metagRoot

F423838

General Info

Members	Datasets	Scaffolds	Average Seq Length
365	261	355	277

Family's Representative Sequence

Representative Sequence	3300049758\|Ga0501241_002202\|Ga0501241_002202_280_1158
Length	292
Sequence	MAGEAMMHFPGTTPAPSSSAMNIISSLLEQRTGQQIAANRAWRIETALKPLLREKGLASLDQLVTQLVATRTGDLGDQVVDALLNQETSFFRDAAVLDMIADATKAMQAEMGRKARIWSSGCSTGQEPLSLAMLFDERGMGDGTSAPEIVATDISPAALTRARAGHYSQFEIQRGLPVRRMMTWFDSNGGDWAAKPELLRRIQFRQHNLTADAPPPGKFDVVLCRNVLLYFSQDVRRDVFAILASAIRPGGLLVLGAGETVIGLTDRFRPCDQYRGFYRAVDAAPVKRAAFG

Samples

	Sample ID	Description	Type	Environment
1	2599185359	Sphingomonas sp. NFR04	Isolate	Rhizoplane
2	2643221622	Sphingomonas sp. Root241	Isolate	Unclassified
3	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
4	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
5	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
6	2928526807	Sphingomonas trueperi 1770	Isolate	Rhizosphere
7	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
8	2990265787	Sphingomonas sp. SORGH_AS802	Isolate	Aerial Root
9	2993693658	Sphingomonas sp. SORGH_AS438	Isolate	Aerial Root
10	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
11	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
12	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
13	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
14	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
17	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
18	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
19	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
20	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
21	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
22	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
23	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
24	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
25	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
26	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
27	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
28	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
29	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
30	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
33	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
34	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
35	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
36	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
37	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
38	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
39	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
40	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
41	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
42	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
43	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
44	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
45	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
46	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
47	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
48	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
49	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
64	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
65	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
70	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
71	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
77	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
80	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
84	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
85	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
86	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
87	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
88	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
90	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
92	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
94	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
97	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
100	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
142	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
143	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
144	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
145	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
146	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
147	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
148	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
149	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
151	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
152	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
153	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
154	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
155	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
156	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
157	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
158	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
159	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
160	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
161	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
162	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
163	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
164	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
165	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
166	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
167	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
168	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
169	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
170	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
171	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
172	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
173	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
174	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
175	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
176	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
177	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
178	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
179	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
180	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
181	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
182	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
183	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
184	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
185	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
186	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
187	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
188	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
189	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
190	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
191	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
192	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
193	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
194	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
195	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
196	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
197	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
198	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
199	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
200	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
201	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
202	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
203	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
204	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
205	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
206	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
207	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
208	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
209	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
210	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
211	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
212	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
213	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
214	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
215	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
216	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
217	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
218	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
219	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
220	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
221	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
222	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
223	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
228	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
229	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
230	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
231	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
232	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
233	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
234	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
235	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
236	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
237	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
238	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
239	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
241	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
242	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
243	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
244	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
245	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
246	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
247	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
248	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
249	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
250	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
251	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
252	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
253	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
254	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
255	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
256	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
257	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
258	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
259	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
260	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
261	8057101203	Sphingomonas lycopersici MMSM20	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.26
Metatranscriptomes	0
Isolates	2.74

