F424243

General Info

Members Datasets Scaffolds Average Seq Length
367 185 734 284

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100001138|Ga0068869_10000113811
Length 310
Sequence VNGQGKSPLLFLLFTFHSSLFASSMAAIRTQKEIRQRAPIWLAVLLLTNLVIMAVDARDSVTRQRLLRVWVQALVSPAQSISSGASGASTNFVKQIVNFRGAAIENERLKQELSTAQLELRKAQNLKEQTGYDQVNARVIARDSSIWFNTITINRGSSSGIALNMPVATGSGIVGRVIALSPWTAQVMMITDEKAAAGAIVGQLGGSGAHGSIRGLGEKGLVEMRYVSGLEKVELGDYILTTGQDGIYPPGLTIGEVVQVSPGTATQSHQILVKPGAKFDQLEEVAVLLYHPPPRPAPEQTLPNVDKTKK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100001138 3300005334 Bacteria 15509
2 MBSR1b_contig_12955374 2162886012 Unclassified 986
3 JGI24751J29686_10000059 3300002459 Bacteria 61971
4 JGI25406J46586_10011864 3300003203 Bacteria 3804
5 Ga0065704_10007582 3300005289 Bacteria 3859
6 Ga0065715_10004777 3300005293 Bacteria 5959
7 Ga0065715_10013211 3300005293 Bacteria 2346
8 Ga0065715_10100152 3300005293 Bacteria 3331
9 Ga0065715_10100615 3300005293 Unclassified 3284
10 Ga0065715_10220539 3300005293 Bacteria 1274
11 Ga0065707_10010226 3300005295 Bacteria 2137
12 Ga0065707_10222867 3300005295 Unclassified 1218
13 Ga0070676_10030393 3300005328 Bacteria 3080
14 Ga0070690_100000612 3300005330 Bacteria 18067
15 Ga0070690_100008137 3300005330 Bacteria 6026
16 Ga0070690_100098723 3300005330 Bacteria 1933
17 Ga0070670_100016850 3300005331 Bacteria 6272
18 Ga0070670_100027126 3300005331 Bacteria 4926
19 Ga0070670_100102710 3300005331 Unclassified 2462
20 Ga0070670_100124984 3300005331 Bacteria 2220
21 Ga0068869_100006262 3300005334 Bacteria 7535
22 Ga0068869_100040218 3300005334 Bacteria 3343
23 Ga0070680_100004986 3300005336 Bacteria 10004
24 Ga0070682_100000112 3300005337 Bacteria 72106
25 Ga0068868_100005161 3300005338 Bacteria 9167
26 Ga0068868_100011202 3300005338 Bacteria 6530
27 Ga0070689_100050611 3300005340 Unclassified 3210
28 Ga0070691_10064450 3300005341 Bacteria 1768
29 Ga0070687_100007607 3300005343 Unclassified 4531
30 Ga0070687_100011056 3300005343 Bacteria 3932
31 Ga0070687_100089059 3300005343 Bacteria 1703
32 Ga0070692_10002317 3300005345 Bacteria 7339
33 Ga0070692_10098886 3300005345 Unclassified 1597
34 Ga0070692_10178656 3300005345 Unclassified 1229
35 Ga0070669_100002338 3300005353 Bacteria 13706
36 Ga0070669_100003575 3300005353 Bacteria 11217
37 Ga0070669_100134214 3300005353 Bacteria 1902
38 Ga0070669_100192587 3300005353 Bacteria 1600
39 Ga0070675_100017970 3300005354 Bacteria 5627
40 Ga0070675_100018323 3300005354 Bacteria 5573
41 Ga0070671_100001508 3300005355 Bacteria 17436
42 Ga0070671_100013718 3300005355 Bacteria 6536
43 Ga0070671_100041515 3300005355 Bacteria 3824
44 Ga0070674_100039133 3300005356 Unclassified 3201
45 Ga0070673_100028613 3300005364 Unclassified 4146
46 Ga0070667_100106338 3300005367 Bacteria 2429
47 Ga0070701_10091164 3300005438 Bacteria 1670
48 Ga0070705_100010818 3300005440 Bacteria 4580
49 Ga0070705_100013010 3300005440 Bacteria 4247
50 Ga0070705_100291766 3300005440 Bacteria 1164
51 Ga0070705_100319522 3300005440 Bacteria 1120
52 Ga0070700_100011225 3300005441 Bacteria 4960
53 Ga0070700_100083629 3300005441 Bacteria 2066
54 Ga0070694_100016103 3300005444 Bacteria 4706
55 Ga0070694_100171165 3300005444 Bacteria 1600
56 Ga0070694_100194039 3300005444 Bacteria 1510
57 Ga0070694_100393612 3300005444 Unclassified 1083
58 Ga0070708_100000756 3300005445 Bacteria 24364
59 Ga0070708_100058192 3300005445 Bacteria 3443
60 Ga0070678_100019092 3300005456 Unclassified 4459
61 Ga0070662_100189029 3300005457 Bacteria 1627
62 Ga0070662_100309558 3300005457 Bacteria 1285
63 Ga0070681_10000089 3300005458 Bacteria 68795
