F424216

General Info

Members Datasets Scaffolds Average Seq Length
367 232 341 414

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000156|JGI25406J46586_1000015628
Length 452
Sequence MMDTGGGVNSAPRAPHLLFLTIGTGGNRTALENERLIFTPFERAVAFRYLRARKGERFVSVIAIFSLVGIGLGVATLIIVMSVMNGFRQELLSRILGLNGHIGVYATXGPLRDFDPIAERIRTLPGVVSATPVVEGQVLMTSEGGGATGGLARGVRPEDLRARAIIADNIRSGSLEDFHGEDAIVIGIRLANRMRVNIGDQITLVSPQGRTTVFGTVPRVRAYTVVAMYEVGMQEYDGSFAFLPLEAAQIYFQQRDAVTQVEVFVQDPTRVREAMREIRNALPGQPLNIISWESANSSFFNAVQVERNVMFLILTLIIVVAAFNIISSLIMLVKDKGKDIAILRTMGATRGAVMRIFLLCGASVGVVGTAAGFLLGLVFCWNIESIRQALQALSGTELFSPEVYFLTRLPAVVDYHEVVQVVGMGLGLSLLATLYPSWRAAKTDPVEMLRSE

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2643221659 Ensifer sp. Root127 Isolate Unclassified
4 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
5 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
6 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
7 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
8 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
9 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
10 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
11 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
12 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
13 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
14 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
15 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
16 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
17 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
18 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
19 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
230 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
231 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
232 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0.27
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0.54
Rhizoplane 0.27
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000696 3300002737 Bacteria 23379
2 JGI25158J39367_1000077 3300002739 Bacteria 22544
3 JGI25152J39213_1000376 3300002773 Bacteria 27463
4 JGI25151J46595_10000465 3300003187 Bacteria 38708
5 JGI25151J46595_10003605 3300003187 Bacteria 8472
6 JGI25406J46586_10000156 3300003203 Bacteria 30235
7 JGI25406J46586_10008619 3300003203 Bacteria 4607
8 JGI25165J46597_1002868 3300003214 Bacteria 4920
9 JGI25405J52794_10003972 3300003911 Bacteria 2619
10 Ga0065165_1003662 3300005262 Bacteria 10490
11 Ga0070658_10046014 3300005327 Bacteria 3530
12 Ga0070683_100018580 3300005329 Bacteria 6162
13 Ga0070683_100059888 3300005329 Bacteria 3537
14 Ga0070683_100061595 3300005329 Bacteria 3489
15 Ga0068869_100042053 3300005334 Bacteria 3275
16 Ga0070666_10012146 3300005335 Bacteria 5425
17 Ga0070660_100058095 3300005339 Bacteria 2999
18 Ga0070661_100085600 3300005344 Bacteria 2330
19 Ga0070674_100007225 3300005356 Bacteria 6538
20 Ga0070688_100128472 3300005365 Bacteria 1706
21 Ga0070667_100028660 3300005367 Bacteria 4637
22 Ga0070694_100029184 3300005444 Bacteria 3598
23 Ga0070678_100113989 3300005456 Bacteria 2120
24 Ga0070681_10001858 3300005458 Bacteria 19063
25 Ga0070681_10044261 3300005458 Bacteria 4455
26 Ga0070706_100028310 3300005467 Bacteria 5159
27 Ga0070706_100064153 3300005467 Bacteria 3395
28 Ga0070698_100101725 3300005471 Bacteria 2845
29 Ga0070679_100001956 3300005530 Bacteria 18491
30 Ga0070684_100079941 3300005535 Bacteria 2891
31 Ga0068853_100077618 3300005539 Bacteria 2901
32 Ga0068853_100192004 3300005539 Bacteria 1856
33 Ga0068853_100226989 3300005539 Bacteria 1707
34 Ga0070695_100032586 3300005545 Bacteria 3258
35 Ga0070696_100166893 3300005546 Bacteria 1625
36 Ga0070696_100167628 3300005546 Bacteria 1622
37 Ga0068855_100135365 3300005563 Bacteria 2811
38 Ga0068856_100052991 3300005614 Bacteria 4002
39 Ga0068856_100122031 3300005614 Bacteria 2608
40 Ga0068852_100077434 3300005616 Bacteria 2940
41 Ga0068859_100251539 3300005617 Bacteria 1858
42 Ga0068858_100061148 3300005842 Bacteria 3481
43 Ga0081455_10006033 3300005937 Bacteria 13120
44 Ga0081455_10075985 3300005937 Bacteria 2769
45 Ga0081538_10002356 3300005981 Bacteria 18584
46 Ga0081538_10025104 3300005981 Bacteria 4217
47 Ga0081540_1000194 3300005983 Bacteria 62934
48 Ga0081539_10000076 3300005985 Bacteria 229037
49 Ga0081539_10001574 3300005985 Bacteria 37718
50 Ga0081539_10092193 3300005985 Bacteria 1563
51 Ga0070717_10088739 3300006028 Bacteria 2607
52 Ga0070717_10241517 3300006028 Bacteria 1593
53 Ga0075368_10007515 3300006042 Bacteria 3845
54 Ga0075363_100021746 3300006048 Bacteria 3236
55 Ga0070712_100001398 3300006175 Bacteria 14669
56 Ga0075366_10049573 3300006195 Bacteria 2491
57 Ga0097621_100000211 3300006237 Bacteria 38289
58 Ga0068871_100015577 3300006358 Bacteria 5696
59 Ga0068871_100024205 3300006358 Bacteria 4705
60 Ga0075434_100007911 3300006871 Bacteria 9852
61 Ga0075436_100047761 3300006914 Bacteria 2953
62 Ga0097620_100251558 3300006931 Bacteria 1858
63 Ga0105240_10110069 3300009093 Bacteria 3335
64 Ga0105240_10129768 3300009093 Bacteria 3025
65 Ga0111539_10000337 3300009094 Bacteria 57733
66 Ga0111539_10149417 3300009094 Bacteria 2735
67 Ga0111539_10225961 3300009094 Bacteria 2180
68 Ga0105245_10007149 3300009098 Bacteria 9790