Biome Distribution

Category	Percentage (%)
Aerial Root	0.55
Bulb	0
Endosphere	25.75
Nodule	0
Rhizoplane	2.74
Rhizosphere	61.92
Stem	0
Stem Tuber	0
Unclassified	9.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1001277	3300001915	Bacteria	7394
2	JGI24740J21852_10001164	3300001979	Bacteria	11886
3	JGI24739J22299_10013902	3300001989	Bacteria	2932
4	JGI24742J22300_10005648	3300002244	Bacteria	2057
5	JGI25150J39212_1000046	3300002774	Bacteria	78180
6	JGI25151J46595_10035201	3300003187	Bacteria	1905
7	JGI25165J46597_1000073	3300003214	Bacteria	192140
8	JGI25153J46596_10000016	3300003215	Bacteria	285917
9	JGI25153J46596_10000099	3300003215	Bacteria	100036
10	JGI25153J46596_10005125	3300003215	Bacteria	6909
11	Ga0055525_1000090	3300003759	Bacteria	141071
12	Ga0055542_1000037	3300003762	Bacteria	225640
13	Ga0055529_1000042	3300003763	Bacteria	225663
14	Ga0055529_1000109	3300003763	Bacteria	121019
15	Ga0055526_1010621	3300003771	Bacteria	4259
16	Ga0055537_1002075	3300003773	Bacteria	7055
17	Ga0055537_1003103	3300003773	Bacteria	5221
18	Ga0055524_1000654	3300003775	Bacteria	24493
19	Ga0055536_1020330	3300003781	Bacteria	2053
20	Ga0055528_1036250	3300003790	Bacteria	1181
21	Ga0055530_10000359	3300003791	Bacteria	41160
22	Ga0055530_10001600	3300003791	Bacteria	16226
23	Ga0055540_1005767	3300003792	Bacteria	5097
24	Ga0055531_10000028	3300003794	Bacteria	159590
25	Ga0055531_10008798	3300003794	Bacteria	5261
26	Ga0065165_1003202	3300005262	Bacteria	11936
27	Ga0065165_1004002	3300005262	Bacteria	9637
28	Ga0065165_1007901	3300005262	Bacteria	5102
29	Ga0065165_1024191	3300005262	Bacteria	2045
30	Ga0065165_1040133	3300005262	Bacteria	1398
31	Ga0070658_10000799	3300005327	Bacteria	26965
32	Ga0070658_10161453	3300005327	Bacteria	1880
33	Ga0070683_100291769	3300005329	Bacteria	1551
34	Ga0070670_100158559	3300005331	Bacteria	1961
35	Ga0070680_100000153	3300005336	Bacteria	42721
36	Ga0068868_100081180	3300005338	Bacteria	2599
37	Ga0070661_100018914	3300005344	Bacteria	4905
38	Ga0070668_100317806	3300005347	Bacteria	1310
39	Ga0070671_100188025	3300005355	Bacteria	1750
40	Ga0070674_100027097	3300005356	Bacteria	3752
41	Ga0070673_100047945	3300005364	Bacteria	3327
42	Ga0070659_100111724	3300005366	Bacteria	2206
43	Ga0070667_100102449	3300005367	Bacteria	2474
44	Ga0070663_100092354	3300005455	Bacteria	2244
45	Ga0070678_100003330	3300005456	Bacteria	8940
46	Ga0070662_100182183	3300005457	Bacteria	1656
47	Ga0070681_10000001	3300005458	Bacteria	946857
48	Ga0068867_100141905	3300005459	Bacteria	1879
49	Ga0070679_100000513	3300005530	Bacteria	32932
50	Ga0070679_100122380	3300005530	Bacteria	2586
51	Ga0070684_100109998	3300005535	Bacteria	2470
52	Ga0068853_100067886	3300005539	Bacteria	3099
53	Ga0068853_100124783	3300005539	Bacteria	2299
54	Ga0070672_100361812	3300005543	Bacteria	1238
55	Ga0070665_100000044	3300005548	Bacteria	276702
56	Ga0070665_100121957	3300005548	Bacteria	2608
57	Ga0068855_100174691	3300005563	Bacteria	2431
58	Ga0070664_100013370	3300005564	Bacteria	6686
59	Ga0068857_100082262	3300005577	Bacteria	2876
60	Ga0068854_100155851	3300005578	Bacteria	1765
61	Ga0068852_100080621	3300005616	Bacteria	2886
62	Ga0068859_100002419	3300005617	Bacteria	19011
63	Ga0068864_100007695	3300005618	Bacteria	8872
64	Ga0068861_100000075	3300005719	Bacteria	48233
65	Ga0068851_10013216	3300005834	Bacteria	3906
66	Ga0068858_100000713	3300005842	Bacteria	34726
67	Ga0068858_100002389	3300005842	Bacteria	18994
68	Ga0068862_100253180	3300005844	Bacteria	1606
69	Ga0081455_10001550	3300005937	Bacteria	28283
70	Ga0081539_10055550	3300005985	Bacteria	2202
71	Ga0075366_10173173	3300006195	Bacteria	1310
72	Ga0097621_100342825	3300006237	Bacteria	1327
73	Ga0075370_10046878	3300006353	Bacteria	2447
74	Ga0097620_100002419	3300006931	Bacteria	19011
75	Ga0105240_10120099	3300009093	Bacteria	3166
76	Ga0105243_10000189	3300009148	Bacteria	71593
77	Ga0105243_10231719	3300009148	Bacteria	1639
78	Ga0105241_10000643	3300009174	Bacteria	26178
79	Ga0105242_10317888	3300009176	Bacteria	1427
80	Ga0105248_10000001	3300009177	Bacteria	1881304
81	Ga0105248_10007521	3300009177	Bacteria	11955
82	Ga0105248_10010997	3300009177	Bacteria	9984
83	Ga0105237_10028003	3300009545	Bacteria	5742
84	Ga0105249_10590231	3300009553	Bacteria	1165
85	Ga0105239_10027675	3300010375	Bacteria	6237
86	Ga0157373_10087587	3300013100	Bacteria	2194
87	Ga0157371_10003266	3300013102	Bacteria	14874
88	Ga0157369_10081492	3300013105	Bacteria	3463
89	Ga0157378_10012429	3300013297	Bacteria	7456
90	Ga0157378_10395671	3300013297	Bacteria	1360
91	Ga0163162_10385485	3300013306	Bacteria	1535
92	Ga0157372_10015607	3300013307	Bacteria	8144
93	Ga0157379_10147455	3300014968	Bacteria	2122
94	Ga0213875_10000077	3300021388	Bacteria	116884
95	Ga0209563_100111	3300025230	Bacteria	141123
96	Ga0209437_105665	3300025233	Bacteria	2118
97	Ga0207425_1000020	3300025245	Bacteria	372623
98	Ga0209148_1000026	3300025254	Bacteria	629213
99	Ga0209129_1000438	3300025258	Bacteria	31036
100	Ga0209233_1000142	3300025261	Bacteria	192193
101	Ga0209565_1000008	3300025263	Bacteria	774179
102	Ga0209565_1000151	3300025263	Bacteria	93781
103	Ga0209455_1000005	3300025272	Bacteria	1416756
104	Ga0209673_1001996	3300025273	Bacteria	15785
105	Ga0209676_1048833	3300025292	Bacteria	1127
106	Ga0209025_1000366	3300025294	Bacteria	95707
107	Ga0209564_1001216	3300025295	Bacteria	29241
108	Ga0209564_1016309	3300025295	Bacteria	2966
109	Ga0209564_1021917	3300025295	Bacteria	2277
110	Ga0209758_1000004	3300025297	Bacteria	1375322
111	Ga0209758_1000035	3300025297	Bacteria	448190
112	Ga0209758_1009849	3300025297	Bacteria	5842
113	Ga0209758_1024108	3300025297	Bacteria	2723
114	Ga0209050_1000001	3300025298	Bacteria	3563507
115	Ga0209050_1000010	3300025298	Bacteria	980454
116	Ga0209050_1000585	3300025298	Bacteria	59049
117	Ga0209050_1006876	3300025298	Bacteria	6599
118	Ga0209050_1017897	3300025298	Bacteria	2792
119	Ga0209256_1000009	3300025299	Bacteria	922071
120	Ga0209256_1000010	3300025299	Bacteria	912110
121	Ga0207426_1017628	3300025302	Bacteria	2533
122	Ga0207426_1035140	3300025302	Bacteria	1602
123	Ga0209051_1000476	3300025303	Bacteria	51944
124	Ga0209257_1000009	3300025304	Bacteria	1205047
125	Ga0209257_1001491	3300025304	Bacteria	27480
126	Ga0209257_1004129	3300025304	Bacteria	11575
127	Ga0209257_1005674	3300025304	Bacteria	8604
128	Ga0209257_1016997	3300025304	Bacteria	2897
129	Ga0207656_10000730	3300025321	Bacteria	10760
130	Ga0207647_10011383	3300025904	Bacteria	6239
131	Ga0207705_10017429	3300025909	Bacteria	5143
132	Ga0207705_10162960	3300025909	Bacteria	1676