64 Ga0068867_100021153 3300005459 Bacteria 4640
65 Ga0068867_100091923 3300005459 Unclassified 2304
66 Ga0070685_10006791 3300005466 Bacteria 5842
67 Ga0070706_100000555 3300005467 Bacteria 43489
68 Ga0070706_100008193 3300005467 Bacteria 9752
69 Ga0070706_100017296 3300005467 Bacteria 6655
70 Ga0070706_100238406 3300005467 Bacteria 1698
71 Ga0070706_100368163 3300005467 Bacteria 1339
72 Ga0070707_100093762 3300005468 Bacteria 2907
73 Ga0070707_100105629 3300005468 Bacteria 2730
74 Ga0070707_100130291 3300005468 Bacteria 2446
75 Ga0070707_100356981 3300005468 Bacteria 1420
76 Ga0070698_100007629 3300005471 Bacteria 11707
77 Ga0070698_100010525 3300005471 Bacteria 9859
78 Ga0070698_100032612 3300005471 Bacteria 5394
79 Ga0070698_100387726 3300005471 Bacteria 1330
80 Ga0070699_100022173 3300005518 Bacteria 5472
81 Ga0070699_100031967 3300005518 Bacteria 4544
82 Ga0070699_100093838 3300005518 Unclassified 2626
83 Ga0070679_100000014 3300005530 Bacteria 150481
84 Ga0070697_100000160 3300005536 Bacteria 54910
85 Ga0070697_100000229 3300005536 Bacteria 45809
86 Ga0070697_100004763 3300005536 Bacteria 10400
87 Ga0070697_100037594 3300005536 Bacteria 3911
88 Ga0070697_100113251 3300005536 Bacteria 2263
89 Ga0070697_100211108 3300005536 Bacteria 1653
90 Ga0068853_100030271 3300005539 Bacteria 4571
91 Ga0068853_100116049 3300005539 Bacteria 2384
92 Ga0070672_100015915 3300005543 Bacteria 5372
93 Ga0070672_100196588 3300005543 Bacteria 1685
94 Ga0070672_100290061 3300005543 Unclassified 1385
95 Ga0070686_100012653 3300005544 Bacteria 4811
96 Ga0070695_100041634 3300005545 Bacteria 2912
97 Ga0070695_100044281 3300005545 Bacteria 2833
98 Ga0070696_100013996 3300005546 Bacteria 5386
99 Ga0070696_100020654 3300005546 Bacteria 4463
100 Ga0070696_100100151 3300005546 Unclassified 2075
101 Ga0070696_100127124 3300005546 Bacteria 1850
102 Ga0070696_100181053 3300005546 Bacteria 1563
103 Ga0070693_100141840 3300005547 Bacteria 1513
104 Ga0070665_100222643 3300005548 Bacteria 1887
105 Ga0070704_100008216 3300005549 Bacteria 6243
106 Ga0070664_100106290 3300005564 Bacteria 2445
107 Ga0068857_100168403 3300005577 Bacteria 1991
108 Ga0068856_100022336 3300005614 Bacteria 6149
109 Ga0070702_100002731 3300005615 Bacteria 7715
110 Ga0070702_100014242 3300005615 Bacteria 4032
111 Ga0070702_100164756 3300005615 Bacteria 1436
112 Ga0070702_100293998 3300005615 Bacteria 1121
113 Ga0070702_100299741 3300005615 Bacteria 1111
114 Ga0068852_100041887 3300005616 Unclassified 3874
115 Ga0068859_100042761 3300005617 Bacteria 4552
116 Ga0068859_100257008 3300005617 Bacteria 1837
117 Ga0068859_100295125 3300005617 Bacteria 1714
118 Ga0068864_100002051 3300005618 Bacteria 16634
119 Ga0068864_100046470 3300005618 Bacteria 3725
120 Ga0068864_100061032 3300005618 Bacteria 3265
121 Ga0068864_100071873 3300005618 Unclassified 3014
122 Ga0068866_10003424 3300005718 Bacteria 6502
123 Ga0068861_100018556 3300005719 Bacteria 4955
124 Ga0068861_100121841 3300005719 Bacteria 2105
125 Ga0068870_10003712 3300005840 Bacteria 6488
126 Ga0068863_100020663 3300005841 Bacteria 6290
127 Ga0068863_100159616 3300005841 Bacteria 2160
128 Ga0068858_100025414 3300005842 Bacteria 5511
129 Ga0068858_100482845 3300005842 Unclassified 1196
130 Ga0068860_100025725 3300005843 Bacteria 5676
131 Ga0068860_100025977 3300005843 Bacteria 5650
132 Ga0068860_100054875 3300005843 Bacteria 3787
133 Ga0068860_100095959 3300005843 Bacteria 2826
134 Ga0068860_100349316 3300005843 Bacteria 1455
135 Ga0068862_100013843 3300005844 Bacteria 6685
136 Ga0081540_1094624 3300005983 Bacteria 1304
