F424130

General Info

Members Datasets Scaffolds Average Seq Length
366 248 264 321

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0101692|Ga0495686_0101692_97_1230
Length 377
Sequence MLCAGANNAADPCETVKTPRFSADGVHARSGWLKCMAGWRDSMHSHRAHLRAGTGSLLMKAVALAIFPGVQALDVAGPLDVFAETNAFVETDRGYRLTLIGAERQPYRASNGMSITPEMTFADKEQAFDLALVAGGPALPTTLPDPRLVDWLGERASRCQQYGSICTGAFALGHAGLIDGKTVTTHWQDAPSLARQFPKAKVEFDRIYLRDGPLLTSAGVTAGIDLALAIVQDDHGPEVALAVARRLVVVAQRQGGQSQFSPYLVPPAEKDSSIARVHAHVMAHLREANGVDVLAQVAGMSPRSFARAFKRETNVTPAEFVESARLDAARNRLEGSDLPLKVVAHESGFGSAEHMRVVFVKRLGITPSHYRASFRKV

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
14 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
15 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
16 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
17 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
18 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
21 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
25 2738541293 Rhizobium sp. GV031 Isolate Unclassified
26 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
27 2773857925 Microvirga vignae BR3299 Isolate Unclassified
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355267 Rhizobium sp. L18 Isolate Nodule
30 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
33 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
34 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
35 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
36 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
37 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
38 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
39 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
40 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
41 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
44 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
45 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
46 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
47 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
48 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
49 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
50 2904504865 Serratia marcescens 1822 Isolate Unclassified
51 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
52 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
53 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
54 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
55 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
56 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
57 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
58 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
59 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
60 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
61 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
62 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
63 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
64 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
65 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
66 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
67 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
68 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
69 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
70 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
71 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
72 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
73 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
74 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
75 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
76 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
77 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
78 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
79 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
80 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
81 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
82 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
128 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
232 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
233 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
234 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
235 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
236 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
237 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
238 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
239 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
240 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
241 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
242 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
243 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
244 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
245 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
246 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
247 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