133	Ga0207654_10004460	3300025911	Bacteria	7066
134	Ga0207707_10000001	3300025912	Bacteria	1212482
135	Ga0207695_10014369	3300025913	Bacteria	9387
136	Ga0207671_10005578	3300025914	Bacteria	11556
137	Ga0207671_10007619	3300025914	Bacteria	9360
138	Ga0207660_10000128	3300025917	Bacteria	44898
139	Ga0207657_10009867	3300025919	Bacteria	9561
140	Ga0207649_10000939	3300025920	Bacteria	18212
141	Ga0207652_10001045	3300025921	Bacteria	25324
142	Ga0207694_10002251	3300025924	Bacteria	15814
143	Ga0207659_10267239	3300025926	Bacteria	1394
144	Ga0207644_10209044	3300025931	Bacteria	1542
145	Ga0207690_10006885	3300025932	Bacteria	6744
146	Ga0207709_10000360	3300025935	Bacteria	45984
147	Ga0207669_10000792	3300025937	Bacteria	13545
148	Ga0207669_10016705	3300025937	Bacteria	3738
149	Ga0207669_10059546	3300025937	Bacteria	2337
150	Ga0207711_10002119	3300025941	Bacteria	17927
151	Ga0207711_10081895	3300025941	Bacteria	2821
152	Ga0207689_10221667	3300025942	Bacteria	1563
153	Ga0207689_10481557	3300025942	Bacteria	1039
154	Ga0207679_10021766	3300025945	Bacteria	4354
155	Ga0207667_10000010	3300025949	Bacteria	477432
156	Ga0207667_10018427	3300025949	Bacteria	7828
157	Ga0207651_10069758	3300025960	Bacteria	2483
158	Ga0207712_10615234	3300025961	Bacteria	941
159	Ga0207668_10169511	3300025972	Bacteria	1711
160	Ga0207668_10406869	3300025972	Bacteria	1152
161	Ga0207640_10001400	3300025981	Bacteria	13014
162	Ga0207640_10136982	3300025981	Bacteria	1779
163	Ga0207658_10172053	3300025986	Bacteria	1785
164	Ga0207703_10000600	3300026035	Bacteria	36585
165	Ga0207703_10001814	3300026035	Bacteria	19035
166	Ga0207639_10005107	3300026041	Bacteria	8846
167	Ga0207639_10016659	3300026041	Bacteria	5204
168	Ga0207639_10400668	3300026041	Bacteria	1236
169	Ga0207678_10002841	3300026067	Bacteria	15703
170	Ga0207702_10005929	3300026078	Bacteria	10616
171	Ga0207676_10000698	3300026095	Bacteria	26476
172	Ga0207674_10018992	3300026116	Bacteria	7451
173	Ga0207674_10189952	3300026116	Bacteria	2004
174	Ga0207675_100000333	3300026118	Bacteria	45102
175	Ga0207683_10016963	3300026121	Bacteria	6199
176	Ga0207683_10453766	3300026121	Bacteria	1182
177	Ga0207698_10001109	3300026142	Bacteria	15686
178	Ga0207698_10339104	3300026142	Bacteria	1415
179	Ga0268266_10000002	3300028379	Bacteria	3059047
180	Ga0268265_10177808	3300028380	Bacteria	1825
181	Ga0268265_10473068	3300028380	Bacteria	1175
182	Ga0268264_10243222	3300028381	Bacteria	1668
183	Ga0307517_10041961	3300028786	Bacteria	4923
184	Ga0307517_10045115	3300028786	Bacteria	4641
185	Ga0307515_10289130	3300028794	Bacteria	1337
186	Ga0307513_10098597	3300031456	Bacteria	2953
187	Ga0307513_10247886	3300031456	Bacteria	1580
188	Ga0307509_10193428	3300031507	Bacteria	1882
189	Ga0307508_10020380	3300031616	Bacteria	6022
190	Ga0307412_10000305	3300031911	Bacteria	31093
191	Ga0307416_100525935	3300032002	Bacteria	1252
192	Ga0307510_10015108	3300033180	Bacteria	9127
193	Ga0373937_0730628	3300036401	Bacteria	937
194	Ga0436364_0024756	3300037853	Bacteria	185423
195	Ga0395901_0124584	3300038443	Bacteria	2708
196	Ga0436363_1136725	3300039450	Bacteria	3782
197	Ga0439436_0013068	3300041404	Bacteria	2514
198	Ga0439447_038884	3300041407	Bacteria	1167
199	Ga0439461_0008258	3300041410	Bacteria	1861
200	Ga0439466_0070475	3300041411	Bacteria	1114
201	Ga0439465_0000497	3300041413	Bacteria	11725
202	Ga0451793_1052378	3300041452	Bacteria	1795
203	Ga0439431_0000707	3300041997	Bacteria	7176
204	Ga0439431_0022867	3300041997	Bacteria	1509
205	Ga0439442_001271	3300042002	Bacteria	5021
206	Ga0439432_000594	3300042006	Bacteria	13644
207	Ga0439449_0019556	3300042007	Bacteria	2539
208	Ga0439457_004900	3300042014	Bacteria	3433
209	Ga0439462_0000054	3300042015	Bacteria	16624
210	Ga0439462_0013785	3300042015	Bacteria	2075
211	Ga0450920_028867	3300042122	Bacteria	1088
212	Ga0439446_0097010	3300042156	Bacteria	928
213	Ga0439434_0000186	3300042435	Bacteria	16956
214	Ga0439434_0006160	3300042435	Bacteria	3497
215	Ga0495617_070698	3300046452	Bacteria	1148
216	Ga0495627_054921	3300046453	Bacteria	1189
217	Ga0495592_0181603	3300046454	Bacteria	1433
218	Ga0495638_0000379	3300046460	Bacteria	55196
219	Ga0495638_0192612	3300046460	Bacteria	1156
220	Ga0495650_0000058	3300046471	Bacteria	302308
221	Ga0495664_0079792	3300046477	Bacteria	1961
222	Ga0495584_0267311	3300046491	Bacteria	869
223	Ga0495585_0008161	3300046492	Bacteria	6362
224	Ga0495585_0174175	3300046492	Bacteria	1109
225	Ga0495596_0030876	3300046500	Bacteria	2143
226	Ga0495596_0152349	3300046500	Bacteria	898
227	Ga0495607_0012069	3300046501	Bacteria	5718
228	Ga0495583_0001290	3300046506	Bacteria	26140
229	Ga0495583_0003723	3300046506	Bacteria	11340
230	Ga0495583_0008149	3300046506	Bacteria	6451
231	Ga0495583_0016791	3300046506	Bacteria	3915
232	Ga0495606_0006010	3300046507	Bacteria	11372
233	Ga0495606_0088941	3300046507	Bacteria	1903
234	Ga0495616_0036785	3300046513	Bacteria	2524
235	Ga0495631_0039150	3300046518	Bacteria	2105
236	Ga0495643_0004773	3300046522	Bacteria	9355
237	Ga0495643_0047527	3300046522	Bacteria	2323
238	Ga0495643_0055638	3300046522	Bacteria	2114
239	Ga0495648_0000069	3300046524	Bacteria	136934
240	Ga0495648_0036408	3300046524	Bacteria	3176
241	Ga0495663_0005440	3300046525	Bacteria	3531
242	Ga0495663_0058804	3300046525	Bacteria	1205
243	Ga0495666_0178993	3300046526	Bacteria	979
244	Ga0495654_0000348	3300046530	Bacteria	39921
245	Ga0495645_0031866	3300046543	Bacteria	3843
246	Ga0495633_0014877	3300046558	Bacteria	4048
247	Ga0495633_0030919	3300046558	Bacteria	2599
248	Ga0495668_0000258	3300046616	Bacteria	75022
249	Ga0495668_0004140	3300046616	Bacteria	10482
250	Ga0495668_0092484	3300046616	Bacteria	1657
251	Ga0495625_0000332	3300046660	Bacteria	71947
252	Ga0495625_0003580	3300046660	Bacteria	15310
253	Ga0495625_0003846	3300046660	Bacteria	14507
254	Ga0495625_0011984	3300046660	Bacteria	7037
255	Ga0495625_0212622	3300046660	Bacteria	1270
256	Ga0495661_0120368	3300046665	Bacteria	1451
257	Ga0495669_0001695	3300046684	Bacteria	9020
258	Ga0495670_0000066	3300046691	Bacteria	46500
259	Ga0495670_0115026	3300046691	Bacteria	1394
260	Ga0495649_0058698	3300046694	Bacteria	2073
261	Ga0495649_0069009	3300046694	Bacteria	1896
262	Ga0495600_0006966	3300046809	Bacteria	6897
263	Ga0495660_0015067	3300046810	Bacteria	4470
264	Ga0495683_0012870	3300047323	Bacteria	4386
265	Ga0495687_000045	3300047443	Bacteria	211968
266	Ga0495687_001633	3300047443	Bacteria	20197
267	Ga0495675_0118121	3300047444	Bacteria	1652
268	Ga0495677_0004793	3300047445	Bacteria	5157
269	Ga0495677_0129387	3300047445	Bacteria	966
270	Ga0495681_0010306	3300047470	Bacteria	5662