137 Ga0081539_10001333 3300005985 Bacteria 43002
138 Ga0097621_100002613 3300006237 Bacteria 12337
139 Ga0097621_100012062 3300006237 Bacteria 6394
140 Ga0097621_100012234 3300006237 Bacteria 6351
141 Ga0097621_100035796 3300006237 Bacteria 3968
142 Ga0068871_100002843 3300006358 Bacteria 11858
143 Ga0068871_100020794 3300006358 Bacteria 5033
144 Ga0068871_100294659 3300006358 Bacteria 1422
145 Ga0075431_100343201 3300006847 Bacteria 1502
146 Ga0075431_100590363 3300006847 Unclassified 1095
147 Ga0075433_10015577 3300006852 Bacteria 6243
148 Ga0075433_10107390 3300006852 Bacteria 2475
149 Ga0075433_10226265 3300006852 Bacteria 1661
150 Ga0075434_100062942 3300006871 Bacteria 3693
151 Ga0075434_100072634 3300006871 Bacteria 3432
152 Ga0075434_100499269 3300006871 Bacteria 1238
153 Ga0068865_100044904 3300006881 Bacteria 3027
154 Ga0097620_100042762 3300006931 Bacteria 4552
155 Ga0097620_100257010 3300006931 Bacteria 1837
156 Ga0097620_100295131 3300006931 Bacteria 1714
157 Ga0111539_10199446 3300009094 Bacteria 2334
158 Ga0111539_10714568 3300009094 Bacteria 1166
159 Ga0105245_10018988 3300009098 Bacteria 6017
160 Ga0105247_10433166 3300009101 Bacteria 944
161 Ga0114129_10003316 3300009147 Bacteria 22613
162 Ga0114129_10005912 3300009147 Bacteria 17312
163 Ga0114129_10024891 3300009147 Bacteria 8487
164 Ga0114129_10278859 3300009147 Bacteria 2234
165 Ga0114129_10465123 3300009147 Bacteria 1657
166 Ga0114129_11030499 3300009147 Bacteria 1034
167 Ga0105243_10015779 3300009148 Bacteria 5713
168 Ga0105243_10107617 3300009148 Bacteria 2326
169 Ga0105243_10144219 3300009148 Unclassified 2035
170 Ga0105243_10580067 3300009148 Bacteria 1076
171 Ga0105241_10386574 3300009174 Bacteria 1224
172 Ga0105242_10009321 3300009176 Bacteria 7537
173 Ga0105242_10066886 3300009176 Bacteria 2969
174 Ga0105242_10390203 3300009176 Bacteria 1296
175 Ga0105248_10007714 3300009177 Bacteria 11820
176 Ga0105248_10015032 3300009177 Bacteria 8522
177 Ga0105248_10100456 3300009177 Unclassified 3260
178 Ga0105248_10387100 3300009177 Bacteria 1574
179 Ga0105248_10606810 3300009177 Unclassified 1235
180 Ga0105237_10002216 3300009545 Bacteria 24329
181 Ga0105237_10558952 3300009545 Bacteria 1151
182 Ga0105238_10004301 3300009551 Bacteria 14132
183 Ga0105249_10007814 3300009553 Bacteria 9313
184 Ga0105249_10027282 3300009553 Bacteria 5152
185 Ga0105249_10127077 3300009553 Bacteria 2429
186 Ga0105239_10200455 3300010375 Bacteria 2236
187 Ga0105239_10240696 3300010375 Unclassified 2031
188 Ga0105246_10100323 3300011119 Unclassified 2106
189 Ga0157374_10040966 3300013296 Unclassified 4266
190 Ga0157374_10116658 3300013296 Archaea 2573
191 Ga0157378_10004573 3300013297 Bacteria 12136
192 Ga0157378_10008763 3300013297 Bacteria 8808
193 Ga0157378_10014311 3300013297 Bacteria 6946
194 Ga0157378_10121882 3300013297 Bacteria 2404
195 Ga0157378_10170783 3300013297 Bacteria 2039
196 Ga0157378_10178877 3300013297 Bacteria 1994
197 Ga0163162_10000734 3300013306 Bacteria 30397
198 Ga0163162_10055757 3300013306 Bacteria 3980
199 Ga0157372_10050474 3300013307 Bacteria 4628
200 Ga0157372_11031352 3300013307 Bacteria 952
201 Ga0157375_10010202 3300013308 Bacteria 8267
202 Ga0157375_10110615 3300013308 Bacteria 2845
203 Ga0157375_10113089 3300013308 Bacteria 2816
204 Ga0157375_10186541 3300013308 Unclassified 2228
205 Ga0157375_10236432 3300013308 Bacteria 1986
206 Ga0163163_10004215 3300014325 Bacteria 12256
207 Ga0157380_10000207 3300014326 Bacteria 34905
208 Ga0157380_10001969 3300014326 Bacteria 13678
209 Ga0157380_10010718 3300014326 Bacteria 6606