69 Ga0105245_10126099 3300009098 Bacteria 2397
70 Ga0114129_10003247 3300009147 Bacteria 22816
71 Ga0105241_10027967 3300009174 Bacteria 4199
72 Ga0105241_10029960 3300009174 Bacteria 4064
73 Ga0105242_10048531 3300009176 Bacteria 3451
74 Ga0105248_10017001 3300009177 Bacteria 8011
75 Ga0105248_10038968 3300009177 Bacteria 5321
76 Ga0105237_10075359 3300009545 Bacteria 3365
77 Ga0105238_10032692 3300009551 Bacteria 5294
78 Ga0105238_10045293 3300009551 Bacteria 4444
79 Ga0105238_10057128 3300009551 Bacteria 3913
80 Ga0105239_10309290 3300010375 Bacteria 1781
81 Ga0105246_10037945 3300011119 Bacteria 3236
82 Ga0157370_10020535 3300013104 Bacteria 6594
83 Ga0157369_10002835 3300013105 Bacteria 20690
84 Ga0157369_10038375 3300013105 Bacteria 5237
85 Ga0157369_10053138 3300013105 Bacteria 4380
86 Ga0157369_10391030 3300013105 Bacteria 1443
87 Ga0157374_10061633 3300013296 Bacteria 3514
88 Ga0157378_10041956 3300013297 Bacteria 4060
89 Ga0157378_10128863 3300013297 Bacteria 2340
90 Ga0157378_10426734 3300013297 Bacteria 1311
91 Ga0163162_10156473 3300013306 Bacteria 2399
92 Ga0163162_10254719 3300013306 Bacteria 1887
93 Ga0157375_10010463 3300013308 Bacteria 8164
94 Ga0163163_10114886 3300014325 Bacteria 2723
95 Ga0163163_10134635 3300014325 Bacteria 2512
96 Ga0157379_10090761 3300014968 Bacteria 2741
97 Ga0157379_10098816 3300014968 Bacteria 2620
98 Ga0157379_10104802 3300014968 Bacteria 2538
99 Ga0157376_10017114 3300014969 Bacteria 5522
100 Ga0157376_10121527 3300014969 Bacteria 2315
101 Ga0163161_10127682 3300017792 Bacteria 1916
102 Ga0213872_10009317 3300021361 Bacteria 4712
103 Ga0213875_10000530 3300021388 Bacteria 31543
104 Ga0213875_10001741 3300021388 Bacteria 13635
105 Ga0213875_10003559 3300021388 Bacteria 8840
106 Ga0213875_10016752 3300021388 Bacteria 3549
107 Ga0209437_100023 3300025233 Bacteria 614195
108 Ga0209233_1000062 3300025261 Bacteria 399685
109 Ga0209130_1000167 3300025284 Bacteria 95517
110 Ga0209025_1000077 3300025294 Bacteria 271958
111 Ga0209025_1000188 3300025294 Bacteria 154209
112 Ga0209758_1007903 3300025297 Bacteria 7063
113 Ga0207426_1000239 3300025302 Bacteria 123307
114 Ga0207688_10073139 3300025901 Bacteria 1948
115 Ga0207680_10032044 3300025903 Bacteria 2983
116 Ga0207647_10112542 3300025904 Bacteria 1609
117 Ga0207707_10022751 3300025912 Bacteria 5481
118 Ga0207707_10130192 3300025912 Bacteria 2201
119 Ga0207707_10206800 3300025912 Bacteria 1711
120 Ga0207695_10120505 3300025913 Bacteria 2592
121 Ga0207693_10003439 3300025915 Bacteria 13511
122 Ga0207657_10007135 3300025919 Bacteria 11475
123 Ga0207652_10043220 3300025921 Bacteria 3837
124 Ga0207659_10281842 3300025926 Bacteria 1359
125 Ga0207687_10082664 3300025927 Bacteria 2324
126 Ga0207700_10085284 3300025928 Bacteria 2479
127 Ga0207706_10144225 3300025933 Bacteria 2095
128 Ga0207686_10017974 3300025934 Bacteria 3995
129 Ga0207686_10025804 3300025934 Bacteria 3423
130 Ga0207711_10029220 3300025941 Bacteria 4647
131 Ga0207661_10036678 3300025944 Bacteria 3829
132 Ga0207658_10081440 3300025986 Bacteria 2482
133 Ga0207677_10098991 3300026023 Bacteria 2140
134 Ga0207677_10137729 3300026023 Bacteria 1864
135 Ga0207703_10087580 3300026035 Bacteria 2611
136 Ga0207639_10116903 3300026041 Bacteria 2184
137 Ga0207678_10032829 3300026067 Bacteria 4524
138 Ga0207678_10064988 3300026067 Bacteria 3134
139 Ga0207702_10035333 3300026078 Bacteria 4179
140 Ga0207702_10165115 3300026078 Bacteria 2025
141 Ga0207641_10021216 3300026088 Bacteria 5339
142 Ga0207648_10009980 3300026089 Bacteria 9037
143 Ga0207676_10149789 3300026095 Bacteria 2008
144 Ga0207676_10305339 3300026095 Bacteria 1454
145 Ga0207683_10027589 3300026121 Bacteria 4906
146 Ga0207683_10042725 3300026121 Bacteria 3959
147 Ga0207428_10051970 3300027907 Bacteria 3274
148 Ga0268266_10016716 3300028379 Bacteria 6272
149 Ga0268266_10023965 3300028379 Bacteria 5193
150 Ga0268266_10040266 3300028379 Bacteria 3982
151 Ga0268266_10176909 3300028379 Bacteria 1940
152 Ga0265334_10019298 3300028573 Bacteria 2807
153 Ga0307515_10000070 3300028794 Bacteria 239322
154 Ga0265338_10011285 3300028800 Bacteria 10339
155 Ga0265338_10071569 3300028800 Bacteria 2965
156 Ga0265324_10013177 3300029957 Bacteria 3090
157 Ga0265760_10005736 3300031090 Bacteria 3550
158 Ga0265330_10053851 3300031235 Bacteria 1760
159 Ga0265332_10056944 3300031238 Bacteria 1675
160 Ga0265331_10076516 3300031250 Bacteria 1559
161 Ga0265327_10046268 3300031251 Bacteria 2305
162 Ga0265316_10068856 3300031344 Bacteria 2732
163 Ga0265316_10133643 3300031344 Bacteria 1867
164 Ga0307408_100107326 3300031548 Bacteria 2138
165 Ga0265313_10009216 3300031595 Bacteria 6436
166 Ga0265314_10014552 3300031711 Bacteria 6286
167 Ga0265314_10041274 3300031711 Bacteria 3304
168 Ga0265314_10046286 3300031711 Bacteria 3070
169 Ga0265314_10055819 3300031711 Bacteria 2723
170 Ga0316576_10067200 3300031727 Bacteria 2639
171 Ga0316578_10002302 3300031728 Bacteria 8303
172 Ga0307413_10019707 3300031824 Bacteria 3571
173 Ga0307407_10036947 3300031903 Bacteria 2695
174 Ga0307412_10109451 3300031911 Bacteria 1970
175 Ga0307409_100008031 3300031995 Bacteria 6364
176 Ga0307411_10007231 3300032005 Bacteria 5632
177 Ga0373953_0052803 3300035117 Bacteria 1646
178 Ga0373954_0011468 3300035118 Bacteria 3928
