F424050

General Info

Members Datasets Scaffolds Average Seq Length
366 213 357 294

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10098585|Ga0207641_100985852
Length 302
Sequence MYFMILNLKDLSTIQKQYYLQHVIAPRPICFASTIDKAGKVNLSPFSFFNLFSSNPPIVIFSPARRVRDNTTKHTLENILEVPEVVINIVTYDMIHQTSLASCEFGKEVNEFIKAGFTEEEATMIKPPMVKESKVKLECKVIEVKPLGTEAGAGNLVICEVLKMHIDNSLLDSPSAAQDFPKIDQRKINHVARLGGDWYCVVNENNLFQVDKPNTQLGIGIDSLPKNIRNSKILSANHLGQLANVHEMPFIQPSFNDAHLKQIIQYYSINPEDMEKELHSYAKKLLDENKVNEAWQVLLSII

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.54
Metatranscriptomes 0
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.1
Nodule 0
Rhizoplane 0.27
Rhizosphere 84.7
Stem 0
Stem Tuber 0
Unclassified 7.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000467 3300000545 Bacteria 2829
2 JGI24736J21556_1004966 3300001904 Bacteria 2256
3 JGI24751J29686_10010629 3300002459 Bacteria 1896
4 rootH1_10052596 3300003316 Bacteria 1955
5 rootH1_10159277 3300003316 Bacteria 1138
6 rootH2_10286261 3300003320 Unclassified 3723
7 rootL2_10001250 3300003322 Bacteria 10494
8 rootL2_10078655 3300003322 Bacteria 4568
9 rootL2_10086736 3300003322 Bacteria 1050
10 rootL2_10105144 3300003322 Bacteria 3069
11 rootL2_10167491 3300003322 Bacteria 2770
12 rootH1_10005722 3300003323 Bacteria 8240
13 rootH1_10144952 3300003323 Bacteria 2174
14 rootH1_10163462 3300003323 Unclassified 1062
15 rootH1_10225103 3300003323 Bacteria 2462
16 Ga0055531_10000005 3300003794 Bacteria 242179
17 Ga0065704_10114609 3300005289 Bacteria 1887
18 Ga0065712_10140700 3300005290 Unclassified 1448
19 Ga0070676_10000717 3300005328 Bacteria 16188
20 Ga0070683_100192760 3300005329 Bacteria 1935
21 Ga0070690_100150015 3300005330 Bacteria 1590
22 Ga0070670_100029160 3300005331 Bacteria 4749
23 Ga0070670_100085544 3300005331 Bacteria 2709
24 Ga0070670_100153380 3300005331 Bacteria 1994
25 Ga0070670_100281944 3300005331 Bacteria 1451
26 Ga0068869_100026799 3300005334 Bacteria 4014
27 Ga0068869_100066614 3300005334 Bacteria 2654
28 Ga0070682_100000008 3300005337 Bacteria 322125
29 Ga0070682_100092017 3300005337 Unclassified 1986
30 Ga0068868_100005661 3300005338 Bacteria 8793
31 Ga0070689_100002057 3300005340 Bacteria 13061
32 Ga0070689_100064533 3300005340 Bacteria 2851
33 Ga0070689_100066244 3300005340 Bacteria 2814
34 Ga0070661_100006097 3300005344 Bacteria 8298
35 Ga0070669_100009090 3300005353 Bacteria 7083
36 Ga0070669_100102836 3300005353 Unclassified 2158
37 Ga0070669_100167455 3300005353 Bacteria 1711
38 Ga0070675_100008510 3300005354 Bacteria 7966
39 Ga0070675_100106091 3300005354 Unclassified 2371
40 Ga0070675_100269803 3300005354 Unclassified 1493
41 Ga0070675_100384585 3300005354 Unclassified 1250
42 Ga0070674_100033573 3300005356 Bacteria 3417
43 Ga0070673_100328025 3300005364 Unclassified 1353
44 Ga0070688_100001996 3300005365 Bacteria 10284
45 Ga0070688_100054462 3300005365 Bacteria 2505
46 Ga0070659_100004858 3300005366 Bacteria 9605
47 Ga0070659_100012321 3300005366 Bacteria 6337
48 Ga0070667_100212164 3300005367 Bacteria 1721
49 Ga0070714_100249007 3300005435 Bacteria 1642
50 Ga0070681_10077822 3300005458 Bacteria 3273
51 Ga0068867_100016779 3300005459 Bacteria 5203
52 Ga0068867_100039531 3300005459 Bacteria 3439
53 Ga0068867_100108976 3300005459 Bacteria 2125
54 Ga0070685_10005013 3300005466 Bacteria 6706
55 Ga0070685_10011213 3300005466 Bacteria 4689
56 Ga0070698_100012041 3300005471 Bacteria 9170
57 Ga0070698_100016818 3300005471 Bacteria 7715
58 Ga0070698_100184507 3300005471 Bacteria 2024
59 Ga0070679_100094302 3300005530 Bacteria 2980
60 Ga0070684_100007720 3300005535 Bacteria 8385
61 Ga0070684_100067126 3300005535 Bacteria 3149
62 Ga0070684_100248314 3300005535 Unclassified 1626
63 Ga0068853_100002113 3300005539 Bacteria 14749
64 Ga0068853_100007142 3300005539 Bacteria 8932
65 Ga0068853_100289278 3300005539 Unclassified 1512
66 Ga0070672_100156719 3300005543 Unclassified 1886
67 Ga0070672_100296943 3300005543 Bacteria 1369
68 Ga0068855_100000033 3300005563 Bacteria 167299
69 Ga0068855_100005067 3300005563 Bacteria 16070
70 Ga0068855_100044992 3300005563 Bacteria 5223
71 Ga0068855_100225447 3300005563 Bacteria 2100
72 Ga0070664_100022102 3300005564 Bacteria 5245
73 Ga0070664_100077702 3300005564 Bacteria 2854
74 Ga0068857_100002917 3300005577 Bacteria 14096
75 Ga0068857_100006200 3300005577 Bacteria 10223
76 Ga0068857_100037938 3300005577 Bacteria 4269
77 Ga0068857_100315505 3300005577 Bacteria 1443
78 Ga0068854_100222448 3300005578 Bacteria 1494
79 Ga0068854_100390453 3300005578 Unclassified 1149
80 Ga0068856_100086801 3300005614 Bacteria 3109
81 Ga0068856_100097017 3300005614 Bacteria 2937
82 Ga0068852_100001055 3300005616 Bacteria 18186
83 Ga0068852_100050231 3300005616 Bacteria 3572
84 Ga0068852_100218929 3300005616 Bacteria 1810
85 Ga0068852_100363657 3300005616 Unclassified 1416
86 Ga0068852_100587598 3300005616 Bacteria 1117
87 Ga0068859_100000903 3300005617 Bacteria 30294
88 Ga0068859_100037703 3300005617 Bacteria 4851
89 Ga0068864_100058330 3300005618 Bacteria 3336
90 Ga0068866_10202729 3300005718 Bacteria 1186
91 Ga0068861_100012397 3300005719 Bacteria 5946
92 Ga0068861_100056961 3300005719 Bacteria 2985
93 Ga0068851_10041853 3300005834 Bacteria 2305