271	Ga0495681_0024810	3300047470	Bacteria	3147
272	Ga0495686_0000705	3300047472	Bacteria	44993
273	Ga0495686_0024137	3300047472	Bacteria	3999
274	Ga0496102_0000281	3300048905	Bacteria	64939
275	Ga0496102_0114267	3300048905	Bacteria	2519
276	Ga0496103_0000207	3300048906	Bacteria	58942
277	Ga0496103_0183737	3300048906	Bacteria	1344
278	Ga0496105_0050194	3300048908	Bacteria	3446
279	Ga0496114_0033343	3300048917	Bacteria	4243
280	Ga0496115_0000444	3300048918	Bacteria	33537
281	Ga0496115_0000545	3300048918	Bacteria	29339
282	Ga0496116_0036850	3300048919	Bacteria	3418
283	Ga0496117_0000114	3300048920	Bacteria	180658
284	Ga0496118_0000082	3300048921	Bacteria	185820
285	Ga0496118_0191900	3300048921	Bacteria	1221
286	Ga0496119_0027672	3300048922	Bacteria	3890
287	Ga0496120_0028460	3300048923	Bacteria	3424
288	Ga0496120_0028461	3300048923	Bacteria	3424
289	Ga0496121_0000529	3300048924	Bacteria	72533
290	Ga0496121_0000655	3300048924	Bacteria	64922
291	Ga0496122_0014259	3300048925	Bacteria	7698
292	Ga0496122_0121475	3300048925	Bacteria	1683
293	Ga0496123_0056672	3300048926	Bacteria	2558
294	Ga0496124_0000068	3300048927	Bacteria	221819
295	Ga0496124_0000328	3300048927	Bacteria	87848
296	Ga0496124_0041522	3300048927	Bacteria	3968
297	Ga0496124_0046283	3300048927	Bacteria	3727
298	Ga0496125_0001621	3300048928	Bacteria	31696
299	Ga0496126_0000634	3300048929	Bacteria	65566
300	Ga0496126_0013167	3300048929	Bacteria	8436
301	Ga0501290_000591	3300049513	Bacteria	5465
302	Ga0501292_000090	3300049515	Bacteria	16575
303	Ga0501294_000090	3300049517	Bacteria	10033
304	Ga0501300_003737	3300049523	Bacteria	2269
305	Ga0501034_0067082	3300049571	Bacteria	3602
306	Ga0501047_0016547	3300049581	Bacteria	7040
307	Ga0501047_0019438	3300049581	Bacteria	6517
308	Ga0501047_0270987	3300049581	Bacteria	1544
309	Ga0501072_0020351	3300049588	Bacteria	5140
310	Ga0501073_0076709	3300049589	Bacteria	2325
311	Ga0501223_000334	3300049663	Bacteria	11662
312	Ga0501224_000170	3300049664	Bacteria	7295
313	Ga0501235_000304	3300049669	Bacteria	9307
314	Ga0501259_000459	3300049688	Bacteria	6490
315	Ga0501261_000078	3300049690	Bacteria	16504
316	Ga0501221_006770	3300049704	Bacteria	1947
317	Ga0501245_000619	3300049708	Bacteria	4378
318	Ga0501241_002202	3300049758	Bacteria	3812
319	Ga0501279_000103	3300049775	Bacteria	13196
320	Ga0501281_00459	3300049777	Bacteria	3900
321	Ga0501282_001374	3300049778	Bacteria	2705
322	Ga0501283_011351	3300049779	Bacteria	1324
323	Ga0501044_0654901	3300049823	Bacteria	939
324	nmdc:mga0k408_245448_c1	3300050493	Bacteria	1069
325	nmdc:mga07m45_123207_c1	3300050496	Bacteria	1498
326	Ga0500610_0000053	3300053079	Bacteria	36671
327	Ga0500643_005936	3300053087	Bacteria	5180
328	Ga0500643_008316	3300053087	Bacteria	4085
329	Ga0500647_0062702	3300053091	Bacteria	1789
330	Ga0500566_0000560	3300053094	Bacteria	20897
331	Ga0500641_0067524	3300053096	Bacteria	1499
332	Ga0500556_0036210	3300053104	Bacteria	1710
333	Ga0500595_000376	3300053119	Bacteria	28751
334	Ga0500595_001206	3300053119	Bacteria	14279
335	Ga0500595_060263	3300053119	Bacteria	1149
336	Ga0500607_027424	3300053121	Bacteria	3160
337	Ga0500658_0003498	3300053134	Bacteria	5927
338	Ga0500658_0014974	3300053134	Bacteria	2874
339	Ga0500559_0004323	3300053136	Bacteria	6774
340	Ga0500559_0014807	3300053136	Bacteria	3295
341	Ga0500559_0037284	3300053136	Bacteria	2107
342	Ga0500559_0051368	3300053136	Bacteria	1821
343	Ga0500568_0021659	3300053139	Bacteria	2762
344	Ga0500568_0053636	3300053139	Bacteria	1580
345	Ga0500568_0124560	3300053139	Bacteria	959
346	Ga0500573_0000034	3300053140	Bacteria	113547
347	Ga0500624_000078	3300053157	Bacteria	51436
348	Ga0500627_0000941	3300053158	Bacteria	7855
349	Ga0500636_0002828	3300053177	Bacteria	9695
350	Ga0500637_0000050	3300053178	Bacteria	43067
351	Ga0500645_000008	3300053730	Bacteria	212254
352	Ga0500645_001470	3300053730	Bacteria	11841
353	Ga0500645_068867	3300053730	Bacteria	1017
354	Ga0500596_000106	3300053735	Bacteria	11596
355	Ga0500601_003920	3300053737	Bacteria	1618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046453	Ga0495627_054921	Ga0495627_054921_13_726	226
2	3300046526	Ga0495666_0178993	Ga0495666_0178993_239_961	230
3	3300046500	Ga0495596_0152349	Ga0495596_0152349_179_877	232
4	3300049823	Ga0501044_0654901	Ga0501044_0654901_16_744	232
5	3300026142	Ga0207698_10339104	Ga0207698_103391042	234
6	3300005262	Ga0065165_1024191	Ga0065165_10241912	240
7	3300053139	Ga0500568_0021659	Ga0500568_0021659_1871_2725	240
8	3300037853	Ga0436364_0024756	Ga0436364_0024756_108056_108871	256
9	iso_pu_bacteria	8057101203	8057103345	257
10	3300048921	Ga0496118_0191900	Ga0496118_0191900_397_1203	260
11	3300005844	Ga0068862_100253180	Ga0068862_1002531802	261
12	3300009553	Ga0105249_10590231	Ga0105249_105902312	261
13	3300025942	Ga0207689_10481557	Ga0207689_104815572	261
14	3300025961	Ga0207712_10615234	Ga0207712_106152342	261
15	3300028380	Ga0268265_10177808	Ga0268265_101778083	261
16	3300028380	Ga0268265_10473068	Ga0268265_104730682	261
17	3300028381	Ga0268264_10243222	Ga0268264_102432221	261
18	3300032002	Ga0307416_100525935	Ga0307416_1005259352	261
19	3300053157	Ga0500624_000078	Ga0500624_000078_8954_9766	261
20	3300053178	Ga0500637_0000050	Ga0500637_0000050_7166_7978	261
21	3300009176	Ga0105242_10317888	Ga0105242_103178882	262
22	3300041407	Ga0439447_038884	Ga0439447_038884_306_1124	262
23	3300041410	Ga0439461_0008258	Ga0439461_0008258_711_1529	262
24	3300041411	Ga0439466_0070475	Ga0439466_0070475_127_945	262
25	3300041997	Ga0439431_0022867	Ga0439431_0022867_359_1177	262
26	3300042014	Ga0439457_004900	Ga0439457_004900_2040_2858	262
27	3300042015	Ga0439462_0013785	Ga0439462_0013785_355_1173	262
28	3300042122	Ga0450920_028867	Ga0450920_028867_199_1017	262
29	3300042156	Ga0439446_0097010	Ga0439446_0097010_87_905	262
30	3300042435	Ga0439434_0006160	Ga0439434_0006160_583_1401	262
31	3300047470	Ga0495681_0024810	Ga0495681_0024810_2310_3131	262
32	3300048924	Ga0496121_0000529	Ga0496121_0000529_46145_46996	262
33	3300053104	Ga0500556_0036210	Ga0500556_0036210_138_1001	262
34	3300053139	Ga0500568_0053636	Ga0500568_0053636_488_1309	262
35	3300053139	Ga0500568_0124560	Ga0500568_0124560_118_939	262
36	3300053730	Ga0500645_001470	Ga0500645_001470_5149_6012	262
37	3300046454	Ga0495592_0181603	Ga0495592_0181603_224_1057	263
38	3300046477	Ga0495664_0079792	Ga0495664_0079792_321_1154	263
39	3300046543	Ga0495645_0031866	Ga0495645_0031866_772_1605	263
40	3300047444	Ga0495675_0118121	Ga0495675_0118121_42_875	263
41	3300053096	Ga0500641_0067524	Ga0500641_0067524_241_1071	263