179 Ga0373946_0023185 3300035171 Bacteria 2423
180 Ga0316574_0003278 3300035398 Bacteria 8320
181 Ga0316574_0012298 3300035398 Bacteria 4893
182 Ga0373933_0002645 3300035724 Bacteria 10030
183 Ga0373933_0040010 3300035724 Bacteria 2760
184 Ga0373937_0001341 3300036401 Bacteria 20589
185 Ga0373937_0023418 3300036401 Bacteria 5560
186 Ga0373937_0097238 3300036401 Bacteria 2731
187 Ga0316584_0013044 3300036712 Bacteria 5873
188 Ga0373925_0147751 3300037068 Bacteria 1843
189 Ga0395905_0007381 3300037471 Bacteria 10935
190 Ga0395905_0067081 3300037471 Bacteria 3360
191 Ga0436364_0022735 3300037853 Bacteria 162985
192 Ga0436364_0966921 3300037853 Bacteria 12120
193 Ga0436364_1129754 3300037853 Bacteria 7608
194 Ga0436364_1184534 3300037853 Bacteria 3466
195 Ga0436364_1561563 3300037853 Bacteria 23976
196 Ga0436365_0816294 3300039437 Bacteria 10089
197 Ga0436360_0954632 3300039438 Bacteria 3721
198 Ga0436360_1228146 3300039438 Bacteria 3464
199 Ga0436360_1275743 3300039438 Bacteria 6530
200 Ga0436361_0215588 3300039447 Bacteria 45530
201 Ga0436361_0276378 3300039447 Bacteria 4221
202 Ga0436361_0300922 3300039447 Bacteria 11064
203 Ga0436361_0378965 3300039447 Bacteria 5108
204 Ga0436363_0601770 3300039450 Bacteria 1673
205 Ga0436363_1258587 3300039450 Bacteria 2581
206 Ga0436362_0802871 3300039453 Bacteria 7529
207 Ga0453683_0022538 3300044673 Bacteria 4018
208 Ga0453684_0000006 3300044712 Bacteria 1364191
209 Ga0453684_0000410 3300044712 Bacteria 175627
210 Ga0453684_0210342 3300044712 Bacteria 2261
211 Ga0451576_0001017 3300045051 Bacteria 51874
212 Ga0451576_0013388 3300045051 Bacteria 9177
213 Ga0451576_0087854 3300045051 Bacteria 3233
214 Ga0495617_018445 3300046452 Bacteria 2360
215 Ga0495592_0164232 3300046454 Bacteria 1525
216 Ga0495629_0086342 3300046459 Bacteria 2189
217 Ga0495580_0013337 3300046472 Bacteria 6278
218 Ga0495580_0049145 3300046472 Bacteria 2985
219 Ga0495582_0004012 3300046473 Bacteria 8264
220 Ga0495662_0087556 3300046476 Bacteria 1517
221 Ga0495585_0062131 3300046492 Bacteria 2052
222 Ga0495608_0163242 3300046511 Bacteria 1416
223 Ga0495610_0020976 3300046512 Bacteria 3606
224 Ga0495610_0025598 3300046512 Bacteria 3163
225 Ga0495610_0069065 3300046512 Bacteria 1654
226 Ga0495618_0090401 3300046514 Bacteria 1958
227 Ga0495622_0007824 3300046557 Bacteria 4963
228 Ga0495658_0016812 3300046683 Bacteria 3769
229 Ga0495674_0075331 3300047319 Bacteria 2904
230 Ga0495672_0031526 3300047320 Bacteria 3309
231 Ga0495673_0019955 3300047469 Bacteria 3348
232 Ga0495684_0039883 3300047471 Bacteria 3600
233 Ga0496101_0032518 3300048904 Bacteria 3673
234 Ga0496117_0006248 3300048920 Bacteria 12145
235 Ga0496122_0000883 3300048925 Bacteria 55831
236 Ga0496122_0004624 3300048925 Bacteria 16932
237 Ga0496123_0001542 3300048926 Bacteria 31818
238 Ga0496125_0000889 3300048928 Bacteria 47420
239 Ga0496125_0124109 3300048928 Bacteria 1834
240 Ga0496126_0028792 3300048929 Bacteria 5286
241 Ga0501031_0182622 3300049568 Bacteria 1370
242 Ga0501032_0010121 3300049569 Bacteria 6806
243 Ga0501032_0026837 3300049569 Bacteria 3959
244 Ga0501033_0002052 3300049570 Bacteria 17521
245 Ga0501033_0008858 3300049570 Bacteria 7773
246 Ga0501033_0076068 3300049570 Bacteria 2464
247 Ga0501034_0010929 3300049571 Bacteria 9433
248 Ga0501034_0075820 3300049571 Bacteria 3370
249 Ga0501034_0379762 3300049571 Bacteria 1338
250 Ga0501037_0000227 3300049573 Bacteria 49134
251 Ga0501037_0004512 3300049573 Bacteria 10116
252 Ga0501038_0003682 3300049574 Bacteria 14277
253 Ga0501039_0002395 3300049575 Bacteria 13948
254 Ga0501039_0077286 3300049575 Bacteria 2589
255 Ga0501041_0054503 3300049577 Bacteria 2439
256 Ga0501043_0000396 3300049579 Bacteria 39180
257 Ga0501043_0001899 3300049579 Bacteria 17912
258 Ga0501043_0013980 3300049579 Bacteria 6281
259 Ga0501043_0041418 3300049579 Bacteria 3619
260 Ga0501043_0137352 3300049579 Bacteria 1915
261 Ga0501046_0001214 3300049580 Bacteria 24970
262 Ga0501046_0146849 3300049580 Bacteria 1781
263 Ga0501047_0017198 3300049581 Bacteria 6922
264 Ga0501047_0028841 3300049581 Bacteria 5354
265 Ga0501047_0036340 3300049581 Bacteria 4761
266 Ga0501047_0078442 3300049581 Bacteria 3176
267 Ga0501047_0191927 3300049581 Bacteria 1906
268 Ga0501047_0275155 3300049581 Bacteria 1529
269 Ga0501048_0158690 3300049582 Bacteria 1600
270 Ga0501067_0042158 3300049583 Bacteria 2534
271 Ga0501067_0067736 3300049583 Bacteria 1977
272 Ga0501068_0021019 3300049584 Bacteria 3809
273 Ga0501069_0000066 3300049585 Bacteria 55164
274 Ga0501069_0000068 3300049585 Bacteria 54324
275 Ga0501069_0010778 3300049585 Bacteria 4846
276 Ga0501069_0025450 3300049585 Bacteria 3235
277 Ga0501070_0005111 3300049586 Bacteria 11184
278 Ga0501070_0006143 3300049586 Bacteria 10240
279 Ga0501070_0067783 3300049586 Bacteria 2955
280 Ga0501070_0071849 3300049586 Bacteria 2865
281 Ga0501070_0113872 3300049586 Bacteria 2234
282 Ga0501071_0011166 3300049587 Bacteria 6041
283 Ga0501072_0068103 3300049588 Bacteria 2810
284 Ga0501072_0124267 3300049588 Bacteria 2056
285 Ga0501073_0001156 3300049589 Bacteria 19243
286 Ga0501073_0023833 3300049589 Bacteria 4395
287 Ga0501074_0000239 3300049590 Bacteria 30690
288 Ga0501074_0007293 3300049590 Bacteria 7993
289 Ga0501075_0069622 3300049591 Bacteria 2659