248 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.4
Metatranscriptomes 0
Isolates 27.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 22.68
Rhizoplane 2.46
Rhizosphere 44.81
Stem 0
Stem Tuber 0
Unclassified 17.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000109 3300002737 Bacteria 89947
2 JGI25165J46597_1000368 3300003214 Bacteria 50369
3 rootH2_10199025 3300003320 Bacteria 2948
4 rootL2_10103203 3300003322 Bacteria 1403
5 Ga0070658_10047406 3300005327 Bacteria 3478
6 Ga0070670_100005017 3300005331 Bacteria 11137
7 Ga0070667_100000214 3300005367 Bacteria 67467
8 Ga0070684_100183418 3300005535 Bacteria 1903
9 Ga0068853_100007092 3300005539 Bacteria 8967
10 Ga0068853_100029714 3300005539 Bacteria 4610
11 Ga0068853_100554616 3300005539 Bacteria 1089
12 Ga0070665_100112146 3300005548 Bacteria 2730
13 Ga0070665_100436765 3300005548 Bacteria 1318
14 Ga0068851_10016926 3300005834 Bacteria 3495
15 Ga0081540_1000809 3300005983 Bacteria 28697
16 Ga0075369_10009688 3300006186 Bacteria 3749
17 Ga0099825_1028570 3300006941 Bacteria 2695
18 Ga0099824_1017723 3300006942 Bacteria 6075
19 Ga0099822_1031267 3300006943 Bacteria 3923
20 Ga0099823_1030525 3300006944 Bacteria 4506
21 Ga0105251_10122871 3300009011 Bacteria 1179
22 Ga0105240_10000290 3300009093 Bacteria 97921
23 Ga0105240_10000336 3300009093 Bacteria 87900
24 Ga0105240_10007408 3300009093 Bacteria 15946
25 Ga0105240_10016389 3300009093 Bacteria 10034
26 Ga0105240_10035916 3300009093 Bacteria 6381
27 Ga0105240_10061314 3300009093 Bacteria 4687
28 Ga0105243_10552750 3300009148 Bacteria 1100
29 Ga0105237_10003793 3300009545 Bacteria 17765
30 Ga0105238_10142006 3300009551 Bacteria 2378
31 Ga0105239_10000024 3300010375 Bacteria 256334
32 Ga0105239_10000202 3300010375 Bacteria 87257
33 Ga0105239_10010502 3300010375 Bacteria 10351
34 Ga0157370_10003913 3300013104 Bacteria 17346
35 Ga0157369_10021636 3300013105 Bacteria 7192
36 Ga0157374_10016153 3300013296 Bacteria 6560
37 Ga0157372_10010786 3300013307 Bacteria 9727
38 Ga0157372_10644435 3300013307 Bacteria 1234
39 Ga0163163_10116520 3300014325 Bacteria 2703
40 Ga0157380_10241940 3300014326 Bacteria 1627
41 Ga0182007_10026536 3300015262 Bacteria 2006
42 Ga0182005_1001606 3300015265 Bacteria 8858
43 Ga0213872_10008747 3300021361 Bacteria 4887
44 Ga0209437_100064 3300025233 Bacteria 334360
45 Ga0209677_107107 3300025253 Bacteria 2464
46 Ga0209677_109223 3300025253 Bacteria 1799
47 Ga0209148_1000396 3300025254 Bacteria 51441
48 Ga0209233_1000081 3300025261 Bacteria 336832
49 Ga0209233_1000334 3300025261 Bacteria 48025
50 Ga0209564_1011130 3300025295 Bacteria 4064
51 Ga0209758_1010005 3300025297 Bacteria 5760
52 Ga0209758_1021299 3300025297 Bacteria 3026
53 Ga0209257_1000303 3300025304 Bacteria 107862
54 Ga0207647_10053728 3300025904 Bacteria 2481
55 Ga0207695_10000385 3300025913 Bacteria 99958
56 Ga0207695_10000458 3300025913 Bacteria 88734
57 Ga0207695_10010386 3300025913 Bacteria 11392
58 Ga0207695_10071150 3300025913 Bacteria 3553
59 Ga0207695_10127119 3300025913 Bacteria 2510
60 Ga0207695_10167842 3300025913 Bacteria 2122
61 Ga0207671_10000330 3300025914 Bacteria 69591
62 Ga0207671_10259063 3300025914 Bacteria 1368
63 Ga0207650_10003897 3300025925 Bacteria 10201
64 Ga0207658_10000750 3300025986 Bacteria 27925
65 Ga0207639_10531219 3300026041 Bacteria 1078
66 Ga0207698_10102233 3300026142 Bacteria 2379
67 Ga0209389_1000054 3300027296 Bacteria 108815
68 Ga0209389_1000242 3300027296 Bacteria 35240
69 Ga0209389_1000371 3300027296 Bacteria 26980
70 Ga0209389_1001311 3300027296 Bacteria 17364
71 Ga0209589_1000002 3300027357 Bacteria 708598
72 Ga0209589_1005194 3300027357 Bacteria 22161
73 Ga0209489_100002 3300027361 Bacteria 708609
74 Ga0209489_102751 3300027361 Bacteria 35240
75 Ga0209489_105336 3300027361 Bacteria 22405
76 Ga0209700_100002 3300027363 Bacteria 708598
77 Ga0209700_102860 3300027363 Bacteria 34208
78 Ga0268266_10001576 3300028379 Bacteria 26652
79 Ga0268266_10373160 3300028379 Bacteria 1344
80 Ga0268266_10392246 3300028379 Bacteria 1311
81 Ga0265338_10000385 3300028800 Bacteria 79013
82 Ga0307412_10018329 3300031911 Bacteria 4210
83 Ga0315911_1000006 3300033442 Bacteria 414563
84 Ga0395900_0189882 3300037418 Bacteria 2084
85 Ga0395900_0329671 3300037418 Bacteria 1505
86 Ga0395898_0031633 3300037466 Bacteria 5285
87 Ga0395898_0040300 3300037466 Bacteria 4619
88 Ga0395905_0024873 3300037471 Bacteria 5650
89 Ga0395901_0047484 3300038443 Bacteria 4458
90 Ga0395901_0467373 3300038443 Bacteria 1288
91 Ga0436361_0502315 3300039447 Bacteria 2066
92 Ga0436361_0670517 3300039447 Bacteria 6962
93 Ga0436361_0671798 3300039447 Bacteria 12492
94 Ga0466965_0032514 3300044683 Bacteria 2548
95 Ga0466960_0016699 3300044901 Bacteria 3189
96 Ga0466959_0114678 3300045049 Bacteria 1920
97 Ga0495591_022283 3300046458 Bacteria 2050
98 Ga0495638_0006823 3300046460 Bacteria 8244
99 Ga0495638_0007762 3300046460 Bacteria 7659
100 Ga0495650_0003322 3300046471 Bacteria 11854
101 Ga0495650_0014055 3300046471 Bacteria 4193
102 Ga0495605_0000014 3300046474 Bacteria 305393