94 Ga0068863_100039091 3300005841 Bacteria 4516
95 Ga0068863_100132970 3300005841 Bacteria 2375
96 Ga0068863_100283100 3300005841 Unclassified 1606
97 Ga0068858_100716794 3300005842 Unclassified 974
98 Ga0068860_100018529 3300005843 Bacteria 6771
99 Ga0068860_100020402 3300005843 Bacteria 6419
100 Ga0068860_100033312 3300005843 Bacteria 4945
101 Ga0068860_100047416 3300005843 Bacteria 4095
102 Ga0068860_100084764 3300005843 Bacteria 3014
103 Ga0068860_100406126 3300005843 Unclassified 1348
104 Ga0075366_10056095 3300006195 Bacteria 2340
105 Ga0075366_10219993 3300006195 Bacteria 1157
106 Ga0075366_10241075 3300006195 Unclassified 1102
107 Ga0097621_100052424 3300006237 Bacteria 3323
108 Ga0075428_100026545 3300006844 Bacteria 6411
109 Ga0075431_100006094 3300006847 Bacteria 11955
110 Ga0075429_100019337 3300006880 Bacteria 5898
111 Ga0068865_100220700 3300006881 Bacteria 1482
112 Ga0097620_100000903 3300006931 Bacteria 30294
113 Ga0097620_100037703 3300006931 Bacteria 4851
114 Ga0105240_10031081 3300009093 Bacteria 6929
115 Ga0105240_10089782 3300009093 Bacteria 3758
116 Ga0105240_10127047 3300009093 Bacteria 3062
117 Ga0111539_10029304 3300009094 Bacteria 6706
118 Ga0111539_10266797 3300009094 Unclassified 1993
119 Ga0114129_10005921 3300009147 Bacteria 17303
120 Ga0114129_10083285 3300009147 Bacteria 4444
121 Ga0105241_10064793 3300009174 Bacteria 2822
122 Ga0105241_10178431 3300009174 Bacteria 1760
123 Ga0105242_10006165 3300009176 Bacteria 9237
124 Ga0105242_10043108 3300009176 Bacteria 3649
125 Ga0105242_10112472 3300009176 Bacteria 2324
126 Ga0105237_10003559 3300009545 Bacteria 18462
127 Ga0105237_10008008 3300009545 Bacteria 11501
128 Ga0105237_10310180 3300009545 Bacteria 1581
129 Ga0105237_10571769 3300009545 Unclassified 1137
130 Ga0105238_10096281 3300009551 Bacteria 2946
131 Ga0105249_10022889 3300009553 Bacteria 5601
132 Ga0105249_10060575 3300009553 Bacteria 3473
133 Ga0105249_10066478 3300009553 Bacteria 3319
134 Ga0105249_10362827 3300009553 Bacteria 1470
135 Ga0105239_10009618 3300010375 Bacteria 10876
136 Ga0105239_10024426 3300010375 Bacteria 6660
137 Ga0105239_10183673 3300010375 Bacteria 2340
138 Ga0105239_10350552 3300010375 Bacteria 1667
139 Ga0157373_10013809 3300013100 Bacteria 5921
140 Ga0157373_10085720 3300013100 Unclassified 2220
141 Ga0157373_10297784 3300013100 Bacteria 1145
142 Ga0157371_10002288 3300013102 Bacteria 18460
143 Ga0157371_10008174 3300013102 Bacteria 8366
144 Ga0157371_10057809 3300013102 Bacteria 2750
145 Ga0157370_10005719 3300013104 Bacteria 13898
146 Ga0157370_10020074 3300013104 Bacteria 6683
147 Ga0157370_10098595 3300013104 Bacteria 2740
148 Ga0157370_10171128 3300013104 Bacteria 2019
149 Ga0157369_10086279 3300013105 Bacteria 3352
150 Ga0157369_10262362 3300013105 Bacteria 1801
151 Ga0157374_10105780 3300013296 Bacteria 2703
152 Ga0157374_10294969 3300013296 Bacteria 1603
153 Ga0157378_10042945 3300013297 Unclassified 4014
154 Ga0163162_10000446 3300013306 Bacteria 38191
155 Ga0163162_10338645 3300013306 Bacteria 1637
156 Ga0157372_10011818 3300013307 Bacteria 9301
157 Ga0157372_10120657 3300013307 Bacteria 3011
158 Ga0157372_10133840 3300013307 Bacteria 2854
159 Ga0157372_10137642 3300013307 Bacteria 2813
160 Ga0157372_10222617 3300013307 Bacteria 2187
161 Ga0157372_10347297 3300013307 Bacteria 1728
162 Ga0157375_10029016 3300013308 Bacteria 5196
163 Ga0157375_10078148 3300013308 Bacteria 3341
164 Ga0157375_10192241 3300013308 Bacteria 2196
165 Ga0157375_10450989 3300013308 Unclassified 1452
166 Ga0163163_10008828 3300014325 Bacteria 8972
167 Ga0163163_10135983 3300014325 Bacteria 2499
168 Ga0163163_10451926 3300014325 Bacteria 1345
169 Ga0157380_10005980 3300014326 Bacteria 8515
170 Ga0157380_10116804 3300014326 Bacteria 2253
171 Ga0157377_10019948 3300014745 Bacteria 3505
172 Ga0157377_10040455 3300014745 Bacteria 2581
173 Ga0157379_10485998 3300014968 Bacteria 1143
174 Ga0157376_10004460 3300014969 Bacteria 9755
175 Ga0182005_1000017 3300015265 Bacteria 331828
176 Ga0163161_10366368 3300017792 Unclassified 1149
177 Ga0209436_102771 3300025208 Bacteria 5009
178 Ga0207426_1004966 3300025302 Bacteria 6269
179 Ga0209257_1000004 3300025304 Bacteria 1678347
180 Ga0207656_10014792 3300025321 Bacteria 3014
181 Ga0207647_10000064 3300025904 Bacteria 82970
182 Ga0207647_10026142 3300025904 Bacteria 3823
183 Ga0207645_10095667 3300025907 Bacteria 1912
184 Ga0207654_10006030 3300025911 Bacteria 6093
185 Ga0207671_10025064 3300025914 Bacteria 4482
186 Ga0207681_10017966 3300025923 Bacteria 4448
187 Ga0207681_10041952 3300025923 Bacteria 3053
188 Ga0207681_10167731 3300025923 Unclassified 1661
189 Ga0207650_10017670 3300025925 Bacteria 4995
190 Ga0207650_10028714 3300025925 Unclassified 3992
191 Ga0207650_10392382 3300025925 Bacteria 1148
192 Ga0207659_10141841 3300025926 Bacteria 1866
193 Ga0207664_10213379 3300025929 Bacteria 1671
194 Ga0207690_10007817 3300025932 Bacteria 6349
195 Ga0207690_10011870 3300025932 Bacteria 5208
196 Ga0207690_10133612 3300025932 Bacteria 1819
197 Ga0207706_10101187 3300025933 Bacteria 2535
198 Ga0207686_10000916 3300025934 Bacteria 17663
199 Ga0207686_10097250 3300025934 Bacteria 1958
200 Ga0207670_10307427 3300025936 Unclassified 1243