290 Ga0501076_0030286 3300049592 Bacteria 4215
291 Ga0501076_0031862 3300049592 Bacteria 4114
292 Ga0501076_0074312 3300049592 Bacteria 2723
293 Ga0501077_0121867 3300049593 Bacteria 1653
294 Ga0501080_0003335 3300049742 Bacteria 14175
295 Ga0501080_0003618 3300049742 Bacteria 13617
296 Ga0501080_0041884 3300049742 Bacteria 4265
297 Ga0501080_0072760 3300049742 Bacteria 3198
298 Ga0501080_0111736 3300049742 Bacteria 2533
299 Ga0501083_0001381 3300049744 Bacteria 16485
300 Ga0501083_0003711 3300049744 Bacteria 10728
301 Ga0501083_0033143 3300049744 Bacteria 3538
302 Ga0501083_0058667 3300049744 Bacteria 2575
303 Ga0501035_0000185 3300049822 Bacteria 76291
304 Ga0501035_0002631 3300049822 Bacteria 17503
305 Ga0501035_0010445 3300049822 Bacteria 8605
306 Ga0501035_0061010 3300049822 Bacteria 3357
307 Ga0501035_0075745 3300049822 Bacteria 2976
308 Ga0501044_0000003 3300049823 Bacteria 345647
309 Ga0501044_0007053 3300049823 Bacteria 12364
310 Ga0501044_0031309 3300049823 Bacteria 5600
311 Ga0501044_0045759 3300049823 Bacteria 4533
312 Ga0501044_0137213 3300049823 Bacteria 2436
313 nmdc:mga06z11_54263_c1 3300050494 Bacteria 2065
314 nmdc:mga05p37_225_c1 3300050507 Bacteria 57238
315 nmdc:mga09592_244_c1 3300050508 Bacteria 39424
316 nmdc:mga0qj67_2611_c1 3300050509 Bacteria 12909
317 nmdc:mga06r32_731_c1 3300050510 Bacteria 28813
318 nmdc:mga08y16_307116_c1 3300050511 Bacteria 1634
319 nmdc:mga08y16_35316_c1 3300050511 Bacteria 5249
320 nmdc:mga08y16_617_c1 3300050511 Bacteria 33261
321 nmdc:mga0n895_457_c1 3300050512 Bacteria 27383
322 nmdc:mga08x19_21397_c1 3300050514 Bacteria 3991
323 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
324 Ga0495612_0069578 3300053078 Bacteria 1466
325 Ga0500610_0043554 3300053079 Bacteria 2326
326 Ga0500569_003456 3300053109 Bacteria 3232
327 Ga0500593_000050 3300053117 Bacteria 42339
328 Ga0500595_006462 3300053119 Bacteria 4969
329 Ga0500595_008161 3300053119 Bacteria 4294
330 Ga0500652_000750 3300053131 Bacteria 10968
331 Ga0500568_0000001 3300053139 Bacteria 988705
332 Ga0500568_0005282 3300053139 Bacteria 6711
333 Ga0500568_0008233 3300053139 Bacteria 5047
334 Ga0500568_0021171 3300053139 Bacteria 2801
335 Ga0500573_0000008 3300053140 Bacteria 237795
336 Ga0500573_0042483 3300053140 Bacteria 2625
337 Ga0500616_0001786 3300053153 Bacteria 19621
338 Ga0500620_000077 3300053155 Bacteria 18369
339 Ga0501082_0004543 3300060353 Bacteria 12114
340 Ga0501082_0056325 3300060353 Bacteria 3386
341 Ga0501082_0097535 3300060353 Bacteria 2541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0042158 Ga0501067_0042158_1408_2523 356
2 3300039438 Ga0436360_0954632 Ga0436360_0954632_1850_3100 357
3 3300039450 Ga0436363_0601770 Ga0436363_0601770_316_1560 363
4 3300049569 Ga0501032_0026837 Ga0501032_0026837_2285_3508 364
5 3300005937 Ga0081455_10075985 Ga0081455_100759851 365
6 3300021388 Ga0213875_10003559 Ga0213875_100035593 365
7 3300037853 Ga0436364_1561563 Ga0436364_1561563_13052_14302 365
8 3300009098 Ga0105245_10007149 Ga0105245_100071494 367
9 3300011119 Ga0105246_10037945 Ga0105246_100379452 367
10 3300013297 Ga0157378_10128863 Ga0157378_101288632 367
11 3300026023 Ga0207677_10137729 Ga0207677_101377292 367
12 3300026095 Ga0207676_10149789 Ga0207676_101497891 367
13 3300009094 Ga0111539_10000337 Ga0111539_1000033725 370
14 3300009147 Ga0114129_10003247 Ga0114129_1000324724 370
15 3300014325 Ga0163163_10114886 Ga0163163_101148862 370
16 3300046511 Ga0495608_0163242 Ga0495608_0163242_14_1126 370
17 3300049580 Ga0501046_0146849 Ga0501046_0146849_446_1669 370
18 3300049591 Ga0501075_0069622 Ga0501075_0069622_1284_2507 370
19 3300049592 Ga0501076_0031862 Ga0501076_0031862_2304_3527 370
20 3300050507 nmdc:mga05p37_225_c1 nmdc:mga05p37_225_c1_22458_23681 370
21 3300050508 nmdc:mga09592_244_c1 nmdc:mga09592_244_c1_15429_16652 370
22 3300050509 nmdc:mga0qj67_2611_c1 nmdc:mga0qj67_2611_c1_2588_3811 370
23 3300050510 nmdc:mga06r32_731_c1 nmdc:mga06r32_731_c1_5011_6234 370
24 3300050511 nmdc:mga08y16_617_c1 nmdc:mga08y16_617_c1_16460_17683 370
25 3300050512 nmdc:mga0n895_457_c1 nmdc:mga0n895_457_c1_6041_7264 370
26 3300050515 nmdc:mga0a205_1019_c1 nmdc:mga0a205_1019_c1_1587_2810 370
27 3300053119 Ga0500595_008161 Ga0500595_008161_169_1392 370
28 3300053140 Ga0500573_0042483 Ga0500573_0042483_38_1267 370
29 3300049568 Ga0501031_0182622 Ga0501031_0182622_11_1180 371
30 3300049582 Ga0501048_0158690 Ga0501048_0158690_341_1564 371
31 3300053109 Ga0500569_003456 Ga0500569_003456_2096_3211 371
32 3300013105 Ga0157369_10391030 Ga0157369_103910301 376
33 3300060353 Ga0501082_0097535 Ga0501082_0097535_205_1443 376
34 3300049581 Ga0501047_0275155 Ga0501047_0275155_382_1518 377
35 3300031728 Ga0316578_10002302 Ga0316578_100023022 379
36 3300035398 Ga0316574_0012298 Ga0316574_0012298_1336_2607 379
37 3300036712 Ga0316584_0013044 Ga0316584_0013044_236_1507 379
38 3300053139 Ga0500568_0000001 Ga0500568_0000001_403848_405140 379
39 3300006358 Ga0068871_100015577 Ga0068871_1000155777 380
40 3300025934 Ga0207686_10025804 Ga0207686_100258043 380
41 3300026089 Ga0207648_10009980 Ga0207648_100099802 380
42 3300046476 Ga0495662_0087556 Ga0495662_0087556_359_1501 380
43 3300046514 Ga0495618_0090401 Ga0495618_0090401_12_1154 380