103 Ga0495605_0000678 3300046474 Bacteria 25640
104 Ga0495594_0003400 3300046499 Bacteria 8215
105 Ga0495607_0005690 3300046501 Bacteria 8881
106 Ga0495607_0125042 3300046501 Bacteria 1345
107 Ga0495583_0000066 3300046506 Bacteria 191372
108 Ga0495583_0001467 3300046506 Bacteria 23652
109 Ga0495583_0001499 3300046506 Bacteria 23250
110 Ga0495606_0007281 3300046507 Bacteria 9970
111 Ga0495610_0002330 3300046512 Bacteria 16053
112 Ga0495610_0005737 3300046512 Bacteria 8745
113 Ga0495616_0015760 3300046513 Bacteria 4195
114 Ga0495620_0000048 3300046515 Bacteria 106392
115 Ga0495631_0003784 3300046518 Bacteria 8232
116 Ga0495631_0034551 3300046518 Bacteria 2266
117 Ga0495631_0048565 3300046518 Bacteria 1861
118 Ga0495632_0001675 3300046519 Bacteria 18148
119 Ga0495637_0006613 3300046520 Bacteria 5801
120 Ga0495648_0002990 3300046524 Bacteria 15166
121 Ga0495654_0002337 3300046530 Bacteria 12246
122 Ga0495609_0000006 3300046538 Bacteria 431833
123 Ga0495609_0000024 3300046538 Bacteria 264100
124 Ga0495597_0001399 3300046542 Bacteria 17432
125 Ga0495633_0000030 3300046558 Bacteria 197184
126 Ga0495668_0000024 3300046616 Bacteria 359469
127 Ga0495611_0004277 3300046648 Bacteria 6207
128 Ga0495625_0000769 3300046660 Bacteria 44640
129 Ga0495625_0097291 3300046660 Bacteria 2026
130 Ga0495661_0000015 3300046665 Bacteria 223740
131 Ga0495661_0057964 3300046665 Bacteria 2310
132 Ga0495670_0050185 3300046691 Bacteria 2088
133 Ga0495670_0183281 3300046691 Eukaryota 1106
134 Ga0495589_0000639 3300046794 Bacteria 22912
135 Ga0495660_0005859 3300046810 Bacteria 7332
136 Ga0495672_0062602 3300047320 Bacteria 2139
137 Ga0495672_0073693 3300047320 Bacteria 1925
138 Ga0495683_0000056 3300047323 Bacteria 118944
139 Ga0495679_000121 3300047446 Bacteria 68858
140 Ga0495673_0002363 3300047469 Bacteria 13392
141 Ga0495673_0044967 3300047469 Bacteria 1966
142 Ga0495681_0039157 3300047470 Bacteria 2317
143 Ga0495686_0000302 3300047472 Bacteria 84826
144 Ga0495686_0000944 3300047472 Bacteria 36054
145 Ga0495686_0002694 3300047472 Bacteria 16296
146 Ga0495686_0057678 3300047472 Bacteria 2423
147 Ga0495686_0101692 3300047472 Bacteria 1733
148 Ga0495686_0108452 3300047472 Bacteria 1668
149 Ga0495626_0006701 3300048091 Bacteria 6524
150 Ga0496102_0016620 3300048905 Bacteria 6433
151 Ga0496103_0002355 3300048906 Bacteria 11921
152 Ga0496112_0059078 3300048915 Bacteria 3778
153 Ga0496113_0051421 3300048916 Bacteria 3075
154 Ga0496117_0001433 3300048920 Bacteria 34426
155 Ga0496117_0010989 3300048920 Bacteria 8152
156 Ga0496117_0056324 3300048920 Bacteria 2739
157 Ga0496117_0140563 3300048920 Bacteria 1447
158 Ga0496118_0001911 3300048921 Bacteria 29639
159 Ga0496118_0053606 3300048921 Bacteria 3063
160 Ga0496118_0148687 3300048921 Bacteria 1470
161 Ga0496119_0033045 3300048922 Bacteria 3438
162 Ga0496119_0120150 3300048922 Bacteria 1446
163 Ga0496120_0016939 3300048923 Bacteria 4743
164 Ga0496120_0020752 3300048923 Bacteria 4167
165 Ga0496120_0032249 3300048923 Bacteria 3161
166 Ga0496121_0000084 3300048924 Bacteria 225942
167 Ga0496121_0000515 3300048924 Bacteria 73665
168 Ga0496121_0001254 3300048924 Bacteria 43970
169 Ga0496121_0010021 3300048924 Bacteria 10766
170 Ga0496121_0010192 3300048924 Bacteria 10642
171 Ga0496121_0071576 3300048924 Bacteria 2788
172 Ga0496121_0079078 3300048924 Bacteria 2612
173 Ga0496122_0000218 3300048925 Bacteria 127770
174 Ga0496122_0004628 3300048925 Bacteria 16924
175 Ga0496122_0006817 3300048925 Bacteria 12956
176 Ga0496122_0008494 3300048925 Bacteria 11059
177 Ga0496122_0113982 3300048925 Bacteria 1764
178 Ga0496123_0000327 3300048926 Bacteria 90879
179 Ga0496123_0001734 3300048926 Bacteria 28884
180 Ga0496123_0005298 3300048926 Bacteria 13060
181 Ga0496123_0012251 3300048926 Bacteria 7331
182 Ga0496125_0000402 3300048928 Bacteria 80919
183 Ga0496125_0002054 3300048928 Bacteria 27194
184 Ga0496125_0013074 3300048928 Bacteria 8185
185 Ga0496125_0222351 3300048928 Bacteria 1215
186 Ga0496126_0011473 3300048929 Bacteria 9167
187 Ga0496126_0017407 3300048929 Bacteria 7159
188 Ga0496126_0020382 3300048929 Bacteria 6502
189 Ga0496126_0053087 3300048929 Bacteria 3679
190 Ga0496126_0149449 3300048929 Bacteria 2003
191 Ga0496126_0246467 3300048929 Bacteria 1490
192 Ga0495678_000063 3300049459 Bacteria 140183
193 Ga0501032_0023119 3300049569 Bacteria 4303
194 Ga0501033_0009147 3300049570 Bacteria 7637
195 Ga0501033_0062946 3300049570 Bacteria 2731
196 Ga0501033_0142105 3300049570 Bacteria 1735
197 Ga0501034_0006368 3300049571 Bacteria 12712
198 Ga0501034_0023832 3300049571 Bacteria 6232
199 Ga0501036_0166177 3300049572 Bacteria 1860
200 Ga0501038_0008807 3300049574 Bacteria 9257
201 Ga0501038_0132636 3300049574 Bacteria 2043
202 Ga0501038_0385798 3300049574 Bacteria 1086
203 Ga0501043_0000072 3300049579 Bacteria 89021
204 Ga0501043_0004057 3300049579 Bacteria 11972
205 Ga0501043_0074264 3300049579 Bacteria 2671
206 Ga0501043_0273108 3300049579 Bacteria 1297
207 Ga0501046_0000010 3300049580 Bacteria 331082
208 Ga0501046_0000112 3300049580 Bacteria 86313
209 Ga0501046_0140627 3300049580 Bacteria 1827