201 Ga0207691_10126484 3300025940 Unclassified 2261
202 Ga0207689_10081903 3300025942 Bacteria 2653
203 Ga0207661_10213836 3300025944 Bacteria 1701
204 Ga0207679_10006822 3300025945 Bacteria 7238
205 Ga0207679_10325592 3300025945 Bacteria 1332
206 Ga0207667_10000046 3300025949 Bacteria 245420
207 Ga0207667_10000969 3300025949 Bacteria 36612
208 Ga0207667_10016010 3300025949 Bacteria 8490
209 Ga0207667_10063442 3300025949 Bacteria 3860
210 Ga0207651_10058594 3300025960 Bacteria 2662
211 Ga0207651_10255782 3300025960 Unclassified 1435
212 Ga0207712_10020197 3300025961 Bacteria 4360
213 Ga0207712_10094896 3300025961 Bacteria 2205
214 Ga0207668_10450159 3300025972 Unclassified 1099
215 Ga0207640_10381199 3300025981 Unclassified 1142
216 Ga0207677_10004418 3300026023 Bacteria 7542
217 Ga0207639_10001705 3300026041 Bacteria 14811
218 Ga0207639_10007951 3300026041 Bacteria 7244
219 Ga0207639_10072532 3300026041 Bacteria 2696
220 Ga0207641_10002362 3300026088 Bacteria 17425
221 Ga0207641_10067002 3300026088 Bacteria 3074
222 Ga0207641_10098585 3300026088 Bacteria 2570
223 Ga0207641_10147651 3300026088 Unclassified 2127
224 Ga0207648_10002903 3300026089 Bacteria 18147
225 Ga0207648_10039621 3300026089 Bacteria 4143
226 Ga0207648_10074091 3300026089 Bacteria 2967
227 Ga0207648_10101455 3300026089 Bacteria 2522
228 Ga0207676_10293096 3300026095 Bacteria 1482
229 Ga0207674_10006762 3300026116 Bacteria 13458
230 Ga0207674_10049461 3300026116 Bacteria 4299
231 Ga0207674_10052322 3300026116 Bacteria 4165
232 Ga0207674_10103310 3300026116 Bacteria 2829
233 Ga0207675_100025736 3300026118 Bacteria 5476
234 Ga0207675_100040269 3300026118 Bacteria 4362
235 Ga0207675_100616367 3300026118 Bacteria 1089
236 Ga0207698_10018936 3300026142 Bacteria 4702
237 Ga0207698_10074007 3300026142 Bacteria 2715
238 Ga0207698_10377956 3300026142 Unclassified 1347
239 Ga0207698_10545112 3300026142 Bacteria 1136
240 Ga0268265_10137919 3300028380 Bacteria 2038
241 Ga0268264_10002782 3300028381 Bacteria 15265
242 Ga0268264_10024091 3300028381 Bacteria 4968
243 Ga0268264_10041778 3300028381 Unclassified 3794
244 Ga0307515_10000001 3300028794 Bacteria 4259510
245 Ga0307511_10000076 3300030521 Bacteria 82520
246 Ga0265327_10005660 3300031251 Bacteria 10341
247 Ga0307513_10083440 3300031456 Bacteria 3286
248 Ga0307513_10324246 3300031456 Bacteria 1297
249 Ga0307509_10006651 3300031507 Bacteria 15434
250 Ga0307410_10301713 3300031852 Bacteria 1264
251 Ga0307412_10107712 3300031911 Bacteria 1984
252 Ga0307414_10196039 3300032004 Unclassified 1639
253 Ga0395899_0014086 3300037312 Bacteria 6104
254 Ga0395900_0342717 3300037418 Bacteria 1469
255 Ga0395898_0006233 3300037466 Bacteria 12776
256 Ga0395905_0007935 3300037471 Bacteria 10499
257 Ga0395901_0031681 3300038443 Bacteria 5451
258 Ga0436365_1632212 3300039437 Bacteria 4094
259 Ga0439436_0006208 3300041404 Bacteria 3669
260 Ga0451804_0972321 3300041463 Bacteria 2033
261 Ga0451841_0708271 3300041498 Bacteria 1955
262 Ga0439431_0011618 3300041997 Bacteria 2014
263 Ga0439449_0002701 3300042007 Bacteria 6907
264 Ga0439449_0011879 3300042007 Bacteria 3274
265 Ga0439449_0092309 3300042007 Bacteria 1118
266 Ga0439457_000805 3300042014 Bacteria 9361
267 Ga0439457_016051 3300042014 Unclassified 1671
268 Ga0439462_0016463 3300042015 Bacteria 1909
269 Ga0439434_0034879 3300042435 Unclassified 1537
270 Ga0466969_0000110 3300044656 Bacteria 43267
271 Ga0466969_0077816 3300044656 Bacteria 1587
272 Ga0466972_0000049 3300044658 Bacteria 118829
273 Ga0466972_0000057 3300044658 Bacteria 110775
274 Ga0466972_0006801 3300044658 Bacteria 5739
275 Ga0466966_0000015 3300044684 Bacteria 127402
276 Ga0453684_0694487 3300044712 Unclassified 1106
277 Ga0466968_0147116 3300044735 Bacteria 1081
278 Ga0466970_0005074 3300044765 Bacteria 6509
279 Ga0466957_0001048 3300044842 Bacteria 14258
280 Ga0466957_0136821 3300044842 Bacteria 1575
281 Ga0466960_0017120 3300044901 Bacteria 3155
282 Ga0466959_0000030 3300045049 Bacteria 111343
283 Ga0495627_001426 3300046453 Bacteria 14067
284 Ga0495639_0049468 3300046475 Bacteria 1908
285 Ga0495633_0000036 3300046558 Bacteria 184999
286 Ga0495668_0000082 3300046616 Bacteria 154982
287 Ga0495674_0175856 3300047319 Bacteria 1784
288 Ga0495672_0098720 3300047320 Bacteria 1588
289 Ga0495686_0009638 3300047472 Bacteria 6937
290 Ga0496121_0000082 3300048924 Bacteria 228557
291 Ga0496124_0101655 3300048927 Bacteria 2328
292 Ga0496126_0031192 3300048929 Bacteria 5040
293 Ga0501300_007019 3300049523 Bacteria 1650
294 Ga0501032_0013835 3300049569 Bacteria 5725
295 Ga0501034_0000007 3300049571 Bacteria 357805
296 Ga0501034_0069252 3300049571 Bacteria 3539
297 Ga0501034_0284888 3300049571 Bacteria 1591
298 Ga0501036_0105601 3300049572 Bacteria 2382
299 Ga0501038_0062799 3300049574 Unclassified 3172
300 Ga0501038_0315749 3300049574 Bacteria 1223
301 Ga0501039_0066432 3300049575 Unclassified 2799
302 Ga0501043_0025982 3300049579 Unclassified 4594
303 Ga0501043_0213123 3300049579 Bacteria 1496
304 Ga0501046_0141288 3300049580 Unclassified 1822
305 Ga0501047_0033307 3300049581 Bacteria 4973
306 Ga0501047_0049456 3300049581 Bacteria 4060
307 Ga0501047_0078341 3300049581 Bacteria 3178
308 Ga0501048_0014691 3300049582 Bacteria 5793