44 3300047471 Ga0495684_0039883 Ga0495684_0039883_18_1160 380
45 3300005937 Ga0081455_10006033 Ga0081455_1000603311 381
46 3300049577 Ga0501041_0054503 Ga0501041_0054503_518_1780 383
47 3300049586 Ga0501070_0071849 Ga0501070_0071849_329_1591 383
48 3300049588 Ga0501072_0068103 Ga0501072_0068103_820_2082 383
49 3300049592 Ga0501076_0030286 Ga0501076_0030286_1936_3198 383
50 3300049575 Ga0501039_0077286 Ga0501039_0077286_124_1404 384
51 3300006175 Ga0070712_100001398 Ga0070712_1000013984 385
52 3300014968 Ga0157379_10090761 Ga0157379_100907612 385
53 3300025915 Ga0207693_10003439 Ga0207693_100034394 385
54 3300035724 Ga0373933_0040010 Ga0373933_0040010_448_1743 385
55 3300037068 Ga0373925_0147751 Ga0373925_0147751_200_1495 385
56 3300037471 Ga0395905_0007381 Ga0395905_0007381_914_2218 385
57 3300037471 Ga0395905_0067081 Ga0395905_0067081_1801_3105 385
58 3300039438 Ga0436360_1275743 Ga0436360_1275743_1065_2318 386
59 3300053139 Ga0500568_0008233 Ga0500568_0008233_831_2135 386
60 3300005458 Ga0070681_10001858 Ga0070681_100018588 387
61 3300005530 Ga0070679_100001956 Ga0070679_1000019569 387
62 3300009093 Ga0105240_10110069 Ga0105240_101100692 387
63 3300013104 Ga0157370_10020535 Ga0157370_100205352 387
64 3300025912 Ga0207707_10022751 Ga0207707_100227515 387
65 3300025913 Ga0207695_10120505 Ga0207695_101205052 387
66 3300025921 Ga0207652_10043220 Ga0207652_100432204 387
67 3300031250 Ga0265331_10076516 Ga0265331_100765162 387
68 3300039437 Ga0436365_0816294 Ga0436365_0816294_7843_9096 387
69 3300003187 JGI25151J46595_10003605 JGI25151J46595_100036055 388
70 3300025294 Ga0209025_1000188 Ga0209025_1000188134 388
71 3300048925 Ga0496122_0000883 Ga0496122_0000883_46493_47791 388
72 3300048926 Ga0496123_0001542 Ga0496123_0001542_30215_31513 388
73 3300048928 Ga0496125_0000889 Ga0496125_0000889_30739_32037 388
74 3300039453 Ga0436362_0802871 Ga0436362_0802871_1183_2436 389
75 3300048920 Ga0496117_0006248 Ga0496117_0006248_7954_9252 389
76 3300048928 Ga0496125_0124109 Ga0496125_0124109_276_1580 389
77 3300048929 Ga0496126_0028792 Ga0496126_0028792_2979_4283 389
78 3300031595 Ga0265313_10009216 Ga0265313_100092164 390
79 3300005329 Ga0070683_100059888 Ga0070683_1000598883 391
80 3300005329 Ga0070683_100061595 Ga0070683_1000615952 391
81 3300005335 Ga0070666_10012146 Ga0070666_100121467 391
82 3300005365 Ga0070688_100128472 Ga0070688_1001284722 391
83 3300005367 Ga0070667_100028660 Ga0070667_1000286607 391
84 3300005535 Ga0070684_100079941 Ga0070684_1000799412 391
85 3300005539 Ga0068853_100077618 Ga0068853_1000776183 391
86 3300005539 Ga0068853_100192004 Ga0068853_1001920042 391
87 3300005614 Ga0068856_100052991 Ga0068856_1000529912 391
88 3300005616 Ga0068852_100077434 Ga0068852_1000774344 391
89 3300005842 Ga0068858_100061148 Ga0068858_1000611484 391
90 3300009093 Ga0105240_10129768 Ga0105240_101297682 391
91 3300009174 Ga0105241_10027967 Ga0105241_100279672 391
92 3300009177 Ga0105248_10038968 Ga0105248_100389687 391
93 3300009545 Ga0105237_10075359 Ga0105237_100753595 391
94 3300009551 Ga0105238_10045293 Ga0105238_100452935 391
95 3300009551 Ga0105238_10057128 Ga0105238_100571282 391
96 3300013105 Ga0157369_10038375 Ga0157369_100383757 391
97 3300013296 Ga0157374_10061633 Ga0157374_100616336 391
98 3300013297 Ga0157378_10041956 Ga0157378_100419562 391
99 3300013306 Ga0163162_10156473 Ga0163162_101564732 391
100 3300013306 Ga0163162_10254719 Ga0163162_102547192 391
101 3300013308 Ga0157375_10010463 Ga0157375_100104637 391
102 3300014968 Ga0157379_10104802 Ga0157379_101048022 391
103 3300014969 Ga0157376_10017114 Ga0157376_100171147 391
104 3300025903 Ga0207680_10032044 Ga0207680_100320442 391
105 3300025927 Ga0207687_10082664 Ga0207687_100826642 391
106 3300025944 Ga0207661_10036678 Ga0207661_100366784 391
107 3300025986 Ga0207658_10081440 Ga0207658_100814403 391
108 3300026023 Ga0207677_10098991 Ga0207677_100989912 391
109 3300026035 Ga0207703_10087580 Ga0207703_100875803 391
110 3300026078 Ga0207702_10035333 Ga0207702_100353334 391
111 3300026095 Ga0207676_10305339 Ga0207676_103053391 391
112 3300028379 Ga0268266_10176909 Ga0268266_101769092 391
113 3300037853 Ga0436364_1129754 Ga0436364_1129754_5939_7189 391
114 3300009174 Ga0105241_10029960 Ga0105241_100299602 392
115 3300026121 Ga0207683_10027589 Ga0207683_100275897 392
116 3300037853 Ga0436364_1184534 Ga0436364_1184534_784_2034 393
117 3300045051 Ga0451576_0087854 Ga0451576_0087854_1141_2361 394
118 3300005334 Ga0068869_100042053 Ga0068869_1000420534 395
119 3300005539 Ga0068853_100226989 Ga0068853_1002269892 395
120 3300049593 Ga0501077_0121867 Ga0501077_0121867_219_1478 395
121 iso_pu_bacteria 2844533157 2844536495 395
122 3300005546 Ga0070696_100167628 Ga0070696_1001676281 396
123 3300009094 Ga0111539_10225961 Ga0111539_102259612 396
124 3300021388 Ga0213875_10016752 Ga0213875_100167522 396
125 3300026121 Ga0207683_10042725 Ga0207683_100427252 396
126 3300037853 Ga0436364_0966921 Ga0436364_0966921_10299_11549 396
127 3300046459 Ga0495629_0086342 Ga0495629_0086342_20_1243 396
128 3300049571 Ga0501034_0379762 Ga0501034_0379762_13_1260 396
129 3300050511 nmdc:mga08y16_307116_c1 nmdc:mga08y16_307116_c1_70_1329 396
130 3300053140 Ga0500573_0000008 Ga0500573_0000008_180418_181644 396
131 3300049823 Ga0501044_0045759 Ga0501044_0045759_3296_4522 397