210 Ga0501047_0000138 3300049581 Bacteria 89028
211 Ga0501047_0019928 3300049581 Bacteria 6438
212 Ga0501047_0020864 3300049581 Bacteria 6293
213 Ga0501048_0001412 3300049582 Bacteria 18171
214 Ga0501067_0028270 3300049583 Bacteria 3106
215 Ga0501068_0075689 3300049584 Bacteria 2059
216 Ga0501069_0078576 3300049585 Bacteria 1856
217 Ga0501070_0188392 3300049586 Bacteria 1696
218 Ga0501073_0078617 3300049589 Bacteria 2295
219 Ga0501073_0173066 3300049589 Bacteria 1495
220 Ga0501080_0067705 3300049742 Bacteria 3321
221 Ga0501080_0153067 3300049742 Bacteria 2131
222 Ga0501083_0067215 3300049744 Bacteria 2387
223 Ga0501035_0015284 3300049822 Bacteria 7084
224 Ga0501035_0077924 3300049822 Bacteria 2929
225 Ga0501035_0081356 3300049822 Bacteria 2858
226 Ga0501044_0021616 3300049823 Bacteria 6860
227 Ga0501044_0043332 3300049823 Bacteria 4676
228 Ga0501044_0087208 3300049823 Bacteria 3153
229 Ga0501045_0008786 3300049824 Bacteria 7052
230 nmdc:mga0yw44_54413_c1 3300050492 Bacteria 2432
231 nmdc:mga0yw44_83795_c1 3300050492 Bacteria 2003
232 nmdc:mga0sz30_60091_c1 3300050516 Bacteria 1623
233 Ga0500643_024903 3300053087 Bacteria 1892
234 Ga0500566_0015515 3300053094 Bacteria 4471
235 Ga0500641_0019200 3300053096 Bacteria 2582
236 Ga0500650_0023801 3300053098 Bacteria 2724
237 Ga0500556_0000195 3300053104 Bacteria 49800
238 Ga0500556_0000348 3300053104 Bacteria 34521
239 Ga0500556_0047267 3300053104 Bacteria 1543
240 Ga0500562_016402 3300053108 Bacteria 1904
241 Ga0500562_017002 3300053108 Bacteria 1872
242 Ga0500593_111717 3300053117 Bacteria 1122
243 Ga0500595_004692 3300053119 Bacteria 6073
244 Ga0500618_000106 3300053125 Bacteria 67801
245 Ga0500618_000753 3300053125 Bacteria 18333
246 Ga0500618_002547 3300053125 Bacteria 6776
247 Ga0500618_004126 3300053125 Bacteria 4752
248 Ga0500618_007367 3300053125 Bacteria 3145
249 Ga0500642_0000012 3300053130 Bacteria 206424
250 Ga0500652_000146 3300053131 Bacteria 26947
251 Ga0500559_0000848 3300053136 Bacteria 19718
252 Ga0500559_0020453 3300053136 Bacteria 2799
253 Ga0500568_0002038 3300053139 Bacteria 12288
254 Ga0500568_0049289 3300053139 Bacteria 1663
255 Ga0500577_0084702 3300053142 Bacteria 1271
256 Ga0500604_0001026 3300053151 Bacteria 7803
257 Ga0500616_0001093 3300053153 Bacteria 28182
258 Ga0500616_0076727 3300053153 Bacteria 1689
259 Ga0500622_0001963 3300053156 Bacteria 15485
260 Ga0500622_0101482 3300053156 Bacteria 1416
261 Ga0500627_0066808 3300053158 Bacteria 1588
262 Ga0500645_014158 3300053730 Bacteria 2546
263 Ga0500645_034000 3300053730 Bacteria 1523
264 Ga0501082_0018974 3300060353 Bacteria 5926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100112146 Ga0070665_1001121462 292
2 3300009093 Ga0105240_10000336 Ga0105240_1000033669 292
3 3300010375 Ga0105239_10010502 Ga0105239_1001050211 292
4 3300025913 Ga0207695_10000458 Ga0207695_1000045820 292
5 3300028379 Ga0268266_10392246 Ga0268266_103922462 292
6 3300048925 Ga0496122_0006817 Ga0496122_0006817_2549_3511 292
7 3300048926 Ga0496123_0001734 Ga0496123_0001734_3905_4867 292
8 3300048928 Ga0496125_0222351 Ga0496125_0222351_27_989 292
9 3300048929 Ga0496126_0053087 Ga0496126_0053087_2026_2988 292
10 3300038443 Ga0395901_0467373 Ga0395901_0467373_269_1252 295
11 3300046616 Ga0495668_0000024 Ga0495668_0000024_144052_145113 306
12 3300049570 Ga0501033_0142105 Ga0501033_0142105_33_998 306
13 3300053125 Ga0500618_000106 Ga0500618_000106_62854_63846 308
14 3300049579 Ga0501043_0000072 Ga0501043_0000072_49811_50845 309
15 3300049580 Ga0501046_0000112 Ga0501046_0000112_47162_48196 309
16 3300049581 Ga0501047_0000138 Ga0501047_0000138_38177_39211 309
17 3300049582 Ga0501048_0001412 Ga0501048_0001412_11785_12819 309
18 3300049823 Ga0501044_0087208 Ga0501044_0087208_1664_2698 309
19 3300049824 Ga0501045_0008786 Ga0501045_0008786_5283_6317 309
20 iso_pu_bacteria 2738541293 2738804877 309
21 3300005331 Ga0070670_100005017 Ga0070670_1000050175 312
22 3300025925 Ga0207650_10003897 Ga0207650_100038975 312
23 3300009093 Ga0105240_10000290 Ga0105240_1000029049 313
24 3300009093 Ga0105240_10061314 Ga0105240_100613144 313
25 3300009148 Ga0105243_10552750 Ga0105243_105527501 313
26 3300009545 Ga0105237_10003793 Ga0105237_100037936 313
27 3300010375 Ga0105239_10000024 Ga0105239_1000002455 313
28 3300010375 Ga0105239_10000202 Ga0105239_1000020244 313
29 3300013104 Ga0157370_10003913 Ga0157370_1000391317 313
30 3300013296 Ga0157374_10016153 Ga0157374_100161535 313
31 3300015262 Ga0182007_10026536 Ga0182007_100265362 313
32 3300015265 Ga0182005_1001606 Ga0182005_10016064 313
33 3300025913 Ga0207695_10071150 Ga0207695_100711503 313
34 3300031911 Ga0307412_10018329 Ga0307412_100183292 313
35 3300048906 Ga0496103_0002355 Ga0496103_0002355_7494_8441 313
36 3300048916 Ga0496113_0051421 Ga0496113_0051421_26_973 313
37 3300048920 Ga0496117_0001433 Ga0496117_0001433_19604_20551 313
38 3300048920 Ga0496117_0140563 Ga0496117_0140563_123_1094 313
39 3300048921 Ga0496118_0001911 Ga0496118_0001911_19604_20551 313
40 3300048922 Ga0496119_0033045 Ga0496119_0033045_1646_2593 313