309 Ga0501073_0014054 3300049589 Bacteria 5815
310 Ga0501074_0007673 3300049590 Bacteria 7812
311 Ga0501202_002034 3300049652 Bacteria 3344
312 Ga0501207_005473 3300049654 Bacteria 1759
313 Ga0501217_017140 3300049661 Bacteria 1668
314 Ga0501233_011623 3300049668 Bacteria 1755
315 Ga0501235_001921 3300049669 Bacteria 4443
316 Ga0501257_028991 3300049686 Bacteria 1329
317 Ga0501259_008562 3300049688 Bacteria 1649
318 Ga0501221_000798 3300049704 Bacteria 5105
319 Ga0501225_0003276 3300049705 Bacteria 4939
320 Ga0501234_001544 3300049707 Bacteria 3609
321 Ga0501080_0183816 3300049742 Bacteria 1923
322 Ga0501080_0257180 3300049742 Bacteria 1591
323 Ga0501080_0283182 3300049742 Unclassified 1506
324 Ga0501266_006567 3300049763 Bacteria 1446
325 Ga0501035_0125743 3300049822 Bacteria 2238
326 Ga0501044_0006850 3300049823 Bacteria 12559
327 Ga0501044_0010710 3300049823 Bacteria 9950
328 Ga0501044_0010855 3300049823 Bacteria 9883
329 Ga0501044_0158514 3300049823 Bacteria 2242
330 Ga0501284_00002 3300050005 Bacteria 220402
331 nmdc:mga0k408_115058_c1 3300050493 Bacteria 1591
332 nmdc:mga0k408_117764_c1 3300050493 Bacteria 1572
333 nmdc:mga05p37_4067_c1 3300050507 Bacteria 17096
334 nmdc:mga05p37_97404_c1 3300050507 Bacteria 3623
335 nmdc:mga09592_14308_c1 3300050508 Bacteria 6477
336 nmdc:mga09592_93410_c1 3300050508 Unclassified 2573
337 nmdc:mga0qj67_20281_c1 3300050509 Bacteria 5087
338 nmdc:mga06r32_35254_c1 3300050510 Unclassified 4721
339 nmdc:mga08y16_456997_c1 3300050511 Bacteria 1302
340 nmdc:mga08y16_57894_c1 3300050511 Bacteria 4049
341 Ga0500578_0000063 3300053086 Bacteria 117869
342 Ga0500646_0001190 3300053090 Bacteria 6990
343 Ga0500583_0000153 3300053092 Bacteria 28587
344 Ga0500583_0000508 3300053092 Bacteria 11956
345 Ga0500651_0084477 3300053093 Bacteria 1963
346 Ga0500641_0008290 3300053096 Bacteria 3707
347 Ga0500562_000094 3300053108 Bacteria 36637
348 Ga0500652_069111 3300053131 Bacteria 1461
349 Ga0500658_0145429 3300053134 Unclassified 1066
350 Ga0500559_0051174 3300053136 Bacteria 1824
351 Ga0500568_0000080 3300053139 Bacteria 92694
352 Ga0500588_0035240 3300053146 Bacteria 1472
353 Ga0500588_0101224 3300053146 Bacteria 993
354 Ga0500622_0000085 3300053156 Bacteria 100276
355 Ga0500622_0000652 3300053156 Bacteria 30940
356 Ga0500611_000003 3300053727 Bacteria 333431
357 Ga0500645_012517 3300053730 Bacteria 2739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10024426 Ga0105239_100244265 273
2 3300005334 Ga0068869_100026799 Ga0068869_1000267994 275
3 3300005353 Ga0070669_100167455 Ga0070669_1001674552 275
4 3300005459 Ga0068867_100108976 Ga0068867_1001089762 275
5 3300005843 Ga0068860_100020402 Ga0068860_1000204025 275
6 3300014325 Ga0163163_10135983 Ga0163163_101359832 275
7 3300005471 Ga0070698_100016818 Ga0070698_1000168185 278
8 3300005435 Ga0070714_100249007 Ga0070714_1002490072 280
9 3300025929 Ga0207664_10213379 Ga0207664_102133792 280
10 3300028794 Ga0307515_10000001 Ga0307515_100000013233 284
11 3300013306 Ga0163162_10000446 Ga0163162_100004466 286
12 3300014968 Ga0157379_10485998 Ga0157379_104859981 286
13 iso_pu_bacteria 2818991442 2819575184 288
14 iso_pu_bacteria 2821136567 2821141287 288
15 iso_pu_bacteria 2904467357 2904471108 288
16 iso_pu_bacteria 2929154850 2929159520 288
17 iso_pu_bacteria 2738541278 2738725566 289
18 3300005289 Ga0065704_10114609 Ga0065704_101146091 290
19 3300046616 Ga0495668_0000082 Ga0495668_0000082_11519_12394 290
20 iso_pu_bacteria 2818991444 2819585714 290
21 iso_pu_bacteria 2929177148 2929177428 290
22 iso_pu_bacteria 2945977869 2945979795 290
23 iso_pu_bacteria 2946013367 2946014338 290
24 3300003323 rootH1_10163462 rootH1_101634621 291
25 3300013105 Ga0157369_10262362 Ga0157369_102623621 291
26 3300013307 Ga0157372_10133840 Ga0157372_101338402 291
27 3300053090 Ga0500646_0001190 Ga0500646_0001190_4176_5051 291
28 3300005354 Ga0070675_100008510 Ga0070675_1000085105 292
29 3300005466 Ga0070685_10011213 Ga0070685_100112134 292
30 3300005563 Ga0068855_100000033 Ga0068855_10000003316 292
31 3300005616 Ga0068852_100363657 Ga0068852_1003636571 292
32 3300006844 Ga0075428_100026545 Ga0075428_1000265455 292
33 3300006847 Ga0075431_100006094 Ga0075431_1000060946 292
34 3300006880 Ga0075429_100019337 Ga0075429_1000193372 292
35 3300009094 Ga0111539_10029304 Ga0111539_100293042 292
36 3300009553 Ga0105249_10066478 Ga0105249_100664784 292
37 3300013308 Ga0157375_10029016 Ga0157375_100290164 292
38 3300015265 Ga0182005_1000017 Ga0182005_100001778 292
39 3300025208 Ga0209436_102771 Ga0209436_1027716 292
40 3300025302 Ga0207426_1004966 Ga0207426_10049665 292
41 3300025949 Ga0207667_10000046 Ga0207667_1000004695 292
42 3300025961 Ga0207712_10020197 Ga0207712_100201974 292
43 3300026088 Ga0207641_10002362 Ga0207641_1000236211 292
44 3300026142 Ga0207698_10377956 Ga0207698_103779562 292
45 3300048924 Ga0496121_0000082 Ga0496121_0000082_135295_136173 292
46 3300049523 Ga0501300_007019 Ga0501300_007019_511_1392 292
47 3300049571 Ga0501034_0069252 Ga0501034_0069252_325_1206 292
48 3300049661 Ga0501217_017140 Ga0501217_017140_644_1522 292
49 3300050508 nmdc:mga09592_14308_c1 nmdc:mga09592_14308_c1_297_1175 292
50 3300050508 nmdc:mga09592_93410_c1 nmdc:mga09592_93410_c1_41_919 292