132 3300045051 Ga0451576_0013388 Ga0451576_0013388_1980_3230 398
133 iso_pu_bacteria 2511231221 2512033959 398
134 iso_pu_bacteria 2522572158 2523105278 398
135 iso_pu_bacteria 2821443989 2821447852 398
136 iso_pu_bacteria 2897803580 2897809950 398
137 iso_pu_bacteria 8054002106 8054004555 398
138 3300003187 JGI25151J46595_10000465 JGI25151J46595_1000046518 399
139 3300005327 Ga0070658_10046014 Ga0070658_100460142 399
140 3300005339 Ga0070660_100058095 Ga0070660_1000580952 399
141 3300025284 Ga0209130_1000167 Ga0209130_100016731 399
142 3300025294 Ga0209025_1000077 Ga0209025_100007738 399
143 3300025297 Ga0209758_1007903 Ga0209758_10079036 399
144 3300025302 Ga0207426_1000239 Ga0207426_1000239110 399
145 3300025919 Ga0207657_10007135 Ga0207657_100071356 399
146 3300026067 Ga0207678_10064988 Ga0207678_100649882 399
147 3300028379 Ga0268266_10016716 Ga0268266_100167167 399
148 3300028379 Ga0268266_10023965 Ga0268266_100239652 399
149 3300046512 Ga0495610_0020976 Ga0495610_0020976_229_1476 399
150 3300046512 Ga0495610_0025598 Ga0495610_0025598_202_1449 399
151 3300047469 Ga0495673_0019955 Ga0495673_0019955_480_1727 399
152 3300049569 Ga0501032_0010121 Ga0501032_0010121_2469_3791 399
153 3300049570 Ga0501033_0008858 Ga0501033_0008858_5422_6744 399
154 3300049573 Ga0501037_0000227 Ga0501037_0000227_43540_44862 399
155 3300049579 Ga0501043_0000396 Ga0501043_0000396_4896_6218 399
156 3300049579 Ga0501043_0041418 Ga0501043_0041418_1042_2367 399
157 3300049585 Ga0501069_0000068 Ga0501069_0000068_4457_5779 399
158 3300049585 Ga0501069_0025450 Ga0501069_0025450_1849_3174 399
159 3300049586 Ga0501070_0005111 Ga0501070_0005111_2949_4271 399
160 3300049587 Ga0501071_0011166 Ga0501071_0011166_3314_4636 399
161 3300049590 Ga0501074_0000239 Ga0501074_0000239_5645_6967 399
162 3300049742 Ga0501080_0003335 Ga0501080_0003335_10705_12027 399
163 3300049744 Ga0501083_0003711 Ga0501083_0003711_3668_4990 399
164 3300049822 Ga0501035_0000185 Ga0501035_0000185_65911_67233 399
165 3300049822 Ga0501035_0002631 Ga0501035_0002631_1220_2545 399
166 3300049823 Ga0501044_0000003 Ga0501044_0000003_68951_70273 399
167 3300049823 Ga0501044_0031309 Ga0501044_0031309_258_1583 399
168 iso_pu_bacteria 2821443989 2821447850 399
169 iso_pu_bacteria 2883291878 2883294332 399
170 iso_pu_bacteria 2883354860 2883357144 399
171 iso_pu_bacteria 2909399089 2909400393 399
172 iso_pu_bacteria 2929199973 2929203567 399
173 iso_pu_bacteria 641228493 641336973 399
174 iso_pu_bacteria 643348555 643392858 399
175 iso_pu_bacteria 8055909800 8055911243 399
176 iso_pu_bacteria 2842775625 2842778347 400
177 iso_pu_bacteria 2883577096 2883580533 400
178 iso_pu_bacteria 2894772417 2894772799 400
179 3300006042 Ga0075368_10007515 Ga0075368_100075152 401
180 3300006048 Ga0075363_100021746 Ga0075363_1000217462 401
181 3300013105 Ga0157369_10053138 Ga0157369_100531384 401
182 3300025912 Ga0207707_10206800 Ga0207707_102068002 401
183 3300031711 Ga0265314_10055819 Ga0265314_100558193 401
184 3300044673 Ga0453683_0022538 Ga0453683_0022538_1303_2544 401
185 3300045051 Ga0451576_0001017 Ga0451576_0001017_45505_46746 401
186 3300049571 Ga0501034_0075820 Ga0501034_0075820_1657_2937 401
187 3300050494 nmdc:mga06z11_54263_c1 nmdc:mga06z11_54263_c1_55_1371 401
188 3300005467 Ga0070706_100064153 Ga0070706_1000641533 402
189 3300006195 Ga0075366_10049573 Ga0075366_100495732 402
190 3300017792 Ga0163161_10127682 Ga0163161_101276822 402
191 3300021388 Ga0213875_10000530 Ga0213875_100005302 402
192 3300021388 Ga0213875_10001741 Ga0213875_100017419 402
193 3300026067 Ga0207678_10032829 Ga0207678_100328292 402
194 3300029957 Ga0265324_10013177 Ga0265324_100131774 402
195 3300031344 Ga0265316_10068856 Ga0265316_100688562 402
196 3300031344 Ga0265316_10133643 Ga0265316_101336432 402
197 3300031711 Ga0265314_10046286 Ga0265314_100462863 402
198 3300035117 Ga0373953_0052803 Ga0373953_0052803_391_1635 402
199 3300035118 Ga0373954_0011468 Ga0373954_0011468_2298_3542 402
200 3300035724 Ga0373933_0002645 Ga0373933_0002645_2172_3416 402
201 3300036401 Ga0373937_0001341 Ga0373937_0001341_3603_4847 402
202 3300037853 Ga0436364_0022735 Ga0436364_0022735_2066_3310 402
203 3300039438 Ga0436360_1228146 Ga0436360_1228146_854_2098 402
204 3300044712 Ga0453684_0000006 Ga0453684_0000006_101797_103047 402
205 3300044712 Ga0453684_0000410 Ga0453684_0000410_77162_78412 402
206 3300044712 Ga0453684_0210342 Ga0453684_0210342_854_2098 402
207 3300046512 Ga0495610_0069065 Ga0495610_0069065_79_1395 402
208 3300049586 Ga0501070_0113872 Ga0501070_0113872_342_1586 402
209 3300053079 Ga0500610_0043554 Ga0500610_0043554_159_1475 402
210 3300005458 Ga0070681_10044261 Ga0070681_100442613 403
211 3300005467 Ga0070706_100028310 Ga0070706_1000283103 403
212 3300005471 Ga0070698_100101725 Ga0070698_1001017252 403
213 3300005546 Ga0070696_100166893 Ga0070696_1001668932 403
214 3300006914 Ga0075436_100047761 Ga0075436_1000477612 403
215 3300009551 Ga0105238_10032692 Ga0105238_100326923 403
216 3300014325 Ga0163163_10134635 Ga0163163_101346352 403
217 3300025912 Ga0207707_10130192 Ga0207707_101301922 403
218 3300026041 Ga0207639_10116903 Ga0207639_101169032 403
219 3300028573 Ga0265334_10019298 Ga0265334_100192982 403
220 3300028800 Ga0265338_10071569 Ga0265338_100715692 403