42	3300005336	Ga0070680_100000153	Ga0070680_10000015320	264
43	3300005458	Ga0070681_10000001	Ga0070681_10000001854	264
44	3300005530	Ga0070679_100000513	Ga0070679_10000051335	264
45	3300009177	Ga0105248_10000001	Ga0105248_10000001477	264
46	3300010375	Ga0105239_10027675	Ga0105239_100276752	264
47	3300025912	Ga0207707_10000001	Ga0207707_10000001533	264
48	3300025917	Ga0207660_10000128	Ga0207660_1000012826	264
49	3300025921	Ga0207652_10001045	Ga0207652_1000104530	264
50	3300046501	Ga0495607_0012069	Ga0495607_0012069_403_1245	264
51	3300049571	Ga0501034_0067082	Ga0501034_0067082_2649_3482	264
52	3300049581	Ga0501047_0016547	Ga0501047_0016547_4691_5524	264
53	3300049581	Ga0501047_0019438	Ga0501047_0019438_3794_4630	264
54	3300049588	Ga0501072_0020351	Ga0501072_0020351_147_980	264
55	3300049589	Ga0501073_0076709	Ga0501073_0076709_212_1045	264
56	3300005985	Ga0081539_10055550	Ga0081539_100555502	265
57	3300039450	Ga0436363_1136725	Ga0436363_1136725_1232_2080	265
58	3300049523	Ga0501300_003737	Ga0501300_003737_376_1209	265
59	3300005543	Ga0070672_100361812	Ga0070672_1003618121	266
60	3300005937	Ga0081455_10001550	Ga0081455_1000155024	266
61	3300013297	Ga0157378_10012429	Ga0157378_100124296	266
62	3300046525	Ga0495663_0058804	Ga0495663_0058804_281_1120	266
63	3300046530	Ga0495654_0000348	Ga0495654_0000348_22854_23693	266
64	3300046616	Ga0495668_0004140	Ga0495668_0004140_3095_3934	266
65	3300049513	Ga0501290_000591	Ga0501290_000591_3086_3925	266
66	3300049515	Ga0501292_000090	Ga0501292_000090_5365_6204	266
67	3300049517	Ga0501294_000090	Ga0501294_000090_5354_6193	266
68	3300049663	Ga0501223_000334	Ga0501223_000334_7006_7845	266
69	3300049664	Ga0501224_000170	Ga0501224_000170_6441_7280	266
70	3300049669	Ga0501235_000304	Ga0501235_000304_5395_6234	266
71	3300049688	Ga0501259_000459	Ga0501259_000459_1304_2143	266
72	3300049690	Ga0501261_000078	Ga0501261_000078_5386_6225	266
73	3300049704	Ga0501221_006770	Ga0501221_006770_656_1495	266
74	3300049708	Ga0501245_000619	Ga0501245_000619_962_1801	266
75	3300049775	Ga0501279_000103	Ga0501279_000103_5389_6228	266
76	3300049777	Ga0501281_00459	Ga0501281_00459_278_1117	266
77	3300049778	Ga0501282_001374	Ga0501282_001374_929_1768	266
78	3300049779	Ga0501283_011351	Ga0501283_011351_354_1193	266
79	3300053136	Ga0500559_0037284	Ga0500559_0037284_821_1675	266
80	3300053158	Ga0500627_0000941	Ga0500627_0000941_2023_2862	266
81	3300046524	Ga0495648_0036408	Ga0495648_0036408_844_1686	267
82	iso_pu_bacteria	2879163058	2879166462	267
83	3300021388	Ga0213875_10000077	Ga0213875_1000007771	268
84	3300053140	Ga0500573_0000034	Ga0500573_0000034_48156_48995	268
85	iso_pu_bacteria	2599185359	2600227811	268
86	iso_pu_bacteria	2818991466	2819714244	268
87	iso_pu_bacteria	2885429604	2885431284	268
88	iso_pu_bacteria	2928526807	2928530461	268
89	iso_pu_bacteria	2928968154	2928968256	268
90	3300002774	JGI25150J39212_1000046	JGI25150J39212_100004656	269
91	3300003187	JGI25151J46595_10035201	JGI25151J46595_100352012	269
92	3300003215	JGI25153J46596_10000099	JGI25153J46596_1000009971	269
93	3300003771	Ga0055526_1010621	Ga0055526_10106213	269
94	3300003773	Ga0055537_1003103	Ga0055537_10031036	269
95	3300003781	Ga0055536_1020330	Ga0055536_10203302	269
96	3300003792	Ga0055540_1005767	Ga0055540_10057673	269
97	3300025245	Ga0207425_1000020	Ga0207425_1000020294	269
98	3300025258	Ga0209129_1000438	Ga0209129_100043823	269
99	3300025263	Ga0209565_1000151	Ga0209565_100015114	269
100	3300025292	Ga0209676_1048833	Ga0209676_10488332	269
101	3300025294	Ga0209025_1000366	Ga0209025_100036685	269
102	3300025295	Ga0209564_1001216	Ga0209564_100121630	269
103	3300025295	Ga0209564_1016309	Ga0209564_10163092	269
104	3300025297	Ga0209758_1000004	Ga0209758_1000004558	269
105	3300025297	Ga0209758_1024108	Ga0209758_10241082	269
106	3300025298	Ga0209050_1000001	Ga0209050_10000012519	269
107	3300025298	Ga0209050_1000585	Ga0209050_100058553	269
108	3300025298	Ga0209050_1017897	Ga0209050_10178972	269
109	3300025302	Ga0207426_1017628	Ga0207426_10176283	269
110	3300025303	Ga0209051_1000476	Ga0209051_10004762	269
111	3300025304	Ga0209257_1004129	Ga0209257_100412914	269
112	3300025304	Ga0209257_1016997	Ga0209257_10169972	269
113	3300047472	Ga0495686_0024137	Ga0495686_0024137_2363_3214	269
114	3300048905	Ga0496102_0114267	Ga0496102_0114267_265_1116	269
115	3300048906	Ga0496103_0183737	Ga0496103_0183737_388_1239	269
116	3300048918	Ga0496115_0000444	Ga0496115_0000444_11624_12472	269
117	iso_pu_bacteria	2643221622	2644128848	269
118	3300003214	JGI25165J46597_1000073	JGI25165J46597_10000738	270
119	3300003215	JGI25153J46596_10005125	JGI25153J46596_100051256	270
120	3300003773	Ga0055537_1002075	Ga0055537_100207512	270
121	3300003775	Ga0055524_1000654	Ga0055524_100065431	270
122	3300003790	Ga0055528_1036250	Ga0055528_10362502	270
123	3300003791	Ga0055530_10000359	Ga0055530_1000035910	270
124	3300003791	Ga0055530_10001600	Ga0055530_100016003	270
125	3300003794	Ga0055531_10000028	Ga0055531_10000028145	270
126	3300003794	Ga0055531_10008798	Ga0055531_100087985	270
127	3300005262	Ga0065165_1007901	Ga0065165_10079016	270
128	3300005347	Ga0070668_100317806	Ga0070668_1003178062	270
129	3300005530	Ga0070679_100122380	Ga0070679_1001223803	270
130	3300005577	Ga0068857_100082262	Ga0068857_1000822622	270
131	3300005578	Ga0068854_100155851	Ga0068854_1001558512	270
132	3300005617	Ga0068859_100002419	Ga0068859_1000024195	270
133	3300005719	Ga0068861_100000075	Ga0068861_10000007519	270
134	3300005842	Ga0068858_100002389	Ga0068858_1000023899	270
135	3300006353	Ga0075370_10046878	Ga0075370_100468783	270
136	3300006931	Ga0097620_100002419	Ga0097620_10000241912	270
137	3300009148	Ga0105243_10231719	Ga0105243_102317193	270
138	3300009177	Ga0105248_10010997	Ga0105248_100109979	270
139	3300014968	Ga0157379_10147455	Ga0157379_101474553	270
140	3300025233	Ga0209437_105665	Ga0209437_1056652	270
141	3300025261	Ga0209233_1000142	Ga0209233_1000142173	270
142	3300025263	Ga0209565_1000008	Ga0209565_1000008230	270
143	3300025273	Ga0209673_1001996	Ga0209673_100199612	270
144	3300025295	Ga0209564_1021917	Ga0209564_10219172	270
145	3300025297	Ga0209758_1009849	Ga0209758_10098497	270
146	3300025298	Ga0209050_1000010	Ga0209050_1000010349	270
147	3300025298	Ga0209050_1006876	Ga0209050_10068763	270
148	3300025299	Ga0209256_1000009	Ga0209256_1000009640	270
149	3300025299	Ga0209256_1000010	Ga0209256_1000010564	270
150	3300025302	Ga0207426_1035140	Ga0207426_10351402	270
151	3300025304	Ga0209257_1000009	Ga0209257_1000009765	270
152	3300025304	Ga0209257_1001491	Ga0209257_10014915	270
153	3300025914	Ga0207671_10007619	Ga0207671_1000761910	270