51 3300050509 nmdc:mga0qj67_20281_c1 nmdc:mga0qj67_20281_c1_3761_4639 292
52 3300050510 nmdc:mga06r32_35254_c1 nmdc:mga06r32_35254_c1_1608_2486 292
53 3300050511 nmdc:mga08y16_57894_c1 nmdc:mga08y16_57894_c1_2477_3373 292
54 3300053108 Ga0500562_000094 Ga0500562_000094_28533_29411 292
55 3300053139 Ga0500568_0000080 Ga0500568_0000080_50290_51234 292
56 3300053730 Ga0500645_012517 Ga0500645_012517_156_1034 292
57 3300002459 JGI24751J29686_10010629 JGI24751J29686_100106292 293
58 3300003316 rootH1_10052596 rootH1_100525962 293
59 3300003320 rootH2_10286261 rootH2_102862613 293
60 3300003322 rootL2_10105144 rootL2_101051442 293
61 3300003322 rootL2_10167491 rootL2_101674912 293
62 3300003323 rootH1_10005722 rootH1_100057226 293
63 3300003323 rootH1_10144952 rootH1_101449522 293
64 3300003323 rootH1_10225103 rootH1_102251032 293
65 3300005290 Ga0065712_10140700 Ga0065712_101407001 293
66 3300005328 Ga0070676_10000717 Ga0070676_1000071716 293
67 3300005329 Ga0070683_100192760 Ga0070683_1001927602 293
68 3300005330 Ga0070690_100150015 Ga0070690_1001500152 293
69 3300005331 Ga0070670_100029160 Ga0070670_1000291601 293
70 3300005331 Ga0070670_100085544 Ga0070670_1000855444 293
71 3300005331 Ga0070670_100153380 Ga0070670_1001533803 293
72 3300005331 Ga0070670_100281944 Ga0070670_1002819442 293
73 3300005334 Ga0068869_100066614 Ga0068869_1000666143 293
74 3300005337 Ga0070682_100000008 Ga0070682_10000000875 293
75 3300005337 Ga0070682_100092017 Ga0070682_1000920171 293
76 3300005338 Ga0068868_100005661 Ga0068868_1000056616 293
77 3300005340 Ga0070689_100002057 Ga0070689_1000020572 293
78 3300005340 Ga0070689_100064533 Ga0070689_1000645331 293
79 3300005340 Ga0070689_100066244 Ga0070689_1000662443 293
80 3300005344 Ga0070661_100006097 Ga0070661_1000060976 293
81 3300005353 Ga0070669_100009090 Ga0070669_1000090906 293
82 3300005353 Ga0070669_100102836 Ga0070669_1001028362 293
83 3300005354 Ga0070675_100106091 Ga0070675_1001060912 293
84 3300005354 Ga0070675_100269803 Ga0070675_1002698031 293
85 3300005354 Ga0070675_100384585 Ga0070675_1003845852 293
86 3300005356 Ga0070674_100033573 Ga0070674_1000335731 293
87 3300005364 Ga0070673_100328025 Ga0070673_1003280251 293
88 3300005365 Ga0070688_100001996 Ga0070688_1000019969 293
89 3300005365 Ga0070688_100054462 Ga0070688_1000544622 293
90 3300005366 Ga0070659_100012321 Ga0070659_1000123214 293
91 3300005367 Ga0070667_100212164 Ga0070667_1002121641 293
92 3300005458 Ga0070681_10077822 Ga0070681_100778223 293
93 3300005459 Ga0068867_100039531 Ga0068867_1000395312 293
94 3300005466 Ga0070685_10005013 Ga0070685_100050134 293
95 3300005471 Ga0070698_100012041 Ga0070698_1000120414 293
96 3300005471 Ga0070698_100184507 Ga0070698_1001845072 293
97 3300005530 Ga0070679_100094302 Ga0070679_1000943022 293
98 3300005535 Ga0070684_100007720 Ga0070684_1000077206 293
99 3300005535 Ga0070684_100067126 Ga0070684_1000671264 293
100 3300005535 Ga0070684_100248314 Ga0070684_1002483142 293
101 3300005539 Ga0068853_100002113 Ga0068853_1000021136 293
102 3300005539 Ga0068853_100007142 Ga0068853_1000071422 293
103 3300005539 Ga0068853_100289278 Ga0068853_1002892781 293
104 3300005543 Ga0070672_100156719 Ga0070672_1001567192 293
105 3300005543 Ga0070672_100296943 Ga0070672_1002969431 293
106 3300005563 Ga0068855_100005067 Ga0068855_1000050678 293
107 3300005563 Ga0068855_100044992 Ga0068855_1000449923 293
108 3300005563 Ga0068855_100225447 Ga0068855_1002254472 293
109 3300005564 Ga0070664_100022102 Ga0070664_1000221022 293
110 3300005564 Ga0070664_100077702 Ga0070664_1000777023 293
111 3300005577 Ga0068857_100002917 Ga0068857_1000029178 293
112 3300005577 Ga0068857_100006200 Ga0068857_1000062008 293
113 3300005577 Ga0068857_100037938 Ga0068857_1000379382 293
114 3300005577 Ga0068857_100315505 Ga0068857_1003155052 293
115 3300005578 Ga0068854_100222448 Ga0068854_1002224482 293
116 3300005578 Ga0068854_100390453 Ga0068854_1003904531 293
117 3300005614 Ga0068856_100086801 Ga0068856_1000868012 293
118 3300005614 Ga0068856_100097017 Ga0068856_1000970172 293
119 3300005616 Ga0068852_100050231 Ga0068852_1000502312 293
120 3300005616 Ga0068852_100218929 Ga0068852_1002189292 293
121 3300005616 Ga0068852_100587598 Ga0068852_1005875981 293
122 3300005617 Ga0068859_100000903 Ga0068859_1000009034 293
123 3300005617 Ga0068859_100037703 Ga0068859_1000377032 293
124 3300005618 Ga0068864_100058330 Ga0068864_1000583304 293
125 3300005718 Ga0068866_10202729 Ga0068866_102027291 293
126 3300005719 Ga0068861_100012397 Ga0068861_1000123975 293
127 3300005719 Ga0068861_100056961 Ga0068861_1000569612 293
128 3300005834 Ga0068851_10041853 Ga0068851_100418533 293
129 3300005841 Ga0068863_100039091 Ga0068863_1000390914 293
130 3300005841 Ga0068863_100132970 Ga0068863_1001329703 293
131 3300005841 Ga0068863_100283100 Ga0068863_1002831002 293
132 3300005842 Ga0068858_100716794 Ga0068858_1007167941 293
133 3300005843 Ga0068860_100018529 Ga0068860_1000185295 293
134 3300005843 Ga0068860_100033312 Ga0068860_1000333122 293
135 3300005843 Ga0068860_100047416 Ga0068860_1000474162 293
136 3300005843 Ga0068860_100084764 Ga0068860_1000847644 293
137 3300005843 Ga0068860_100406126 Ga0068860_1004061261 293