221 3300031251 Ga0265327_10046268 Ga0265327_100462682 403
222 3300031711 Ga0265314_10014552 Ga0265314_100145522 403
223 3300031711 Ga0265314_10041274 Ga0265314_100412742 403
224 3300036401 Ga0373937_0097238 Ga0373937_0097238_200_1444 403
225 3300046472 Ga0495580_0049145 Ga0495580_0049145_1417_2661 403
226 3300049744 Ga0501083_0033143 Ga0501083_0033143_844_2088 403
227 3300050514 nmdc:mga08x19_21397_c1 nmdc:mga08x19_21397_c1_1707_2954 403
228 3300053131 Ga0500652_000750 Ga0500652_000750_6959_8203 403
229 3300053155 Ga0500620_000077 Ga0500620_000077_7348_8664 403
230 3300060353 Ga0501082_0056325 Ga0501082_0056325_869_2113 403
231 3300005356 Ga0070674_100007225 Ga0070674_1000072254 404
232 3300005614 Ga0068856_100122031 Ga0068856_1001220312 404
233 3300005981 Ga0081538_10002356 Ga0081538_1000235614 404
234 3300006028 Ga0070717_10088739 Ga0070717_100887392 404
235 3300006028 Ga0070717_10241517 Ga0070717_102415172 404
236 3300014968 Ga0157379_10098816 Ga0157379_100988162 404
237 3300025928 Ga0207700_10085284 Ga0207700_100852842 404
238 3300026078 Ga0207702_10165115 Ga0207702_101651152 404
239 3300031548 Ga0307408_100107326 Ga0307408_1001073262 404
240 3300031824 Ga0307413_10019707 Ga0307413_100197073 404
241 3300031903 Ga0307407_10036947 Ga0307407_100369472 404
242 3300031911 Ga0307412_10109451 Ga0307412_101094512 404
243 3300031995 Ga0307409_100008031 Ga0307409_1000080316 404
244 3300032005 Ga0307411_10007231 Ga0307411_100072312 404
245 3300039447 Ga0436361_0215588 Ga0436361_0215588_1543_2796 404
246 3300039447 Ga0436361_0276378 Ga0436361_0276378_2029_3276 404
247 3300005456 Ga0070678_100113989 Ga0070678_1001139892 405
248 3300005985 Ga0081539_10092193 Ga0081539_100921932 405
249 3300009098 Ga0105245_10126099 Ga0105245_101260993 405
250 3300021361 Ga0213872_10009317 Ga0213872_100093175 405
251 3300025933 Ga0207706_10144225 Ga0207706_101442252 405
252 3300035171 Ga0373946_0023185 Ga0373946_0023185_245_1507 405
253 3300039447 Ga0436361_0300922 Ga0436361_0300922_3445_4695 405
254 3300039447 Ga0436361_0378965 Ga0436361_0378965_1582_2832 405
255 3300046472 Ga0495580_0013337 Ga0495580_0013337_1871_3130 405
256 3300046473 Ga0495582_0004012 Ga0495582_0004012_1974_3233 405
257 3300046683 Ga0495658_0016812 Ga0495658_0016812_902_2161 405
258 3300047319 Ga0495674_0075331 Ga0495674_0075331_1379_2644 405
259 3300049570 Ga0501033_0002052 Ga0501033_0002052_4757_6061 405
260 3300049571 Ga0501034_0010929 Ga0501034_0010929_1952_3256 405
261 3300049573 Ga0501037_0004512 Ga0501037_0004512_2474_3778 405
262 3300049574 Ga0501038_0003682 Ga0501038_0003682_2802_4106 405
263 3300049575 Ga0501039_0002395 Ga0501039_0002395_2772_4076 405
264 3300049579 Ga0501043_0001899 Ga0501043_0001899_16287_17591 405
265 3300049580 Ga0501046_0001214 Ga0501046_0001214_12565_13869 405
266 3300049581 Ga0501047_0017198 Ga0501047_0017198_3087_4391 405
267 3300049581 Ga0501047_0028841 Ga0501047_0028841_1789_3099 405
268 3300049581 Ga0501047_0191927 Ga0501047_0191927_17_1321 405
269 3300049583 Ga0501067_0067736 Ga0501067_0067736_455_1759 405
270 3300049584 Ga0501068_0021019 Ga0501068_0021019_261_1565 405
271 3300049585 Ga0501069_0000066 Ga0501069_0000066_2363_3667 405
272 3300049586 Ga0501070_0006143 Ga0501070_0006143_2936_4240 405
273 3300049588 Ga0501072_0124267 Ga0501072_0124267_92_1396 405
274 3300049589 Ga0501073_0001156 Ga0501073_0001156_15802_17106 405
275 3300049589 Ga0501073_0023833 Ga0501073_0023833_819_2129 405
276 3300049590 Ga0501074_0007293 Ga0501074_0007293_6601_7905 405
277 3300049742 Ga0501080_0041884 Ga0501080_0041884_2364_3668 405
278 3300049744 Ga0501083_0001381 Ga0501083_0001381_13368_14672 405
279 3300049744 Ga0501083_0058667 Ga0501083_0058667_509_1813 405
280 3300049822 Ga0501035_0010445 Ga0501035_0010445_6335_7639 405
281 3300049823 Ga0501044_0007053 Ga0501044_0007053_6325_7629 405
282 3300053117 Ga0500593_000050 Ga0500593_000050_37786_39078 405
283 3300053153 Ga0500616_0001786 Ga0500616_0001786_14439_15740 405
284 3300060353 Ga0501082_0004543 Ga0501082_0004543_8702_10006 405
285 iso_pu_bacteria 2929199973 2929203568 405
286 iso_pu_bacteria 8055909800 8055911242 405
287 3300003203 JGI25406J46586_10008619 JGI25406J46586_100086193 406
288 3300005617 Ga0068859_100251539 Ga0068859_1002515392 406
289 3300005985 Ga0081539_10001574 Ga0081539_100015745 406
290 3300006931 Ga0097620_100251558 Ga0097620_1002515582 406
291 3300009177 Ga0105248_10017001 Ga0105248_100170016 406
292 3300010375 Ga0105239_10309290 Ga0105239_103092902 406
293 3300025941 Ga0207711_10029220 Ga0207711_100292205 406
294 3300026088 Ga0207641_10021216 Ga0207641_100212166 406
295 3300028379 Ga0268266_10040266 Ga0268266_100402663 406
296 3300039450 Ga0436363_1258587 Ga0436363_1258587_1271_2533 406
297 3300003911 JGI25405J52794_10003972 JGI25405J52794_100039722 407
298 3300005329 Ga0070683_100018580 Ga0070683_1000185803 407
299 3300005344 Ga0070661_100085600 Ga0070661_1000856002 407
300 3300005563 Ga0068855_100135365 Ga0068855_1001353652 407
301 3300005981 Ga0081538_10025104 Ga0081538_100251043 407
302 3300005983 Ga0081540_1000194 Ga0081540_100019442 407
303 3300006237 Ga0097621_100000211 Ga0097621_10000021127 407
304 3300006358 Ga0068871_100024205 Ga0068871_1000242052 407