154	3300025941	Ga0207711_10002119	Ga0207711_100021199	270
155	3300025972	Ga0207668_10169511	Ga0207668_101695112	270
156	3300025981	Ga0207640_10136982	Ga0207640_101369822	270
157	3300026035	Ga0207703_10001814	Ga0207703_1000181415	270
158	3300026041	Ga0207639_10400668	Ga0207639_104006681	270
159	3300026116	Ga0207674_10189952	Ga0207674_101899522	270
160	3300026118	Ga0207675_100000333	Ga0207675_10000033319	270
161	3300031507	Ga0307509_10193428	Ga0307509_101934282	270
162	3300031616	Ga0307508_10020380	Ga0307508_100203805	270
163	3300031911	Ga0307412_10000305	Ga0307412_1000030515	270
164	3300041452	Ga0451793_1052378	Ga0451793_1052378_146_1000	270
165	3300046460	Ga0495638_0000379	Ga0495638_0000379_8788_9642	270
166	3300046492	Ga0495585_0174175	Ga0495585_0174175_11_868	270
167	3300046660	Ga0495625_0000332	Ga0495625_0000332_26681_27535	270
168	3300046691	Ga0495670_0115026	Ga0495670_0115026_444_1292	270
169	3300048923	Ga0496120_0028460	Ga0496120_0028460_2291_3142	270
170	3300048925	Ga0496122_0121475	Ga0496122_0121475_407_1258	270
171	3300048926	Ga0496123_0056672	Ga0496123_0056672_1209_2060	270
172	3300048927	Ga0496124_0000328	Ga0496124_0000328_11686_12537	270
173	3300048927	Ga0496124_0041522	Ga0496124_0041522_1517_2368	270
174	3300048927	Ga0496124_0046283	Ga0496124_0046283_1607_2458	270
175	3300048929	Ga0496126_0013167	Ga0496126_0013167_1432_2283	270
176	3300050496	nmdc:mga07m45_123207_c1	nmdc:mga07m45_123207_c1_262_1122	270
177	3300053119	Ga0500595_060263	Ga0500595_060263_241_1098	270
178	3300053134	Ga0500658_0003498	Ga0500658_0003498_4577_5434	270
179	3300053136	Ga0500559_0004323	Ga0500559_0004323_503_1357	270
180	3300053136	Ga0500559_0051368	Ga0500559_0051368_914_1771	270
181	3300053737	Ga0500601_003920	Ga0500601_003920_118_975	270
182	iso_pu_bacteria	2990265787	2990266406	270
183	iso_pu_bacteria	2993693658	2993695801	270
184	3300005262	Ga0065165_1003202	Ga0065165_10032022	271
185	3300005262	Ga0065165_1004002	Ga0065165_100400211	271
186	3300005539	Ga0068853_100067886	Ga0068853_1000678862	271
187	3300005618	Ga0068864_100007695	Ga0068864_1000076958	271
188	3300005842	Ga0068858_100000713	Ga0068858_10000071326	271
189	3300009177	Ga0105248_10007521	Ga0105248_100075216	271
190	3300013306	Ga0163162_10385485	Ga0163162_103854852	271
191	3300025937	Ga0207669_10059546	Ga0207669_100595462	271
192	3300025941	Ga0207711_10081895	Ga0207711_100818953	271
193	3300026035	Ga0207703_10000600	Ga0207703_1000060023	271
194	3300026041	Ga0207639_10016659	Ga0207639_100166596	271
195	3300026095	Ga0207676_10000698	Ga0207676_100006988	271
196	3300028786	Ga0307517_10041961	Ga0307517_100419613	271
197	3300031456	Ga0307513_10247886	Ga0307513_102478862	271
198	3300033180	Ga0307510_10015108	Ga0307510_100151082	271
199	3300041404	Ga0439436_0013068	Ga0439436_0013068_607_1473	271
200	3300041413	Ga0439465_0000497	Ga0439465_0000497_2197_3063	271
201	3300041997	Ga0439431_0000707	Ga0439431_0000707_1874_2740	271
202	3300042002	Ga0439442_001271	Ga0439442_001271_2301_3167	271
203	3300042006	Ga0439432_000594	Ga0439432_000594_11666_12532	271
204	3300042007	Ga0439449_0019556	Ga0439449_0019556_1529_2395	271
205	3300042015	Ga0439462_0000054	Ga0439462_0000054_5729_6595	271
206	3300042435	Ga0439434_0000186	Ga0439434_0000186_5122_5988	271
207	3300046460	Ga0495638_0192612	Ga0495638_0192612_25_879	271
208	3300046506	Ga0495583_0016791	Ga0495583_0016791_1031_1885	271
209	3300046616	Ga0495668_0092484	Ga0495668_0092484_346_1200	271
210	3300046660	Ga0495625_0011984	Ga0495625_0011984_1765_2619	271
211	3300049758	Ga0501241_002202	Ga0501241_002202_280_1158	271
212	3300053087	Ga0500643_005936	Ga0500643_005936_786_1640	271
213	3300053087	Ga0500643_008316	Ga0500643_008316_299_1165	271
214	3300053094	Ga0500566_0000560	Ga0500566_0000560_3727_4593	271
215	3300053119	Ga0500595_001206	Ga0500595_001206_3311_4177	271
216	3300053134	Ga0500658_0014974	Ga0500658_0014974_1216_2082	271
217	3300053136	Ga0500559_0014807	Ga0500559_0014807_238_1092	271
218	3300053730	Ga0500645_068867	Ga0500645_068867_129_995	271
219	3300001915	JGI24741J21665_1001277	JGI24741J21665_10012776	272
220	3300001979	JGI24740J21852_10001164	JGI24740J21852_100011645	272
221	3300001989	JGI24739J22299_10013902	JGI24739J22299_100139022	272
222	3300002244	JGI24742J22300_10005648	JGI24742J22300_100056482	272
223	3300003215	JGI25153J46596_10000016	JGI25153J46596_10000016244	272
224	3300003759	Ga0055525_1000090	Ga0055525_100009069	272
225	3300003762	Ga0055542_1000037	Ga0055542_100003736	272
226	3300003763	Ga0055529_1000042	Ga0055529_100004236	272
227	3300003763	Ga0055529_1000109	Ga0055529_1000109106	272
228	3300005262	Ga0065165_1040133	Ga0065165_10401332	272
229	3300005327	Ga0070658_10000799	Ga0070658_1000079922	272
230	3300005327	Ga0070658_10161453	Ga0070658_101614532	272
231	3300005329	Ga0070683_100291769	Ga0070683_1002917692	272
232	3300005331	Ga0070670_100158559	Ga0070670_1001585592	272
233	3300005338	Ga0068868_100081180	Ga0068868_1000811802	272
234	3300005344	Ga0070661_100018914	Ga0070661_1000189145	272
235	3300005355	Ga0070671_100188025	Ga0070671_1001880252	272
236	3300005356	Ga0070674_100027097	Ga0070674_1000270973	272
237	3300005364	Ga0070673_100047945	Ga0070673_1000479453	272
238	3300005366	Ga0070659_100111724	Ga0070659_1001117242	272
239	3300005367	Ga0070667_100102449	Ga0070667_1001024493	272
240	3300005455	Ga0070663_100092354	Ga0070663_1000923542	272
241	3300005456	Ga0070678_100003330	Ga0070678_1000033305	272
242	3300005457	Ga0070662_100182183	Ga0070662_1001821832	272
243	3300005459	Ga0068867_100141905	Ga0068867_1001419052	272
244	3300005535	Ga0070684_100109998	Ga0070684_1001099982	272
245	3300005539	Ga0068853_100124783	Ga0068853_1001247832	272
246	3300005548	Ga0070665_100000044	Ga0070665_10000004456	272
247	3300005548	Ga0070665_100121957	Ga0070665_1001219573	272
248	3300005563	Ga0068855_100174691	Ga0068855_1001746913	272
249	3300005564	Ga0070664_100013370	Ga0070664_1000133703	272
250	3300005616	Ga0068852_100080621	Ga0068852_1000806212	272
251	3300005834	Ga0068851_10013216	Ga0068851_100132165	272
252	3300006195	Ga0075366_10173173	Ga0075366_101731732	272
253	3300006237	Ga0097621_100342825	Ga0097621_1003428252	272
254	3300009093	Ga0105240_10120099	Ga0105240_101200992	272
255	3300009148	Ga0105243_10000189	Ga0105243_1000018959	272
256	3300009174	Ga0105241_10000643	Ga0105241_1000064314	272
257	3300009545	Ga0105237_10028003	Ga0105237_100280032	272
258	3300013100	Ga0157373_10087587	Ga0157373_100875873	272
259	3300013102	Ga0157371_10003266	Ga0157371_100032669	272
260	3300013105	Ga0157369_10081492	Ga0157369_100814923	272
261	3300013297	Ga0157378_10395671	Ga0157378_103956712	272