138 3300006195 Ga0075366_10056095 Ga0075366_100560952 293
139 3300006195 Ga0075366_10219993 Ga0075366_102199931 293
140 3300006237 Ga0097621_100052424 Ga0097621_1000524243 293
141 3300006881 Ga0068865_100220700 Ga0068865_1002207002 293
142 3300006931 Ga0097620_100000903 Ga0097620_10000090326 293
143 3300006931 Ga0097620_100037703 Ga0097620_1000377032 293
144 3300009093 Ga0105240_10031081 Ga0105240_100310816 293
145 3300009093 Ga0105240_10089782 Ga0105240_100897823 293
146 3300009093 Ga0105240_10127047 Ga0105240_101270472 293
147 3300009094 Ga0111539_10266797 Ga0111539_102667972 293
148 3300009147 Ga0114129_10005921 Ga0114129_100059216 293
149 3300009147 Ga0114129_10083285 Ga0114129_100832853 293
150 3300009174 Ga0105241_10064793 Ga0105241_100647932 293
151 3300009174 Ga0105241_10178431 Ga0105241_101784312 293
152 3300009176 Ga0105242_10006165 Ga0105242_100061653 293
153 3300009176 Ga0105242_10043108 Ga0105242_100431081 293
154 3300009176 Ga0105242_10112472 Ga0105242_101124721 293
155 3300009545 Ga0105237_10003559 Ga0105237_1000355915 293
156 3300009545 Ga0105237_10008008 Ga0105237_100080082 293
157 3300009545 Ga0105237_10310180 Ga0105237_103101802 293
158 3300009545 Ga0105237_10571769 Ga0105237_105717692 293
159 3300009551 Ga0105238_10096281 Ga0105238_100962812 293
160 3300009553 Ga0105249_10022889 Ga0105249_100228894 293
161 3300009553 Ga0105249_10060575 Ga0105249_100605753 293
162 3300009553 Ga0105249_10362827 Ga0105249_103628271 293
163 3300010375 Ga0105239_10009618 Ga0105239_100096182 293
164 3300010375 Ga0105239_10350552 Ga0105239_103505522 293
165 3300013100 Ga0157373_10013809 Ga0157373_100138092 293
166 3300013100 Ga0157373_10085720 Ga0157373_100857203 293
167 3300013102 Ga0157371_10002288 Ga0157371_100022889 293
168 3300013102 Ga0157371_10008174 Ga0157371_1000817410 293
169 3300013104 Ga0157370_10005719 Ga0157370_100057196 293
170 3300013104 Ga0157370_10020074 Ga0157370_100200741 293
171 3300013104 Ga0157370_10098595 Ga0157370_100985952 293
172 3300013104 Ga0157370_10171128 Ga0157370_101711282 293
173 3300013105 Ga0157369_10086279 Ga0157369_100862792 293
174 3300013296 Ga0157374_10105780 Ga0157374_101057803 293
175 3300013296 Ga0157374_10294969 Ga0157374_102949692 293
176 3300013297 Ga0157378_10042945 Ga0157378_100429455 293
177 3300013306 Ga0163162_10338645 Ga0163162_103386452 293
178 3300013307 Ga0157372_10011818 Ga0157372_100118183 293
179 3300013307 Ga0157372_10137642 Ga0157372_101376422 293
180 3300013307 Ga0157372_10222617 Ga0157372_102226172 293
181 3300013308 Ga0157375_10078148 Ga0157375_100781483 293
182 3300013308 Ga0157375_10192241 Ga0157375_101922412 293
183 3300013308 Ga0157375_10450989 Ga0157375_104509891 293
184 3300014325 Ga0163163_10008828 Ga0163163_100088283 293
185 3300014325 Ga0163163_10451926 Ga0163163_104519262 293
186 3300014326 Ga0157380_10005980 Ga0157380_100059807 293
187 3300014326 Ga0157380_10116804 Ga0157380_101168042 293
188 3300014745 Ga0157377_10019948 Ga0157377_100199484 293
189 3300014745 Ga0157377_10040455 Ga0157377_100404553 293
190 3300014969 Ga0157376_10004460 Ga0157376_100044608 293
191 3300017792 Ga0163161_10366368 Ga0163161_103663681 293
192 3300025321 Ga0207656_10014792 Ga0207656_100147921 293
193 3300025904 Ga0207647_10026142 Ga0207647_100261422 293
194 3300025907 Ga0207645_10095667 Ga0207645_100956672 293
195 3300025911 Ga0207654_10006030 Ga0207654_100060302 293
196 3300025914 Ga0207671_10025064 Ga0207671_100250642 293
197 3300025923 Ga0207681_10017966 Ga0207681_100179664 293
198 3300025923 Ga0207681_10041952 Ga0207681_100419522 293
199 3300025923 Ga0207681_10167731 Ga0207681_101677312 293
200 3300025925 Ga0207650_10017670 Ga0207650_100176702 293
201 3300025925 Ga0207650_10028714 Ga0207650_100287144 293
202 3300025925 Ga0207650_10392382 Ga0207650_103923822 293
203 3300025926 Ga0207659_10141841 Ga0207659_101418414 293
204 3300025932 Ga0207690_10007817 Ga0207690_100078173 293
205 3300025932 Ga0207690_10133612 Ga0207690_101336122 293
206 3300025933 Ga0207706_10101187 Ga0207706_101011872 293
207 3300025934 Ga0207686_10000916 Ga0207686_1000091613 293
208 3300025934 Ga0207686_10097250 Ga0207686_100972502 293
209 3300025936 Ga0207670_10307427 Ga0207670_103074272 293
210 3300025940 Ga0207691_10126484 Ga0207691_101264842 293
211 3300025942 Ga0207689_10081903 Ga0207689_100819033 293
212 3300025944 Ga0207661_10213836 Ga0207661_102138361 293
213 3300025945 Ga0207679_10006822 Ga0207679_100068226 293
214 3300025945 Ga0207679_10325592 Ga0207679_103255922 293
215 3300025949 Ga0207667_10000969 Ga0207667_1000096927 293
216 3300025949 Ga0207667_10016010 Ga0207667_100160104 293
217 3300025949 Ga0207667_10063442 Ga0207667_100634422 293
218 3300025960 Ga0207651_10058594 Ga0207651_100585943 293
219 3300025960 Ga0207651_10255782 Ga0207651_102557822 293
220 3300025961 Ga0207712_10094896 Ga0207712_100948962 293
221 3300025972 Ga0207668_10450159 Ga0207668_104501591 293
222 3300025981 Ga0207640_10381199 Ga0207640_103811991 293
223 3300026023 Ga0207677_10004418 Ga0207677_100044185 293
224 3300026041 Ga0207639_10001705 Ga0207639_100017055 293
225 3300026041 Ga0207639_10007951 Ga0207639_100079512 293
226 3300026041 Ga0207639_10072532 Ga0207639_100725322 293
227 3300026088 Ga0207641_10067002 Ga0207641_100670023 293