41 3300048923 Ga0496120_0016939 Ga0496120_0016939_443_1390 313
42 3300048924 Ga0496121_0000084 Ga0496121_0000084_160371_161318 313
43 3300048924 Ga0496121_0000515 Ga0496121_0000515_4577_5548 313
44 3300048925 Ga0496122_0004628 Ga0496122_0004628_49_1002 313
45 3300048925 Ga0496122_0008494 Ga0496122_0008494_4019_4966 313
46 3300048926 Ga0496123_0005298 Ga0496123_0005298_443_1390 313
47 3300048926 Ga0496123_0012251 Ga0496123_0012251_5985_6938 313
48 3300048928 Ga0496125_0000402 Ga0496125_0000402_12087_13034 313
49 3300048929 Ga0496126_0017407 Ga0496126_0017407_6124_7071 313
50 3300048929 Ga0496126_0020382 Ga0496126_0020382_4355_5326 313
51 iso_pu_bacteria 2600254954 2600446849 313
52 iso_pu_bacteria 2513237098 2513671534 314
53 iso_pu_bacteria 2524023210 2524464840 314
54 iso_pu_bacteria 2602042107 2603857452 314
55 iso_pu_bacteria 2617270742 2617382127 314
56 iso_pu_bacteria 2802429635 2806058589 314
57 iso_pu_bacteria 2818991453 2819643171 314
58 iso_pu_bacteria 2842482326 2842484361 314
59 iso_pu_bacteria 2857524615 2857526833 314
60 iso_pu_bacteria 2885383462 2885385576 314
61 iso_pu_bacteria 2893066018 2893069996 314
62 iso_pu_bacteria 2919073203 2919077958 314
63 iso_pu_bacteria 2929199973 2929205873 314
64 iso_pu_bacteria 8055909800 8055912382 314
65 iso_pu_bacteria 8057575449 8057576018 314
66 iso_pu_bacteria 2818991466 2819714909 315
67 3300049571 Ga0501034_0006368 Ga0501034_0006368_2817_3779 316
68 3300049744 Ga0501083_0067215 Ga0501083_0067215_975_1937 316
69 iso_pu_bacteria 2508501042 2508690661 316
70 iso_pu_bacteria 2513237095 2513652760 316
71 iso_pu_bacteria 2513237096 2513657977 316
72 iso_pu_bacteria 2513237137 2513855679 316
73 iso_pu_bacteria 2513237145 2513919930 316
74 iso_pu_bacteria 2513237161 2514017279 316
75 iso_pu_bacteria 2515154112 2515627889 316
76 iso_pu_bacteria 2517572143 2517887901 316
77 iso_pu_bacteria 2517572143 2517892217 316
78 iso_pu_bacteria 2524023228 2524534309 316
79 iso_pu_bacteria 2534681796 2535517644 316
80 iso_pu_bacteria 2600254933 2600377245 316
81 iso_pu_bacteria 2667528175 2671120533 316
82 iso_pu_bacteria 2667528175 2671123669 316
83 iso_pu_bacteria 2687453392 2688594856 316
84 iso_pu_bacteria 2721755763 2723879024 316
85 iso_pu_bacteria 2758568016 2758639958 316
86 iso_pu_bacteria 2773857925 2774871636 316
87 iso_pu_bacteria 2791355197 2793068713 316
88 iso_pu_bacteria 2791355267 2793370781 316
89 iso_pu_bacteria 2816332527 2818243073 316
90 iso_pu_bacteria 2821443989 2821446319 316
91 iso_pu_bacteria 2824600985 2824606413 316
92 iso_pu_bacteria 2824609381 2824616334 316
93 iso_pu_bacteria 2844533157 2844533786 316
94 iso_pu_bacteria 2849076700 2849078000 316
95 iso_pu_bacteria 2856328259 2856333886 316
96 iso_pu_bacteria 2869271264 2869275492 316
97 iso_pu_bacteria 2876399893 2876400730 316
98 iso_pu_bacteria 2881665667 2881670961 316
99 iso_pu_bacteria 2885374607 2885381959 316
100 iso_pu_bacteria 2903748898 2903751586 316
101 iso_pu_bacteria 2904504865 2904509075 316
102 iso_pu_bacteria 2904690495 2904694647 316
103 iso_pu_bacteria 2906635258 2906643095 316
104 iso_pu_bacteria 2908739725 2908742493 316
105 iso_pu_bacteria 2908756301 2908760197 316
106 iso_pu_bacteria 2932828146 2932837469 316
107 iso_pu_bacteria 2935630451 2935631479 316
108 iso_pu_bacteria 2935648319 2935653010 316
109 iso_pu_bacteria 2935656913 2935661593 316
110 iso_pu_bacteria 2935665750 2935674941 316
111 iso_pu_bacteria 2935769743 2935770882 316
112 iso_pu_bacteria 2935777560 2935782403 316
113 iso_pu_bacteria 2935785616 2935786838 316
114 iso_pu_bacteria 2935793552 2935794885 316
115 iso_pu_bacteria 2935827899 2935837352 316
116 iso_pu_bacteria 2936011229 2936016049 316
117 iso_pu_bacteria 2936019824 2936024514 316
118 iso_pu_bacteria 2936028420 2936036998 316
119 iso_pu_bacteria 2936046547 2936051793 316
120 iso_pu_bacteria 2936055302 2936063404 316
121 iso_pu_bacteria 2941507105 2941510221 316
122 iso_pu_bacteria 2941515067 2941518693 316
123 iso_pu_bacteria 2941523033 2941525620 316
124 iso_pu_bacteria 2961136820 2961140788 316
125 iso_pu_bacteria 2965025482 2965028202 316
126 iso_pu_bacteria 2965102966 2965106968 316
127 iso_pu_bacteria 2970547951 2970551449 316
128 iso_pu_bacteria 3005474847 3005480395 316
129 iso_pu_bacteria 3005718088 3005720111 316
130 iso_pu_bacteria 8005542996 8005549674 316
131 iso_pu_bacteria 8006933436 8006940480 316
132 iso_pu_bacteria 8006973647 8006980169 316
133 iso_pu_bacteria 8016511872 8016512481 316
134 iso_pu_bacteria 8016603502 8016604872 316
135 iso_pu_bacteria 8016613128 8016620135 316
136 iso_pu_bacteria 8017057580 8017067009 316
137 iso_pu_bacteria 8019538911 8019539268 316
138 iso_pu_bacteria 8019555841 8019559175 316
139 iso_pu_bacteria 8019565922 8019566125 316
140 iso_pu_bacteria 8019619141 8019620733 316
141 iso_pu_bacteria 8019629233 8019637399 316
142 iso_pu_bacteria 8023680758 8023681452 316
143 iso_pu_bacteria 8056681323 8056688153 316
144 iso_pu_bacteria 8056689827 8056691335 316
145 iso_pu_bacteria 8056967851 8056974374 316