210 Ga0157380_10012652 3300014326 Bacteria 6125
211 Ga0157380_10021774 3300014326 Bacteria 4814
212 Ga0157377_10036183 3300014745 Unclassified 2714
213 Ga0157379_10068444 3300014968 Bacteria 3174
214 Ga0157379_10158613 3300014968 Bacteria 2042
215 Ga0157376_10006987 3300014969 Bacteria 8008
216 Ga0163161_10004656 3300017792 Bacteria 9540
217 Ga0163161_10212115 3300017792 Bacteria 1496
218 Ga0163161_10279631 3300017792 Unclassified 1309
219 Ga0213876_10000033 3300021384 Bacteria 205318
220 Ga0213876_10022227 3300021384 Bacteria 3354
221 Ga0207697_10006162 3300025315 Bacteria 5472
222 Ga0207653_10005924 3300025885 Bacteria 3815
223 Ga0207642_10134869 3300025899 Bacteria 1293
224 Ga0207688_10087726 3300025901 Bacteria 1784
225 Ga0207680_10016499 3300025903 Unclassified 3879
226 Ga0207680_10156364 3300025903 Bacteria 1525
227 Ga0207647_10005301 3300025904 Bacteria 9476
228 Ga0207645_10024088 3300025907 Bacteria 3949
229 Ga0207643_10030525 3300025908 Unclassified 3000
230 Ga0207643_10135551 3300025908 Bacteria 1467
231 Ga0207684_10000085 3300025910 Bacteria 175922
232 Ga0207684_10009660 3300025910 Bacteria 8508
233 Ga0207684_10020364 3300025910 Bacteria 5667
234 Ga0207684_10154565 3300025910 Bacteria 1974
235 Ga0207654_10123681 3300025911 Bacteria 1628
236 Ga0207707_10000016 3300025912 Bacteria 256002
237 Ga0207695_10119376 3300025913 Bacteria 2607
238 Ga0207671_10010573 3300025914 Bacteria 7597
239 Ga0207671_10096660 3300025914 Bacteria 2232
240 Ga0207660_10002053 3300025917 Bacteria 13367
241 Ga0207662_10001801 3300025918 Bacteria 10515
242 Ga0207662_10020813 3300025918 Bacteria 3745
243 Ga0207652_10000126 3300025921 Bacteria 82522
244 Ga0207646_10185995 3300025922 Bacteria 1876
245 Ga0207694_10015947 3300025924 Bacteria 5670
246 Ga0207650_10040890 3300025925 Bacteria 3395
247 Ga0207650_10109567 3300025925 Bacteria 2136
248 Ga0207659_10010474 3300025926 Bacteria 5829
249 Ga0207659_10068090 3300025926 Bacteria 2588
250 Ga0207687_10193000 3300025927 Unclassified 1586
251 Ga0207644_10014651 3300025931 Bacteria 5251
252 Ga0207644_10031680 3300025931 Bacteria 3685
253 Ga0207644_10033060 3300025931 Bacteria 3612
254 Ga0207690_10160220 3300025932 Bacteria 1677
255 Ga0207686_10004869 3300025934 Bacteria 7216
256 Ga0207686_10294231 3300025934 Bacteria 1203
257 Ga0207709_10006884 3300025935 Bacteria 6363
258 Ga0207709_10169220 3300025935 Unclassified 1532
259 Ga0207691_10006377 3300025940 Bacteria 11396
260 Ga0207691_10224720 3300025940 Bacteria 1627
261 Ga0207711_10002913 3300025941 Bacteria 15003
262 Ga0207711_10013068 3300025941 Bacteria 6897
263 Ga0207711_10035971 3300025941 Bacteria 4200
264 Ga0207711_10127460 3300025941 Bacteria 2278
265 Ga0207689_10004678 3300025942 Bacteria 12353
266 Ga0207689_10005863 3300025942 Bacteria 10888
267 Ga0207689_10029992 3300025942 Bacteria 4535
268 Ga0207689_10206280 3300025942 Bacteria 1623
269 Ga0207679_10011076 3300025945 Bacteria 5823
270 Ga0207712_10078185 3300025961 Unclassified 2400
271 Ga0207712_10113451 3300025961 Bacteria 2037
272 Ga0207712_10197416 3300025961 Bacteria 1593
273 Ga0207640_10147231 3300025981 Bacteria 1725
274 Ga0207658_10015645 3300025986 Bacteria 5208
275 Ga0207677_10056968 3300026023 Bacteria 2681
276 Ga0207677_10181796 3300026023 Bacteria 1655
277 Ga0207703_10012859 3300026035 Bacteria 6527
278 Ga0207703_10069336 3300026035 Bacteria 2908
279 Ga0207703_10156720 3300026035 Bacteria 1991
280 Ga0207703_10290416 3300026035 Bacteria 1488
281 Ga0207639_10173916 3300026041 Bacteria 1826
282 Ga0207708_10017306 3300026075 Bacteria 5426
283 Ga0207708_10047439 3300026075 Bacteria 3270