228 3300026088 Ga0207641_10098585 Ga0207641_100985852 293
229 3300026088 Ga0207641_10147651 Ga0207641_101476512 293
230 3300026089 Ga0207648_10002903 Ga0207648_1000290311 293
231 3300026089 Ga0207648_10074091 Ga0207648_100740913 293
232 3300026089 Ga0207648_10101455 Ga0207648_101014551 293
233 3300026095 Ga0207676_10293096 Ga0207676_102930961 293
234 3300026116 Ga0207674_10006762 Ga0207674_100067623 293
235 3300026116 Ga0207674_10049461 Ga0207674_100494613 293
236 3300026116 Ga0207674_10052322 Ga0207674_100523222 293
237 3300026116 Ga0207674_10103310 Ga0207674_101033101 293
238 3300026118 Ga0207675_100025736 Ga0207675_1000257365 293
239 3300026118 Ga0207675_100040269 Ga0207675_1000402694 293
240 3300026142 Ga0207698_10018936 Ga0207698_100189363 293
241 3300026142 Ga0207698_10545112 Ga0207698_105451121 293
242 3300028380 Ga0268265_10137919 Ga0268265_101379192 293
243 3300028381 Ga0268264_10002782 Ga0268264_100027822 293
244 3300028381 Ga0268264_10024091 Ga0268264_100240914 293
245 3300028381 Ga0268264_10041778 Ga0268264_100417782 293
246 3300030521 Ga0307511_10000076 Ga0307511_1000007664 293
247 3300031456 Ga0307513_10083440 Ga0307513_100834403 293
248 3300031456 Ga0307513_10324246 Ga0307513_103242462 293
249 3300031507 Ga0307509_10006651 Ga0307509_100066515 293
250 3300037312 Ga0395899_0014086 Ga0395899_0014086_4640_5527 293
251 3300037418 Ga0395900_0342717 Ga0395900_0342717_427_1314 293
252 3300037466 Ga0395898_0006233 Ga0395898_0006233_11734_12621 293
253 3300038443 Ga0395901_0031681 Ga0395901_0031681_3480_4367 293
254 3300041404 Ga0439436_0006208 Ga0439436_0006208_2243_3124 293
255 3300041463 Ga0451804_0972321 Ga0451804_0972321_484_1365 293
256 3300041498 Ga0451841_0708271 Ga0451841_0708271_1032_1913 293
257 3300042014 Ga0439457_000805 Ga0439457_000805_4305_5186 293
258 3300042014 Ga0439457_016051 Ga0439457_016051_458_1339 293
259 3300042015 Ga0439462_0016463 Ga0439462_0016463_137_1018 293
260 3300042435 Ga0439434_0034879 Ga0439434_0034879_414_1295 293
261 3300044656 Ga0466969_0000110 Ga0466969_0000110_10028_10909 293
262 3300044656 Ga0466969_0077816 Ga0466969_0077816_310_1224 293
263 3300044658 Ga0466972_0000049 Ga0466972_0000049_36202_37083 293
264 3300044658 Ga0466972_0000057 Ga0466972_0000057_73692_74573 293
265 3300044658 Ga0466972_0006801 Ga0466972_0006801_1884_2765 293
266 3300044684 Ga0466966_0000015 Ga0466966_0000015_40948_41829 293
267 3300044712 Ga0453684_0694487 Ga0453684_0694487_39_920 293
268 3300044735 Ga0466968_0147116 Ga0466968_0147116_14_895 293
269 3300044765 Ga0466970_0005074 Ga0466970_0005074_1123_2004 293
270 3300044842 Ga0466957_0001048 Ga0466957_0001048_10690_11571 293
271 3300044901 Ga0466960_0017120 Ga0466960_0017120_314_1195 293
272 3300045049 Ga0466959_0000030 Ga0466959_0000030_96870_97751 293
273 3300046453 Ga0495627_001426 Ga0495627_001426_7178_8059 293
274 3300046475 Ga0495639_0049468 Ga0495639_0049468_966_1847 293
275 3300046558 Ga0495633_0000036 Ga0495633_0000036_142438_143319 293
276 3300047319 Ga0495674_0175856 Ga0495674_0175856_745_1626 293
277 3300047320 Ga0495672_0098720 Ga0495672_0098720_124_1005 293
278 3300047472 Ga0495686_0009638 Ga0495686_0009638_3100_3981 293
279 3300049569 Ga0501032_0013835 Ga0501032_0013835_1975_2856 293
280 3300049571 Ga0501034_0284888 Ga0501034_0284888_546_1481 293
281 3300049572 Ga0501036_0105601 Ga0501036_0105601_1135_2070 293
282 3300049574 Ga0501038_0062799 Ga0501038_0062799_446_1327 293
283 3300049574 Ga0501038_0315749 Ga0501038_0315749_87_995 293
284 3300049575 Ga0501039_0066432 Ga0501039_0066432_1847_2728 293
285 3300049579 Ga0501043_0025982 Ga0501043_0025982_138_1046 293
286 3300049579 Ga0501043_0213123 Ga0501043_0213123_111_1046 293
287 3300049580 Ga0501046_0141288 Ga0501046_0141288_265_1146 293
288 3300049581 Ga0501047_0033307 Ga0501047_0033307_1575_2456 293
289 3300049581 Ga0501047_0049456 Ga0501047_0049456_3114_3995 293
290 3300049581 Ga0501047_0078341 Ga0501047_0078341_713_1648 293
291 3300049582 Ga0501048_0014691 Ga0501048_0014691_1157_2065 293
292 3300049589 Ga0501073_0014054 Ga0501073_0014054_4770_5705 293
293 3300049590 Ga0501074_0007673 Ga0501074_0007673_6739_7647 293
294 3300049742 Ga0501080_0183816 Ga0501080_0183816_109_990 293
295 3300049742 Ga0501080_0257180 Ga0501080_0257180_111_1046 293
296 3300049742 Ga0501080_0283182 Ga0501080_0283182_53_961 293
297 3300049822 Ga0501035_0125743 Ga0501035_0125743_931_1812 293
298 3300049823 Ga0501044_0006850 Ga0501044_0006850_5251_6159 293
299 3300049823 Ga0501044_0010710 Ga0501044_0010710_7764_8645 293
300 3300049823 Ga0501044_0010855 Ga0501044_0010855_69_950 293
301 3300049823 Ga0501044_0158514 Ga0501044_0158514_814_1695 293
302 3300050005 Ga0501284_00002 Ga0501284_00002_53968_54849 293
303 3300050493 nmdc:mga0k408_115058_c1 nmdc:mga0k408_115058_c1_586_1467 293
304 3300050493 nmdc:mga0k408_117764_c1 nmdc:mga0k408_117764_c1_558_1439 293
305 3300050507 nmdc:mga05p37_4067_c1 nmdc:mga05p37_4067_c1_7679_8560 293
306 3300050507 nmdc:mga05p37_97404_c1 nmdc:mga05p37_97404_c1_1186_2067 293
307 3300050511 nmdc:mga08y16_456997_c1 nmdc:mga08y16_456997_c1_36_917 293
308 3300053086 Ga0500578_0000063 Ga0500578_0000063_25641_26522 293
309 3300053092 Ga0500583_0000153 Ga0500583_0000153_3470_4351 293