305 3300006871 Ga0075434_100007911 Ga0075434_1000079118 407
306 3300009094 Ga0111539_10149417 Ga0111539_101494172 407
307 3300009176 Ga0105242_10048531 Ga0105242_100485313 407
308 3300013105 Ga0157369_10002835 Ga0157369_1000283519 407
309 3300013297 Ga0157378_10426734 Ga0157378_104267341 407
310 3300014969 Ga0157376_10121527 Ga0157376_101215272 407
311 3300025901 Ga0207688_10073139 Ga0207688_100731392 407
312 3300025904 Ga0207647_10112542 Ga0207647_101125421 407
313 3300025926 Ga0207659_10281842 Ga0207659_102818421 407
314 3300025934 Ga0207686_10017974 Ga0207686_100179745 407
315 3300027907 Ga0207428_10051970 Ga0207428_100519702 407
316 3300031235 Ga0265330_10053851 Ga0265330_100538511 407
317 3300031238 Ga0265332_10056944 Ga0265332_100569442 407
318 3300036401 Ga0373937_0023418 Ga0373937_0023418_2041_3321 407
319 3300046492 Ga0495585_0062131 Ga0495585_0062131_177_1556 407
320 3300046557 Ga0495622_0007824 Ga0495622_0007824_1686_2960 407
321 3300048904 Ga0496101_0032518 Ga0496101_0032518_2112_3380 407
322 3300049592 Ga0501076_0074312 Ga0501076_0074312_1162_2514 407
323 3300050511 nmdc:mga08y16_35316_c1 nmdc:mga08y16_35316_c1_319_1587 407
324 3300053078 Ga0495612_0069578 Ga0495612_0069578_61_1329 407
325 3300053119 Ga0500595_006462 Ga0500595_006462_1198_2472 407
326 3300053139 Ga0500568_0021171 Ga0500568_0021171_648_1916 407
327 iso_pu_bacteria 2874123672 2874123857 407
328 3300005444 Ga0070694_100029184 Ga0070694_1000291843 408
329 3300005545 Ga0070695_100032586 Ga0070695_1000325862 408
330 3300028800 Ga0265338_10011285 Ga0265338_100112855 408
331 iso_pu_bacteria 2721755823 2724109510 408
332 iso_pu_bacteria 2891373044 2891377228 409
333 iso_pu_bacteria 2924762789 2924767200 409
334 iso_pu_bacteria 2987666974 2987669036 409
335 3300031727 Ga0316576_10067200 Ga0316576_100672003 410
336 3300035398 Ga0316574_0003278 Ga0316574_0003278_5787_7055 410
337 iso_pu_bacteria 2643221659 2644332269 410
338 3300048925 Ga0496122_0004624 Ga0496122_0004624_6018_7418 411
339 3300002739 JGI25158J39367_1000077 JGI25158J39367_10000776 412
340 3300002773 JGI25152J39213_1000376 JGI25152J39213_100037615 412
341 3300005262 Ga0065165_1003662 Ga0065165_10036623 412
342 3300046452 Ga0495617_018445 Ga0495617_018445_734_2041 412
343 3300046454 Ga0495592_0164232 Ga0495592_0164232_141_1454 412
344 3300047320 Ga0495672_0031526 Ga0495672_0031526_552_1853 412
345 3300053139 Ga0500568_0005282 Ga0500568_0005282_4428_5717 412
346 3300031090 Ga0265760_10005736 Ga0265760_100057363 414
347 3300002737 JGI25162J39368_1000696 JGI25162J39368_100069620 415
348 3300003203 JGI25406J46586_10000156 JGI25406J46586_1000015628 415
349 3300003214 JGI25165J46597_1002868 JGI25165J46597_10028682 415
350 3300005985 Ga0081539_10000076 Ga0081539_10000076174 415
351 3300025233 Ga0209437_100023 Ga0209437_100023291 415
352 3300025261 Ga0209233_1000062 Ga0209233_1000062184 415
353 3300028794 Ga0307515_10000070 Ga0307515_1000007019 415
354 3300049570 Ga0501033_0076068 Ga0501033_0076068_109_1434 415
355 3300049579 Ga0501043_0013980 Ga0501043_0013980_4151_5473 415
356 3300049579 Ga0501043_0137352 Ga0501043_0137352_47_1372 415
357 3300049581 Ga0501047_0036340 Ga0501047_0036340_1626_2951 415
358 3300049581 Ga0501047_0078442 Ga0501047_0078442_819_2144 415
359 3300049585 Ga0501069_0010778 Ga0501069_0010778_1946_3271 415
360 3300049586 Ga0501070_0067783 Ga0501070_0067783_570_1895 415
361 3300049742 Ga0501080_0003618 Ga0501080_0003618_9958_11283 415
362 3300049742 Ga0501080_0072760 Ga0501080_0072760_1514_2839 415
363 3300049742 Ga0501080_0111736 Ga0501080_0111736_751_2073 415
364 3300049822 Ga0501035_0061010 Ga0501035_0061010_1520_2845 415
365 3300049822 Ga0501035_0075745 Ga0501035_0075745_414_1736 415
366 3300049823 Ga0501044_0137213 Ga0501044_0137213_1061_2386 415
367 iso_pu_bacteria 2937843397 2937847270 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

311

445

0.97

PF12704

MacB_PCD

MacB-like periplasmic core domain

63

281

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8807 53 255
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8698 53 255
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8667 53 255
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.85 53 255
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8476 53 255
ID Description Score Start End Superfamily
af_I1MEU9_21_98_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6738 63 94 3.30.70.100
1cz5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5601 145 229 2.40.40.20
af_Q9BPU3_378_783_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5455 165 197 3.40.850.10
af_Q4DUB6_274_435_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5018 278 413 1.10.1760.20
af_A4IBQ2_333_497_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4948 278 413 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.9481 242 415 GO:0044874
GO:0098797
AF-A0A2D5LV36-F1-model_v4 Transporter 0.9455 274 415 GO:0044874
GO:0098797
AF-A0A2X3M198-F1-model_v4 Lipoprotein-releasing system transmembrane protein 0.938 274 415 GO:0044874
GO:0098797
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.9376 242 415 GO:0044874
GO:0098797
AF-A0A3M3M7Q0-F1-model_v4 deleted 0.9345 296 415

Feature Viewer

pLDDT pTM Quality
83.04 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map