262	3300013307	Ga0157372_10015607	Ga0157372_100156076	272
263	3300025230	Ga0209563_100111	Ga0209563_10011188	272
264	3300025254	Ga0209148_1000026	Ga0209148_1000026420	272
265	3300025272	Ga0209455_1000005	Ga0209455_10000051167	272
266	3300025297	Ga0209758_1000035	Ga0209758_1000035314	272
267	3300025304	Ga0209257_1005674	Ga0209257_100567416	272
268	3300025321	Ga0207656_10000730	Ga0207656_100007308	272
269	3300025904	Ga0207647_10011383	Ga0207647_100113837	272
270	3300025909	Ga0207705_10017429	Ga0207705_100174293	272
271	3300025909	Ga0207705_10162960	Ga0207705_101629602	272
272	3300025911	Ga0207654_10004460	Ga0207654_100044605	272
273	3300025913	Ga0207695_10014369	Ga0207695_100143698	272
274	3300025914	Ga0207671_10005578	Ga0207671_100055785	272
275	3300025919	Ga0207657_10009867	Ga0207657_100098675	272
276	3300025920	Ga0207649_10000939	Ga0207649_1000093912	272
277	3300025924	Ga0207694_10002251	Ga0207694_100022518	272
278	3300025926	Ga0207659_10267239	Ga0207659_102672392	272
279	3300025931	Ga0207644_10209044	Ga0207644_102090442	272
280	3300025932	Ga0207690_10006885	Ga0207690_100068852	272
281	3300025935	Ga0207709_10000360	Ga0207709_1000036050	272
282	3300025937	Ga0207669_10000792	Ga0207669_100007923	272
283	3300025937	Ga0207669_10016705	Ga0207669_100167053	272
284	3300025942	Ga0207689_10221667	Ga0207689_102216671	272
285	3300025945	Ga0207679_10021766	Ga0207679_100217664	272
286	3300025949	Ga0207667_10000010	Ga0207667_10000010424	272
287	3300025949	Ga0207667_10018427	Ga0207667_100184275	272
288	3300025960	Ga0207651_10069758	Ga0207651_100697583	272
289	3300025972	Ga0207668_10406869	Ga0207668_104068691	272
290	3300025981	Ga0207640_10001400	Ga0207640_100014008	272
291	3300025986	Ga0207658_10172053	Ga0207658_101720532	272
292	3300026041	Ga0207639_10005107	Ga0207639_100051074	272
293	3300026067	Ga0207678_10002841	Ga0207678_1000284115	272
294	3300026078	Ga0207702_10005929	Ga0207702_100059294	272
295	3300026116	Ga0207674_10018992	Ga0207674_100189925	272
296	3300026121	Ga0207683_10016963	Ga0207683_100169633	272
297	3300026121	Ga0207683_10453766	Ga0207683_104537662	272
298	3300026142	Ga0207698_10001109	Ga0207698_100011098	272
299	3300028379	Ga0268266_10000002	Ga0268266_100000021947	272
300	3300028786	Ga0307517_10045115	Ga0307517_100451153	272
301	3300028794	Ga0307515_10289130	Ga0307515_102891301	272
302	3300031456	Ga0307513_10098597	Ga0307513_100985973	272
303	3300036401	Ga0373937_0730628	Ga0373937_0730628_11_877	272
304	3300038443	Ga0395901_0124584	Ga0395901_0124584_1465_2283	272
305	3300046452	Ga0495617_070698	Ga0495617_070698_274_1092	272
306	3300046471	Ga0495650_0000058	Ga0495650_0000058_280011_280829	272
307	3300046491	Ga0495584_0267311	Ga0495584_0267311_29_847	272
308	3300046492	Ga0495585_0008161	Ga0495585_0008161_1599_2417	272
309	3300046500	Ga0495596_0030876	Ga0495596_0030876_743_1561	272
310	3300046506	Ga0495583_0001290	Ga0495583_0001290_5414_6232	272
311	3300046506	Ga0495583_0003723	Ga0495583_0003723_6753_7571	272
312	3300046506	Ga0495583_0008149	Ga0495583_0008149_2795_3613	272
313	3300046507	Ga0495606_0006010	Ga0495606_0006010_8875_9693	272
314	3300046507	Ga0495606_0088941	Ga0495606_0088941_103_921	272
315	3300046513	Ga0495616_0036785	Ga0495616_0036785_707_1525	272
316	3300046518	Ga0495631_0039150	Ga0495631_0039150_828_1646	272
317	3300046522	Ga0495643_0004773	Ga0495643_0004773_6861_7679	272
318	3300046522	Ga0495643_0047527	Ga0495643_0047527_1362_2180	272
319	3300046522	Ga0495643_0055638	Ga0495643_0055638_144_962	272
320	3300046524	Ga0495648_0000069	Ga0495648_0000069_100558_101376	272
321	3300046525	Ga0495663_0005440	Ga0495663_0005440_571_1389	272
322	3300046558	Ga0495633_0014877	Ga0495633_0014877_1440_2258	272
323	3300046558	Ga0495633_0030919	Ga0495633_0030919_153_971	272
324	3300046616	Ga0495668_0000258	Ga0495668_0000258_51136_51954	272
325	3300046660	Ga0495625_0003580	Ga0495625_0003580_12821_13639	272
326	3300046660	Ga0495625_0003846	Ga0495625_0003846_2259_3077	272
327	3300046660	Ga0495625_0212622	Ga0495625_0212622_376_1194	272
328	3300046665	Ga0495661_0120368	Ga0495661_0120368_393_1211	272
329	3300046684	Ga0495669_0001695	Ga0495669_0001695_1402_2220	272
330	3300046691	Ga0495670_0000066	Ga0495670_0000066_35501_36370	272
331	3300046694	Ga0495649_0058698	Ga0495649_0058698_500_1318	272
332	3300046694	Ga0495649_0069009	Ga0495649_0069009_61_879	272
333	3300046809	Ga0495600_0006966	Ga0495600_0006966_2220_3038	272
334	3300046810	Ga0495660_0015067	Ga0495660_0015067_3306_4124	272
335	3300047323	Ga0495683_0012870	Ga0495683_0012870_1637_2455	272
336	3300047443	Ga0495687_000045	Ga0495687_000045_1701_2519	272
337	3300047443	Ga0495687_001633	Ga0495687_001633_1255_2073	272
338	3300047445	Ga0495677_0004793	Ga0495677_0004793_3630_4448	272
339	3300047445	Ga0495677_0129387	Ga0495677_0129387_106_924	272
340	3300047470	Ga0495681_0010306	Ga0495681_0010306_2839_3657	272
341	3300047472	Ga0495686_0000705	Ga0495686_0000705_2313_3164	272
342	3300048905	Ga0496102_0000281	Ga0496102_0000281_57298_58116	272
343	3300048906	Ga0496103_0000207	Ga0496103_0000207_23906_24724	272
344	3300048908	Ga0496105_0050194	Ga0496105_0050194_1220_2038	272
345	3300048917	Ga0496114_0033343	Ga0496114_0033343_1513_2331	272
346	3300048918	Ga0496115_0000545	Ga0496115_0000545_21126_21944	272
347	3300048919	Ga0496116_0036850	Ga0496116_0036850_910_1728	272
348	3300048920	Ga0496117_0000114	Ga0496117_0000114_163578_164396	272
349	3300048921	Ga0496118_0000082	Ga0496118_0000082_20789_21607	272
350	3300048922	Ga0496119_0027672	Ga0496119_0027672_697_1515	272
351	3300048923	Ga0496120_0028461	Ga0496120_0028461_423_1241	272
352	3300048924	Ga0496121_0000655	Ga0496121_0000655_6938_7756	272
353	3300048925	Ga0496122_0014259	Ga0496122_0014259_285_1103	272
354	3300048927	Ga0496124_0000068	Ga0496124_0000068_163715_164533	272
355	3300048928	Ga0496125_0001621	Ga0496125_0001621_17055_17873	272
356	3300048929	Ga0496126_0000634	Ga0496126_0000634_7590_8408	272
357	3300049581	Ga0501047_0270987	Ga0501047_0270987_339_1202	272
358	3300050493	nmdc:mga0k408_245448_c1	nmdc:mga0k408_245448_c1_156_974	272
359	3300053079	Ga0500610_0000053	Ga0500610_0000053_24357_25175	272
360	3300053091	Ga0500647_0062702	Ga0500647_0062702_838_1656	272
361	3300053119	Ga0500595_000376	Ga0500595_000376_7189_8007	272
362	3300053121	Ga0500607_027424	Ga0500607_027424_2121_2939	272
363	3300053177	Ga0500636_0002828	Ga0500636_0002828_4686_5504	272
364	3300053730	Ga0500645_000008	Ga0500645_000008_151732_152550	272
365	3300053735	Ga0500596_000106	Ga0500596_000106_1619_2437	272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01739