146 3300003322 rootL2_10103203 rootL2_101032031 317
147 3300048920 Ga0496117_0010989 Ga0496117_0010989_94_1128 317
148 3300049574 Ga0501038_0132636 Ga0501038_0132636_161_1162 317
149 3300049579 Ga0501043_0273108 Ga0501043_0273108_249_1250 317
150 3300049581 Ga0501047_0019928 Ga0501047_0019928_1650_2651 317
151 3300049583 Ga0501067_0028270 Ga0501067_0028270_469_1470 317
152 3300049584 Ga0501068_0075689 Ga0501068_0075689_193_1194 317
153 3300049585 Ga0501069_0078576 Ga0501069_0078576_397_1398 317
154 3300049589 Ga0501073_0078617 Ga0501073_0078617_1104_2105 317
155 3300049742 Ga0501080_0067705 Ga0501080_0067705_788_1789 317
156 3300049823 Ga0501044_0043332 Ga0501044_0043332_2488_3489 317
157 3300060353 Ga0501082_0018974 Ga0501082_0018974_743_1744 317
158 3300002737 JGI25162J39368_1000109 JGI25162J39368_100010967 318
159 3300003214 JGI25165J46597_1000368 JGI25165J46597_100036845 318
160 3300003320 rootH2_10199025 rootH2_101990251 318
161 3300005327 Ga0070658_10047406 Ga0070658_100474065 318
162 3300005367 Ga0070667_100000214 Ga0070667_10000021455 318
163 3300005535 Ga0070684_100183418 Ga0070684_1001834181 318
164 3300005539 Ga0068853_100007092 Ga0068853_1000070924 318
165 3300005539 Ga0068853_100029714 Ga0068853_1000297144 318
166 3300005539 Ga0068853_100554616 Ga0068853_1005546161 318
167 3300005548 Ga0070665_100436765 Ga0070665_1004367652 318
168 3300005834 Ga0068851_10016926 Ga0068851_100169263 318
169 3300005983 Ga0081540_1000809 Ga0081540_100080911 318
170 3300006186 Ga0075369_10009688 Ga0075369_100096884 318
171 3300006941 Ga0099825_1028570 Ga0099825_10285702 318
172 3300006942 Ga0099824_1017723 Ga0099824_10177233 318
173 3300006943 Ga0099822_1031267 Ga0099822_10312672 318
174 3300006944 Ga0099823_1030525 Ga0099823_10305254 318
175 3300009011 Ga0105251_10122871 Ga0105251_101228711 318
176 3300009093 Ga0105240_10007408 Ga0105240_1000740814 318
177 3300009093 Ga0105240_10016389 Ga0105240_100163898 318
178 3300009093 Ga0105240_10035916 Ga0105240_100359164 318
179 3300009551 Ga0105238_10142006 Ga0105238_101420062 318
180 3300013105 Ga0157369_10021636 Ga0157369_100216366 318
181 3300013307 Ga0157372_10010786 Ga0157372_100107867 318
182 3300013307 Ga0157372_10644435 Ga0157372_106444351 318
183 3300014325 Ga0163163_10116520 Ga0163163_101165202 318
184 3300014326 Ga0157380_10241940 Ga0157380_102419402 318
185 3300021361 Ga0213872_10008747 Ga0213872_100087474 318
186 3300025233 Ga0209437_100064 Ga0209437_100064204 318
187 3300025253 Ga0209677_107107 Ga0209677_1071072 318
188 3300025253 Ga0209677_109223 Ga0209677_1092232 318
189 3300025254 Ga0209148_1000396 Ga0209148_100039616 318
190 3300025261 Ga0209233_1000081 Ga0209233_100008197 318
191 3300025261 Ga0209233_1000334 Ga0209233_100033413 318
192 3300025295 Ga0209564_1011130 Ga0209564_10111303 318
193 3300025297 Ga0209758_1010005 Ga0209758_10100055 318
194 3300025297 Ga0209758_1021299 Ga0209758_10212993 318
195 3300025304 Ga0209257_1000303 Ga0209257_100030312 318
196 3300025904 Ga0207647_10053728 Ga0207647_100537283 318
197 3300025913 Ga0207695_10000385 Ga0207695_1000038537 318
198 3300025913 Ga0207695_10010386 Ga0207695_100103865 318
199 3300025913 Ga0207695_10127119 Ga0207695_101271193 318
200 3300025913 Ga0207695_10167842 Ga0207695_101678423 318
201 3300025914 Ga0207671_10000330 Ga0207671_1000033052 318
202 3300025914 Ga0207671_10259063 Ga0207671_102590631 318
203 3300025986 Ga0207658_10000750 Ga0207658_100007506 318
204 3300025986 Ga0207658_10000750 Ga0207658_100007509 318
205 3300026041 Ga0207639_10531219 Ga0207639_105312191 318
206 3300026142 Ga0207698_10102233 Ga0207698_101022333 318
207 3300027296 Ga0209389_1000054 Ga0209389_100005425 318
208 3300027296 Ga0209389_1000242 Ga0209389_100024211 318
209 3300027296 Ga0209389_1000371 Ga0209389_100037112 318
210 3300027296 Ga0209389_1001311 Ga0209389_10013117 318
211 3300027357 Ga0209589_1000002 Ga0209589_1000002397 318
212 3300027357 Ga0209589_1005194 Ga0209589_100519419 318
213 3300027361 Ga0209489_100002 Ga0209489_100002397 318
214 3300027361 Ga0209489_102751 Ga0209489_10275111 318
215 3300027361 Ga0209489_105336 Ga0209489_10533617 318
216 3300027363 Ga0209700_100002 Ga0209700_100002397 318
217 3300027363 Ga0209700_102860 Ga0209700_10286024 318
218 3300028379 Ga0268266_10001576 Ga0268266_1000157610 318
219 3300028379 Ga0268266_10373160 Ga0268266_103731602 318
220 3300028800 Ga0265338_10000385 Ga0265338_1000038527 318
221 3300033442 Ga0315911_1000006 Ga0315911_100000640 318
222 3300037418 Ga0395900_0189882 Ga0395900_0189882_923_1897 318
223 3300037418 Ga0395900_0329671 Ga0395900_0329671_414_1460 318
224 3300037466 Ga0395898_0031633 Ga0395898_0031633_3171_4145 318
225 3300037466 Ga0395898_0040300 Ga0395898_0040300_3535_4518 318
226 3300037471 Ga0395905_0024873 Ga0395905_0024873_92_1066 318
227 3300038443 Ga0395901_0047484 Ga0395901_0047484_3298_4272 318
228 3300039447 Ga0436361_0502315 Ga0436361_0502315_1073_2056 318
229 3300039447 Ga0436361_0670517 Ga0436361_0670517_5112_6077 318
230 3300039447 Ga0436361_0671798 Ga0436361_0671798_6885_7850 318
231 3300044683 Ga0466965_0032514 Ga0466965_0032514_1308_2282 318