284 Ga0207708_10052140 3300026075 Bacteria 3116
285 Ga0207708_10192386 3300026075 Unclassified 1624
286 Ga0207641_10021728 3300026088 Bacteria 5274
287 Ga0207641_10062434 3300026088 Bacteria 3180
288 Ga0207641_10070737 3300026088 Bacteria 2999
289 Ga0207641_10247766 3300026088 Bacteria 1663
290 Ga0207641_10474556 3300026088 Unclassified 1212
291 Ga0207648_10284029 3300026089 Bacteria 1480
292 Ga0207648_10479740 3300026089 Unclassified 1136
293 Ga0207676_10315495 3300026095 Unclassified 1433
294 Ga0207674_10552435 3300026116 Archaea 1112
295 Ga0207675_100001843 3300026118 Bacteria 21273
296 Ga0207675_100004607 3300026118 Bacteria 13286
297 Ga0207675_100135237 3300026118 Bacteria 2338
298 Ga0207675_100265747 3300026118 Bacteria 1664
299 Ga0207683_10024011 3300026121 Bacteria 5247
300 Ga0207698_10139625 3300026142 Unclassified 2085
301 Ga0207698_10181870 3300026142 Unclassified 1863
302 Ga0207428_10092058 3300027907 Bacteria 2353
303 Ga0268265_10166185 3300028380 Bacteria 1881
304 Ga0268265_10337773 3300028380 Bacteria 1370
305 Ga0268264_10042430 3300028381 Unclassified 3765
306 Ga0268264_10060189 3300028381 Unclassified 3182
307 Ga0268264_10083649 3300028381 Bacteria 2734
308 Ga0268264_10324982 3300028381 Bacteria 1456
309 Ga0307513_10002098 3300031456 Bacteria 27997
310 Ga0307408_100004717 3300031548 Bacteria 9202
311 Ga0307405_10048224 3300031731 Bacteria 2626
312 Ga0307406_10111193 3300031901 Bacteria 1887
313 Ga0307407_10379725 3300031903 Bacteria 1009
314 Ga0307409_100019733 3300031995 Bacteria 4574
315 Ga0307416_100181040 3300032002 Bacteria 1975
316 Ga0307414_10025042 3300032004 Bacteria 3814
317 Ga0307411_10120809 3300032005 Bacteria 1895
318 Ga0307415_100017711 3300032126 Bacteria 4277
319 Ga0307415_100109798 3300032126 Bacteria 2044
320 Ga0307415_100557545 3300032126 Bacteria 1012
321 Ga0373930_0023987 3300034816 Unclassified 1217
322 Ga0373931_0053004 3300035691 Bacteria 2164
323 Ga0373937_0048672 3300036401 Bacteria 3881
324 Ga0395900_0255479 3300037418 Bacteria 1752
325 Ga0395900_0472772 3300037418 Bacteria 1207
326 Ga0395900_0516565 3300037418 Unclassified 1143
327 Ga0395905_0010752 3300037471 Bacteria 8874
328 Ga0436364_0435429 3300037853 Bacteria 1609
329 Ga0395901_0247555 3300038443 Bacteria 1858
330 Ga0242420_012570 3300038996 Unclassified 1435
331 Ga0436365_0198252 3300039437 Bacteria 179679
332 Ga0436365_1008175 3300039437 Bacteria 10626
333 Ga0436365_1311852 3300039437 Bacteria 65317
334 Ga0439434_0004315 3300042435 Bacteria 4157
335 Ga0439464_0035271 3300042439 Bacteria 1412
336 Ga0451576_0108632 3300045051 Bacteria 2887
337 Ga0495663_0000097 3300046525 Bacteria 36409
338 Ga0495598_0000557 3300046537 Bacteria 6985
339 Ga0495598_0037900 3300046537 Unclassified 1393
340 Ga0495621_0000647 3300046539 Bacteria 8767
341 Ga0495621_0027198 3300046539 Bacteria 1935
342 Ga0495656_0165322 3300046615 Unclassified 1078
343 Ga0495668_0048801 3300046616 Bacteria 2348
344 Ga0496102_0034583 3300048905 Bacteria 4545
345 Ga0496104_0157125 3300048907 Bacteria 2182
346 Ga0496106_0134940 3300048909 Bacteria 1938
347 Ga0496112_0396445 3300048915 Bacteria 1320
348 Ga0496113_0227374 3300048916 Bacteria 1487
349 Ga0501217_000177 3300049661 Bacteria 9316
350 Ga0501224_000816 3300049664 Bacteria 3951
351 Ga0501227_002079 3300049665 Bacteria 4435
352 Ga0501233_005380 3300049668 Bacteria 2376
353 Ga0501225_0002715 3300049705 Bacteria 5434
354 Ga0501083_0292960 3300049744 Unclassified 1059
355 nmdc:mga05p37_22778_c1 3300050507 Bacteria 7597
356 nmdc:mga05p37_405090_c1 3300050507 Bacteria 1592
357 nmdc:mga0qj67_381678_c1 3300050509 Bacteria 1138