CheR

CheR methyltransferase, SAM binding domain

86

277

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5xlx-assembly1.cif.gz_D	crystal structure of the c-terminal domain of cher1 containing sah	0.8678	77	264
1bc5-assembly1.cif.gz_A	chemotaxis receptor recognition by protein methyltransferase cher	0.8656	2	265
1bc5-assembly1.cif.gz_A	chemotaxis receptor recognition by protein methyltransferase cher	0.8477	2	265
5xlx-assembly1.cif.gz_D	crystal structure of the c-terminal domain of cher1 containing sah	0.8116	77	264
3cgg-assembly2.cif.gz_B	crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution	0.8098	87	242

ID	Description	Score	Start	End	Superfamily
5ftwA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8802	75	265	3.40.50.150
5ftwA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8716	75	265	3.40.50.150
1af7A02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8649	74	265	3.40.50.150
1bc5A01	Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain	0.8537	2	73	1.10.155.10
1af7A02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8525	74	265	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q5SF31-F1-model_v4	Methyltransferase domain-containing protein	0.9702	82	264	GO:0008757 GO:0032259
AF-A0A1M2ZZ17-F1-model_v4	Chemotaxis protein CheR	0.9636	11	265	GO:0008757
AF-X1G3V0-F1-model_v4	CheR-type methyltransferase domain-containing protein	0.9536	41	264	GO:0008757
AF-A0A1M2ZZ17-F1-model_v4	Chemotaxis protein CheR	0.9489	11	265	GO:0008757
AF-A0A411LH62-F1-model_v4	Protein-glutamate O-methyltransferase CheR	0.9445	1	265	GO:0008757 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
91.07	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F423838

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01739

CheR

CheR methyltransferase, SAM binding domain

86

277

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map