232 3300044901 Ga0466960_0016699 Ga0466960_0016699_1437_2411 318
233 3300045049 Ga0466959_0114678 Ga0466959_0114678_545_1519 318
234 3300046458 Ga0495591_022283 Ga0495591_022283_1025_1984 318
235 3300046460 Ga0495638_0006823 Ga0495638_0006823_2085_3047 318
236 3300046460 Ga0495638_0007762 Ga0495638_0007762_4922_5881 318
237 3300046471 Ga0495650_0003322 Ga0495650_0003322_4789_5751 318
238 3300046471 Ga0495650_0014055 Ga0495650_0014055_1471_2430 318
239 3300046474 Ga0495605_0000014 Ga0495605_0000014_83667_84626 318
240 3300046474 Ga0495605_0000678 Ga0495605_0000678_17175_18137 318
241 3300046499 Ga0495594_0003400 Ga0495594_0003400_6604_7563 318
242 3300046501 Ga0495607_0005690 Ga0495607_0005690_3782_4744 318
243 3300046501 Ga0495607_0125042 Ga0495607_0125042_307_1269 318
244 3300046506 Ga0495583_0000066 Ga0495583_0000066_54547_55506 318
245 3300046506 Ga0495583_0001467 Ga0495583_0001467_7816_8787 318
246 3300046506 Ga0495583_0001499 Ga0495583_0001499_5516_6478 318
247 3300046507 Ga0495606_0007281 Ga0495606_0007281_4015_4989 318
248 3300046512 Ga0495610_0002330 Ga0495610_0002330_1506_2465 318
249 3300046512 Ga0495610_0005737 Ga0495610_0005737_5951_6913 318
250 3300046513 Ga0495616_0015760 Ga0495616_0015760_684_1643 318
251 3300046515 Ga0495620_0000048 Ga0495620_0000048_54541_55500 318
252 3300046518 Ga0495631_0003784 Ga0495631_0003784_5058_6017 318
253 3300046518 Ga0495631_0034551 Ga0495631_0034551_935_1894 318
254 3300046518 Ga0495631_0048565 Ga0495631_0048565_656_1615 318
255 3300046519 Ga0495632_0001675 Ga0495632_0001675_14201_15172 318
256 3300046520 Ga0495637_0006613 Ga0495637_0006613_4623_5594 318
257 3300046524 Ga0495648_0002990 Ga0495648_0002990_7041_8000 318
258 3300046530 Ga0495654_0002337 Ga0495654_0002337_3146_4105 318
259 3300046538 Ga0495609_0000006 Ga0495609_0000006_251644_252606 318
260 3300046538 Ga0495609_0000024 Ga0495609_0000024_225020_225979 318
261 3300046542 Ga0495597_0001399 Ga0495597_0001399_5869_6828 318
262 3300046558 Ga0495633_0000030 Ga0495633_0000030_115432_116391 318
263 3300046648 Ga0495611_0004277 Ga0495611_0004277_4712_5671 318
264 3300046660 Ga0495625_0000769 Ga0495625_0000769_33223_34299 318
265 3300046660 Ga0495625_0097291 Ga0495625_0097291_497_1456 318
266 3300046665 Ga0495661_0000015 Ga0495661_0000015_143087_144046 318
267 3300046665 Ga0495661_0057964 Ga0495661_0057964_734_1693 318
268 3300046691 Ga0495670_0050185 Ga0495670_0050185_1004_1963 318
269 3300046691 Ga0495670_0183281 Ga0495670_0183281_94_1062 318
270 3300046794 Ga0495589_0000639 Ga0495589_0000639_2427_3386 318
271 3300046810 Ga0495660_0005859 Ga0495660_0005859_207_1166 318
272 3300047320 Ga0495672_0062602 Ga0495672_0062602_764_1729 318
273 3300047320 Ga0495672_0073693 Ga0495672_0073693_530_1504 318
274 3300047323 Ga0495683_0000056 Ga0495683_0000056_54495_55454 318
275 3300047446 Ga0495679_000121 Ga0495679_000121_48215_49174 318
276 3300047469 Ga0495673_0002363 Ga0495673_0002363_1668_2627 318
277 3300047469 Ga0495673_0044967 Ga0495673_0044967_248_1216 318
278 3300047470 Ga0495681_0039157 Ga0495681_0039157_993_1952 318
279 3300047472 Ga0495686_0000302 Ga0495686_0000302_34427_35395 318
280 3300047472 Ga0495686_0000944 Ga0495686_0000944_1377_2351 318
281 3300047472 Ga0495686_0002694 Ga0495686_0002694_7203_8171 318
282 3300047472 Ga0495686_0057678 Ga0495686_0057678_304_1263 318
283 3300047472 Ga0495686_0101692 Ga0495686_0101692_97_1230 318
284 3300047472 Ga0495686_0108452 Ga0495686_0108452_317_1285 318
285 3300048091 Ga0495626_0006701 Ga0495626_0006701_3502_4461 318
286 3300048905 Ga0496102_0016620 Ga0496102_0016620_465_1439 318
287 3300048915 Ga0496112_0059078 Ga0496112_0059078_1742_2716 318
288 3300048920 Ga0496117_0056324 Ga0496117_0056324_341_1300 318
289 3300048921 Ga0496118_0053606 Ga0496118_0053606_1540_2499 318
290 3300048921 Ga0496118_0148687 Ga0496118_0148687_119_1093 318
291 3300048922 Ga0496119_0120150 Ga0496119_0120150_154_1128 318
292 3300048923 Ga0496120_0020752 Ga0496120_0020752_2626_3585 318
293 3300048923 Ga0496120_0032249 Ga0496120_0032249_936_1895 318
294 3300048924 Ga0496121_0001254 Ga0496121_0001254_14651_15616 318
295 3300048924 Ga0496121_0010021 Ga0496121_0010021_4420_5382 318
296 3300048924 Ga0496121_0010192 Ga0496121_0010192_3884_4843 318
297 3300048924 Ga0496121_0071576 Ga0496121_0071576_835_1800 318
298 3300048924 Ga0496121_0079078 Ga0496121_0079078_546_1511 318
299 3300048925 Ga0496122_0000218 Ga0496122_0000218_7220_8236 318
300 3300048925 Ga0496122_0113982 Ga0496122_0113982_67_1026 318
301 3300048926 Ga0496123_0000327 Ga0496123_0000327_7220_8236 318
302 3300048928 Ga0496125_0002054 Ga0496125_0002054_11779_12738 318
303 3300048928 Ga0496125_0013074 Ga0496125_0013074_662_1621 318
304 3300048929 Ga0496126_0011473 Ga0496126_0011473_8162_9121 318
305 3300048929 Ga0496126_0149449 Ga0496126_0149449_980_1939 318
306 3300048929 Ga0496126_0246467 Ga0496126_0246467_267_1226 318
307 3300049459 Ga0495678_000063 Ga0495678_000063_96308_97267 318
308 3300049569 Ga0501032_0023119 Ga0501032_0023119_2789_3796 318