358 nmdc:mga06r32_51229_c1 3300050510 Bacteria 3950
359 nmdc:mga08y16_496977_c1 3300050511 Unclassified 1240
360 nmdc:mga08y16_519562_c1 3300050511 Bacteria 1208
361 nmdc:mga0n895_167760_c1 3300050512 Bacteria 2227
362 nmdc:mga0n895_576023_c1 3300050512 Bacteria 1130
363 nmdc:mga0n895_59996_c1 3300050512 Bacteria 3753
364 nmdc:mga0n895_99298_c1 3300050512 Bacteria 2919
365 nmdc:mga0a205_3680_c1 3300050515 Bacteria 13725
366 nmdc:mga0a205_429856_c1 3300050515 Bacteria 1182
367 nmdc:mga0a205_483223_c1 3300050515 Unclassified 1097
368 Ga0068869_100001138
369 MBSR1b_contig_12955374
370 JGI24751J29686_10000059
371 JGI25406J46586_10011864
372 Ga0065704_10007582
373 Ga0065715_10004777
374 Ga0065715_10013211
375 Ga0065715_10100152
376 Ga0065715_10100615
377 Ga0065715_10220539
378 Ga0065707_10010226
379 Ga0065707_10222867
380 Ga0070676_10030393
381 Ga0070690_100000612
382 Ga0070690_100008137
383 Ga0070690_100098723
384 Ga0070670_100016850
385 Ga0070670_100027126
386 Ga0070670_100102710
387 Ga0070670_100124984
388 Ga0068869_100006262
389 Ga0068869_100040218
390 Ga0070680_100004986
391 Ga0070682_100000112
392 Ga0068868_100005161
393 Ga0068868_100011202
394 Ga0070689_100050611
395 Ga0070691_10064450
396 Ga0070687_100007607
397 Ga0070687_100011056
398 Ga0070687_100089059
399 Ga0070692_10002317
400 Ga0070692_10098886
401 Ga0070692_10178656
402 Ga0070669_100002338
403 Ga0070669_100003575
404 Ga0070669_100134214
405 Ga0070669_100192587
406 Ga0070675_100017970
407 Ga0070675_100018323
408 Ga0070671_100001508
409 Ga0070671_100013718
410 Ga0070671_100041515
411 Ga0070674_100039133
412 Ga0070673_100028613
413 Ga0070667_100106338
414 Ga0070701_10091164
415 Ga0070705_100010818
416 Ga0070705_100013010
417 Ga0070705_100291766
418 Ga0070705_100319522
419 Ga0070700_100011225
420 Ga0070700_100083629
421 Ga0070694_100016103
422 Ga0070694_100171165
423 Ga0070694_100194039
424 Ga0070694_100393612
425 Ga0070708_100000756
426 Ga0070708_100058192
427 Ga0070678_100019092
428 Ga0070662_100189029
429 Ga0070662_100309558
430 Ga0070681_10000089
431 Ga0068867_100021153
432 Ga0068867_100091923
433 Ga0070685_10006791
434 Ga0070706_100000555
435 Ga0070706_100008193
436 Ga0070706_100017296
437 Ga0070706_100238406
438 Ga0070706_100368163
439 Ga0070707_100093762
440 Ga0070707_100105629
441 Ga0070707_100130291
442 Ga0070707_100356981
443 Ga0070698_100007629
444 Ga0070698_100010525
445 Ga0070698_100032612
446 Ga0070698_100387726
447 Ga0070699_100022173
448 Ga0070699_100031967
449 Ga0070699_100093838
450 Ga0070679_100000014
451 Ga0070697_100000160
452 Ga0070697_100000229
453 Ga0070697_100004763
454 Ga0070697_100037594
455 Ga0070697_100113251
456 Ga0070697_100211108
457 Ga0068853_100030271
458 Ga0068853_100116049
459 Ga0070672_100015915
460 Ga0070672_100196588
461 Ga0070672_100290061
462 Ga0070686_100012653
463 Ga0070695_100041634
464 Ga0070695_100044281
465 Ga0070696_100013996
466 Ga0070696_100020654
467 Ga0070696_100100151
468 Ga0070696_100127124
469 Ga0070696_100181053
470 Ga0070693_100141840
471 Ga0070665_100222643
472 Ga0070704_100008216
473 Ga0070664_100106290
474 Ga0068857_100168403
475 Ga0068856_100022336
476 Ga0070702_100002731
477 Ga0070702_100014242
478 Ga0070702_100164756
479 Ga0070702_100293998
480 Ga0070702_100299741
481 Ga0068852_100041887
482 Ga0068859_100042761
483 Ga0068859_100257008
484 Ga0068859_100295125
485 Ga0068864_100002051
486 Ga0068864_100046470
487 Ga0068864_100061032
488 Ga0068864_100071873
489 Ga0068866_10003424
490 Ga0068861_100018556
491 Ga0068861_100121841
492 Ga0068870_10003712
493 Ga0068863_100020663
494 Ga0068863_100159616
495 Ga0068858_100025414