310 3300053092 Ga0500583_0000508 Ga0500583_0000508_6851_7732 293
311 3300053093 Ga0500651_0084477 Ga0500651_0084477_1013_1894 293
312 3300053096 Ga0500641_0008290 Ga0500641_0008290_1999_2955 293
313 3300053131 Ga0500652_069111 Ga0500652_069111_449_1330 293
314 3300053134 Ga0500658_0145429 Ga0500658_0145429_106_987 293
315 3300053146 Ga0500588_0035240 Ga0500588_0035240_327_1208 293
316 3300053146 Ga0500588_0101224 Ga0500588_0101224_23_904 293
317 3300053156 Ga0500622_0000652 Ga0500622_0000652_2346_3227 293
318 3300053727 Ga0500611_000003 Ga0500611_000003_306462_307466 293
319 3300000545 CNXas_1000467 CNXas_10004673 294
320 3300001904 JGI24736J21556_1004966 JGI24736J21556_10049663 294
321 3300003316 rootH1_10159277 rootH1_101592771 294
322 3300003322 rootL2_10001250 rootL2_100012507 294
323 3300003322 rootL2_10078655 rootL2_100786552 294
324 3300003322 rootL2_10086736 rootL2_100867362 294
325 3300003794 Ga0055531_10000005 Ga0055531_10000005143 294
326 3300005366 Ga0070659_100004858 Ga0070659_1000048583 294
327 3300005459 Ga0068867_100016779 Ga0068867_1000167794 294
328 3300005616 Ga0068852_100001055 Ga0068852_10000105516 294
329 3300006195 Ga0075366_10241075 Ga0075366_102410752 294
330 3300010375 Ga0105239_10183673 Ga0105239_101836732 294
331 3300013100 Ga0157373_10297784 Ga0157373_102977842 294
332 3300013102 Ga0157371_10057809 Ga0157371_100578092 294
333 3300013307 Ga0157372_10120657 Ga0157372_101206573 294
334 3300013307 Ga0157372_10347297 Ga0157372_103472971 294
335 3300025304 Ga0209257_1000004 Ga0209257_1000004266 294
336 3300025904 Ga0207647_10000064 Ga0207647_1000006459 294
337 3300025932 Ga0207690_10011870 Ga0207690_100118707 294
338 3300026089 Ga0207648_10039621 Ga0207648_100396212 294
339 3300026118 Ga0207675_100616367 Ga0207675_1006163671 294
340 3300026142 Ga0207698_10074007 Ga0207698_100740073 294
341 3300031251 Ga0265327_10005660 Ga0265327_100056608 294
342 3300031852 Ga0307410_10301713 Ga0307410_103017132 294
343 3300031911 Ga0307412_10107712 Ga0307412_101077122 294
344 3300032004 Ga0307414_10196039 Ga0307414_101960391 294
345 3300037471 Ga0395905_0007935 Ga0395905_0007935_8310_9200 294
346 3300039437 Ga0436365_1632212 Ga0436365_1632212_2823_3710 294
347 3300041997 Ga0439431_0011618 Ga0439431_0011618_814_1698 294
348 3300042007 Ga0439449_0002701 Ga0439449_0002701_3513_4403 294
349 3300042007 Ga0439449_0011879 Ga0439449_0011879_2108_2992 294
350 3300042007 Ga0439449_0092309 Ga0439449_0092309_115_999 294
351 3300044842 Ga0466957_0136821 Ga0466957_0136821_654_1538 294
352 3300048927 Ga0496124_0101655 Ga0496124_0101655_730_1614 294
353 3300048929 Ga0496126_0031192 Ga0496126_0031192_2681_3565 294
354 3300049571 Ga0501034_0000007 Ga0501034_0000007_259027_259914 294
355 3300049652 Ga0501202_002034 Ga0501202_002034_546_1436 294
356 3300049654 Ga0501207_005473 Ga0501207_005473_663_1553 294
357 3300049668 Ga0501233_011623 Ga0501233_011623_446_1336 294
358 3300049669 Ga0501235_001921 Ga0501235_001921_2872_3762 294
359 3300049686 Ga0501257_028991 Ga0501257_028991_330_1217 294
360 3300049688 Ga0501259_008562 Ga0501259_008562_688_1578 294
361 3300049704 Ga0501221_000798 Ga0501221_000798_3337_4227 294
362 3300049705 Ga0501225_0003276 Ga0501225_0003276_2864_3754 294
363 3300049707 Ga0501234_001544 Ga0501234_001544_689_1579 294
364 3300049763 Ga0501266_006567 Ga0501266_006567_145_1032 294
365 3300053136 Ga0500559_0051174 Ga0500559_0051174_755_1639 294
366 3300053156 Ga0500622_0000085 Ga0500622_0000085_25462_26346 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

23

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pm7-assembly1.cif.gz_C crystal structure of yeast sec13/31 edge element of the copii vesicular coat, selenomethionine version 0.9289 251 292
3rh7-assembly3.cif.gz_F crystal structure of a putative oxidoreductase (sma0793) from sinorhizobium meliloti 1021 at 3.00 a resolution 0.8971 24 164
6zg5-assembly1.cif.gz_C copii on membranes, outer coat right-handed rod, class1 0.8943 251 294
4bzj-assembly1.cif.gz_C the structure of the copii coat assembled on membranes 0.8943 251 294
1eje-assembly1.cif.gz_A-2 crystal structure of an fmn-binding protein 0.8892 18 202
ID Description Score Start End Superfamily
af_Q2FUW0_12_215_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9036 18 204 2.30.110.10
1ejeA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8892 18 202 2.30.110.10
3bnkA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8789 21 195 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8777 24 163 2.30.110.10
3cb0C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8753 24 163 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A538TE11-F1-model_v4 Flavin reductase family protein 0.9522 39 204 GO:0010181
GO:0016646
AF-A0A1J4SCY0-F1-model_v4 Flavin reductase like domain-containing protein 0.9502 39 208 GO:0010181
GO:0016646
AF-N8Q226-F1-model_v4 Flavin reductase like domain-containing protein 0.9458 43 204 GO:0010181
GO:0016646
AF-A0A7Z9Y4Z3-F1-model_v4 Flavin reductase family protein 0.9453 52 203 GO:0010181
GO:0016646
AF-A0A5F0LRJ2-F1-model_v4 Flavin reductase family protein 0.9414 78 204 GO:0010181
GO:0016646

Feature Viewer

pLDDT pTM Quality
91 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map