309 3300049570 Ga0501033_0009147 Ga0501033_0009147_6334_7341 318
310 3300049570 Ga0501033_0062946 Ga0501033_0062946_1050_2039 318
311 3300049571 Ga0501034_0023832 Ga0501034_0023832_162_1169 318
312 3300049572 Ga0501036_0166177 Ga0501036_0166177_279_1268 318
313 3300049574 Ga0501038_0008807 Ga0501038_0008807_5075_6061 318
314 3300049574 Ga0501038_0385798 Ga0501038_0385798_83_1072 318
315 3300049579 Ga0501043_0004057 Ga0501043_0004057_7838_8845 318
316 3300049579 Ga0501043_0074264 Ga0501043_0074264_1339_2328 318
317 3300049580 Ga0501046_0000010 Ga0501046_0000010_247893_248903 318
318 3300049580 Ga0501046_0140627 Ga0501046_0140627_700_1674 318
319 3300049581 Ga0501047_0020864 Ga0501047_0020864_4316_5323 318
320 3300049586 Ga0501070_0188392 Ga0501070_0188392_684_1673 318
321 3300049589 Ga0501073_0173066 Ga0501073_0173066_475_1464 318
322 3300049742 Ga0501080_0153067 Ga0501080_0153067_895_1884 318
323 3300049822 Ga0501035_0015284 Ga0501035_0015284_1928_2908 318
324 3300049822 Ga0501035_0077924 Ga0501035_0077924_631_1614 318
325 3300049822 Ga0501035_0081356 Ga0501035_0081356_506_1495 318
326 3300049823 Ga0501044_0021616 Ga0501044_0021616_2662_3669 318
327 3300050492 nmdc:mga0yw44_54413_c1 nmdc:mga0yw44_54413_c1_711_1670 318
328 3300050492 nmdc:mga0yw44_83795_c1 nmdc:mga0yw44_83795_c1_533_1492 318
329 3300050516 nmdc:mga0sz30_60091_c1 nmdc:mga0sz30_60091_c1_271_1230 318
330 3300053087 Ga0500643_024903 Ga0500643_024903_284_1243 318
331 3300053094 Ga0500566_0015515 Ga0500566_0015515_716_1675 318
332 3300053096 Ga0500641_0019200 Ga0500641_0019200_874_1833 318
333 3300053098 Ga0500650_0023801 Ga0500650_0023801_147_1106 318
334 3300053104 Ga0500556_0000195 Ga0500556_0000195_29862_30821 318
335 3300053104 Ga0500556_0000348 Ga0500556_0000348_11067_12038 318
336 3300053104 Ga0500556_0047267 Ga0500556_0047267_148_1107 318
337 3300053108 Ga0500562_016402 Ga0500562_016402_536_1495 318
338 3300053108 Ga0500562_017002 Ga0500562_017002_645_1604 318
339 3300053117 Ga0500593_111717 Ga0500593_111717_125_1084 318
340 3300053119 Ga0500595_004692 Ga0500595_004692_2292_3269 318
341 3300053125 Ga0500618_000753 Ga0500618_000753_16142_17230 318
342 3300053125 Ga0500618_002547 Ga0500618_002547_502_1596 318
343 3300053125 Ga0500618_004126 Ga0500618_004126_953_1921 318
344 3300053125 Ga0500618_007367 Ga0500618_007367_1974_2966 318
345 3300053130 Ga0500642_0000012 Ga0500642_0000012_29838_30797 318
346 3300053131 Ga0500652_000146 Ga0500652_000146_15654_16613 318
347 3300053136 Ga0500559_0000848 Ga0500559_0000848_1353_2312 318
348 3300053136 Ga0500559_0020453 Ga0500559_0020453_375_1334 318
349 3300053139 Ga0500568_0002038 Ga0500568_0002038_908_1867 318
350 3300053139 Ga0500568_0049289 Ga0500568_0049289_75_1070 318
351 3300053142 Ga0500577_0084702 Ga0500577_0084702_148_1107 318
352 3300053151 Ga0500604_0001026 Ga0500604_0001026_1559_2518 318
353 3300053153 Ga0500616_0001093 Ga0500616_0001093_18014_18973 318
354 3300053153 Ga0500616_0076727 Ga0500616_0076727_404_1375 318
355 3300053156 Ga0500622_0001963 Ga0500622_0001963_5730_6689 318
356 3300053156 Ga0500622_0101482 Ga0500622_0101482_422_1381 318
357 3300053158 Ga0500627_0066808 Ga0500627_0066808_33_992 318
358 3300053730 Ga0500645_014158 Ga0500645_014158_697_1668 318
359 3300053730 Ga0500645_034000 Ga0500645_034000_500_1459 318
360 iso_pu_bacteria 2582581308 2585278036 318
361 iso_pu_bacteria 2582581315 2585328343 318
362 iso_pu_bacteria 2585427527 2585536956 318
363 iso_pu_bacteria 2585427530 2585554592 318
364 iso_pu_bacteria 2615840626 2616309042 318
365 iso_pu_bacteria 2818991453 2819643995 318
366 iso_pu_bacteria 2903768456 2903773856 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

294

373

0.98

PF01965

DJ-1_PfpI

DJ-1/PfpI family

60

233

0.93

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

291

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9401 212 316
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9344 218 312
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9186 217 314
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9173 218 304
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9094 218 307
ID Description Score Start End Superfamily
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9579 215 318 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9563 266 315 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9417 268 312 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9405 215 318 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9401 212 316 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6L8Z911-F1-model_v4 deleted 0.9654 214 313
AF-F1TEY5-F1-model_v4 Transcriptional regulator, AraC family 0.9606 214 314 GO:0003700
GO:0043565
AF-A0A2W4NK05-F1-model_v4 deleted 0.9585 214 318
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.9562 214 313 GO:0003700
GO:0043565
AF-A0A7Y2MPR1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9562 214 315 GO:0003700
GO:0016020
GO:0043565

Feature Viewer

pLDDT pTM Quality
87.65 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map