496 Ga0068858_100482845
497 Ga0068860_100025725
498 Ga0068860_100025977
499 Ga0068860_100054875
500 Ga0068860_100095959
501 Ga0068860_100349316
502 Ga0068862_100013843
503 Ga0081540_1094624
504 Ga0081539_10001333
505 Ga0097621_100002613
506 Ga0097621_100012062
507 Ga0097621_100012234
508 Ga0097621_100035796
509 Ga0068871_100002843
510 Ga0068871_100020794
511 Ga0068871_100294659
512 Ga0075431_100343201
513 Ga0075431_100590363
514 Ga0075433_10015577
515 Ga0075433_10107390
516 Ga0075433_10226265
517 Ga0075434_100062942
518 Ga0075434_100072634
519 Ga0075434_100499269
520 Ga0068865_100044904
521 Ga0097620_100042762
522 Ga0097620_100257010
523 Ga0097620_100295131
524 Ga0111539_10199446
525 Ga0111539_10714568
526 Ga0105245_10018988
527 Ga0105247_10433166
528 Ga0114129_10003316
529 Ga0114129_10005912
530 Ga0114129_10024891
531 Ga0114129_10278859
532 Ga0114129_10465123
533 Ga0114129_11030499
534 Ga0105243_10015779
535 Ga0105243_10107617
536 Ga0105243_10144219
537 Ga0105243_10580067
538 Ga0105241_10386574
539 Ga0105242_10009321
540 Ga0105242_10066886
541 Ga0105242_10390203
542 Ga0105248_10007714
543 Ga0105248_10015032
544 Ga0105248_10100456
545 Ga0105248_10387100
546 Ga0105248_10606810
547 Ga0105237_10002216
548 Ga0105237_10558952
549 Ga0105238_10004301
550 Ga0105249_10007814
551 Ga0105249_10027282
552 Ga0105249_10127077
553 Ga0105239_10200455
554 Ga0105239_10240696
555 Ga0105246_10100323
556 Ga0157374_10040966
557 Ga0157374_10116658
558 Ga0157378_10004573
559 Ga0157378_10008763
560 Ga0157378_10014311
561 Ga0157378_10121882
562 Ga0157378_10170783
563 Ga0157378_10178877
564 Ga0163162_10000734
565 Ga0163162_10055757
566 Ga0157372_10050474
567 Ga0157372_11031352
568 Ga0157375_10010202
569 Ga0157375_10110615
570 Ga0157375_10113089
571 Ga0157375_10186541
572 Ga0157375_10236432
573 Ga0163163_10004215
574 Ga0157380_10000207
575 Ga0157380_10001969
576 Ga0157380_10010718
577 Ga0157380_10012652
578 Ga0157380_10021774
579 Ga0157377_10036183
580 Ga0157379_10068444
581 Ga0157379_10158613
582 Ga0157376_10006987
583 Ga0163161_10004656
584 Ga0163161_10212115
585 Ga0163161_10279631
586 Ga0213876_10000033
587 Ga0213876_10022227
588 Ga0207697_10006162
589 Ga0207653_10005924
590 Ga0207642_10134869
591 Ga0207688_10087726
592 Ga0207680_10016499
593 Ga0207680_10156364
594 Ga0207647_10005301
595 Ga0207645_10024088
596 Ga0207643_10030525
597 Ga0207643_10135551
598 Ga0207684_10000085
599 Ga0207684_10009660
600 Ga0207684_10020364
601 Ga0207684_10154565
602 Ga0207654_10123681
603 Ga0207707_10000016
604 Ga0207695_10119376
605 Ga0207671_10010573
606 Ga0207671_10096660
607 Ga0207660_10002053
608 Ga0207662_10001801
609 Ga0207662_10020813
610 Ga0207652_10000126
611 Ga0207646_10185995
612 Ga0207694_10015947
613 Ga0207650_10040890
614 Ga0207650_10109567
615 Ga0207659_10010474
616 Ga0207659_10068090
617 Ga0207687_10193000
618 Ga0207644_10014651
619 Ga0207644_10031680
620 Ga0207644_10033060
621 Ga0207690_10160220
622 Ga0207686_10004869
623 Ga0207686_10294231
624 Ga0207709_10006884
625 Ga0207709_10169220
626 Ga0207691_10006377
627 Ga0207691_10224720
628 Ga0207711_10002913
629 Ga0207711_10013068
630 Ga0207711_10035971
631 Ga0207711_10127460
632 Ga0207689_10004678
633 Ga0207689_10005863
634 Ga0207689_10029992
635 Ga0207689_10206280
636 Ga0207679_10011076
637 Ga0207712_10078185
638 Ga0207712_10113451
639 Ga0207712_10197416
640 Ga0207640_10147231
641 Ga0207658_10015645
642 Ga0207677_10056968
643 Ga0207677_10181796
644 Ga0207703_10012859
645 Ga0207703_10069336
646 Ga0207703_10156720
647 Ga0207703_10290416
648 Ga0207639_10173916
649 Ga0207708_10017306
650 Ga0207708_10047439
651 Ga0207708_10052140
652 Ga0207708_10192386
653 Ga0207641_10021728
654 Ga0207641_10062434
655 Ga0207641_10070737
656 Ga0207641_10247766
657 Ga0207641_10474556
658 Ga0207648_10284029
659 Ga0207648_10479740
660 Ga0207676_10315495
661 Ga0207674_10552435
662 Ga0207675_100001843
663 Ga0207675_100004607
664 Ga0207675_100135237
665 Ga0207675_100265747
666 Ga0207683_10024011
667 Ga0207698_10139625
668 Ga0207698_10181870
669 Ga0207428_10092058
670 Ga0268265_10166185
671 Ga0268265_10337773
672 Ga0268264_10042430
673 Ga0268264_10060189
674 Ga0268264_10083649
675 Ga0268264_10324982
676 Ga0307513_10002098
677 Ga0307408_100004717
678 Ga0307405_10048224
679 Ga0307406_10111193
680 Ga0307407_10379725
681 Ga0307409_100019733
682 Ga0307416_100181040
683 Ga0307414_10025042
684 Ga0307411_10120809
685 Ga0307415_100017711
686 Ga0307415_100109798
687 Ga0307415_100557545
688 Ga0373930_0023987
689 Ga0373931_0053004
690 Ga0373937_0048672
691 Ga0395900_0255479
692 Ga0395900_0472772
693 Ga0395900_0516565
694 Ga0395905_0010752
695 Ga0436364_0435429
696 Ga0395901_0247555
697 Ga0242420_012570
698 Ga0436365_0198252
699 Ga0436365_1008175
700 Ga0436365_1311852
701 Ga0439434_0004315
702 Ga0439464_0035271
703 Ga0451576_0108632
704 Ga0495663_0000097
705 Ga0495598_0000557
706 Ga0495598_0037900
707 Ga0495621_0000647
708 Ga0495621_0027198
709 Ga0495656_0165322
710 Ga0495668_0048801
711 Ga0496102_0034583
712 Ga0496104_0157125
713 Ga0496106_0134940
714 Ga0496112_0396445
715 Ga0496113_0227374
716 Ga0501217_000177
717 Ga0501224_000816
718 Ga0501227_002079
719 Ga0501233_005380
720 Ga0501225_0002715
721 Ga0501083_0292960
722 nmdc:mga05p37_22778_c1
723 nmdc:mga05p37_405090_c1
724 nmdc:mga0qj67_381678_c1
725 nmdc:mga06r32_51229_c1
726 nmdc:mga08y16_496977_c1
727 nmdc:mga08y16_519562_c1
728 nmdc:mga0n895_167760_c1
729 nmdc:mga0n895_576023_c1
730 nmdc:mga0n895_59996_c1
731 nmdc:mga0n895_99298_c1
732 nmdc:mga0a205_3680_c1
733 nmdc:mga0a205_429856_c1
734 nmdc:mga0a205_483223_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04085

MreC

rod shape-determining protein MreC

139

289

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zm0-assembly1.cif.gz_AAA crystal structure of mrec from pseudomonas aeruginosa 0.9316 94 248
6zm0-assembly1.cif.gz_AAA crystal structure of mrec from pseudomonas aeruginosa 0.9088 94 248
6zlv-assembly1.cif.gz_A mrec 0.8706 77 249
6zlv-assembly1.cif.gz_A mrec 0.8382 77 249
2qf4-assembly2.cif.gz_B high resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (orthorhombic form) 0.8268 94 249
ID Description Score Start End Superfamily
af_Q2FXS6_104_165_2.40.10.340 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.9273 92 150 2.40.10.340
2qf4A01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8878 94 151 2.40.10.340
2j5uB02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8723 94 251 2.40.10.340
af_Q2FXS6_104_165_2.40.10.340 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8701 92 150 2.40.10.340
2j5uB03 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 2 0.8541 161 236 2.40.10.350
ID Description Score Start End GO Terms
AF-A0A831KFR2-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9338 96 249 GO:0005886
GO:0008360
AF-A0A6J6MFX4-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9333 92 256 GO:0005886
GO:0008360
AF-A0A3M1MYL6-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9303 96 254 GO:0005886
GO:0008360
AF-A0A3M1MYL6-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9246 96 254 GO:0005886
GO:0008360
AF-A0A7Y0AF38-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9134 93 249 GO:0005886
GO:0008360

Map