F423820

General Info

Members Datasets Scaffolds Average Seq Length
365 199 730 127

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0495865|Ga0501031_0495865_107_556
Length 149
Sequence VTATDRAIELVNTAALAASEKLATDIVAIDVSDQLAITDAFVLCSASNDRQVRAIVDHIEEKLRERDARPVRREGEKDGRWVLLDYGDIVIHVQHDEERVYYSLERLWRDCPSIALPESVTAGASTAARPSDSARGSGPAGTAGLDAQA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2643221604 Nocardioides sp. Root190 Isolate Unclassified
195 2643221617 Nocardioides sp. Root79 Isolate Unclassified
196 2643221620 Nocardioides sp. Root240 Isolate Unclassified
197 2738541305 Nocardioides sp. CF167 Isolate Unclassified
198 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
199 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 2.47
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 0
Rhizoplane 8.77
Rhizosphere 80.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0495865 3300049568 Bacteria 788
2 Ga0070683_100636920 3300005329 Bacteria 1021
3 Ga0070683_100902091 3300005329 Bacteria 848
4 Ga0068868_101331916 3300005338 Bacteria 668
5 Ga0070660_101049434 3300005339 Bacteria 689
6 Ga0070689_102128166 3300005340 Bacteria 514
7 Ga0070687_101020641 3300005343 Bacteria 601
8 Ga0070692_10646020 3300005345 Bacteria 706
9 Ga0070675_101981883 3300005354 Bacteria 537
10 Ga0070674_100968315 3300005356 Bacteria 745
11 Ga0070659_100376141 3300005366 Bacteria 1196
12 Ga0070667_100023734 3300005367 Bacteria 5092
13 Ga0070711_101413014 3300005439 Bacteria 606
14 Ga0070700_100679971 3300005441 Bacteria 816
15 Ga0070694_101342211 3300005444 Bacteria 602
16 Ga0070678_100202928 3300005456 Bacteria 1638
17 Ga0070662_100524316 3300005457 Bacteria 990
18 Ga0068867_101494303 3300005459 Bacteria 629
19 Ga0070679_100286642 3300005530 Bacteria 1599
20 Ga0070679_100575731 3300005530 Bacteria 1070
21 Ga0070684_100365720 3300005535 Bacteria 1328
22 Ga0070684_100470954 3300005535 Bacteria 1162
23 Ga0070684_101418696 3300005535 Bacteria 654
24 Ga0070672_100164964 3300005543 Bacteria 1840
25 Ga0070672_102053898 3300005543 Bacteria 515
26 Ga0070696_100000319 3300005546 Bacteria 29290
27 Ga0070704_101918229 3300005549 Bacteria 549
28 Ga0068857_100416622 3300005577 Bacteria 1252
29 Ga0070702_100287347 3300005615 Bacteria 1132
30 Ga0070702_100441262 3300005615 Bacteria 942
31 Ga0070702_101361098 3300005615 Bacteria 579
32 Ga0068852_101966189 3300005616 Bacteria 607
33 Ga0068860_100000672 3300005843 Bacteria 39521
34 Ga0081455_10001502 3300005937 Bacteria 28810
35 Ga0075365_10040734 3300006038 Bacteria 3030
36 Ga0075365_10070859 3300006038 Bacteria 2346
37 Ga0075365_10101043 3300006038 Bacteria 1975
38 Ga0075365_10104058 3300006038 Bacteria 1946
39 Ga0075365_10118920 3300006038 Bacteria 1821
40 Ga0075365_10438307 3300006038 Bacteria 922
41 Ga0075368_10388592 3300006042 Bacteria 612
42 Ga0075364_10073535 3300006051 Bacteria 2253
43 Ga0075364_10243865 3300006051 Bacteria 1221
44 Ga0075364_10899570 3300006051 Bacteria 603
45 Ga0075432_10183489 3300006058 Bacteria 820
46 Ga0075362_10571160 3300006177 Bacteria 583
47 Ga0075367_10201817 3300006178 Bacteria 1242
48 Ga0075367_10228986 3300006178 Bacteria 1164
49 Ga0075434_100823557 3300006871 Bacteria 944
50 Ga0068865_100262970 3300006881 Bacteria 1367
51 Ga0111539_10052403 3300009094 Bacteria 4857
52 Ga0111539_10258698 3300009094 Bacteria 2026
53 Ga0111539_12320719 3300009094 Bacteria 622
54 Ga0105245_11377353 3300009098 Bacteria 755
55 Ga0105247_10774634 3300009101 Bacteria 729
56 Ga0105243_10243891 3300009148 Bacteria 1600
57 Ga0105243_11044654 3300009148 Bacteria 822
58 Ga0105243_11750324 3300009148 Bacteria 651
59 Ga0105237_11657602 3300009545 Bacteria 647
60 Ga0105238_12518545 3300009551 Bacteria 550
61 Ga0105249_10311950 3300009553 Bacteria 1582
62 Ga0105239_12565685 3300010375 Bacteria 594
63 Ga0105246_11781279 3300011119 Bacteria 588
64 Ga0157371_10466159 3300013102 Bacteria 930
65 Ga0157371_11028690 3300013102 Bacteria 629
66 Ga0157370_10155780 3300013104 Bacteria 2125
67 Ga0157369_10696077 3300013105 Bacteria 1047
68 Ga0157372_13108705 3300013307 Bacteria 530
69 Ga0157375_10825110 3300013308 Bacteria 1075
70 Ga0157375_11620349 3300013308 Bacteria 765
71 Ga0157375_12063145 3300013308 Bacteria 678
72 Ga0157375_12575274 3300013308 Bacteria 608
73 Ga0163163_10131107 3300014325 Bacteria 2547
74 Ga0163163_11102838 3300014325 Bacteria 856
75 Ga0163163_11438319 3300014325 Bacteria 751
76 Ga0163163_12631886 3300014325 Bacteria 560
77 Ga0157380_10454603 3300014326 Bacteria 1231
78 Ga0182008_10080698 3300014497 Bacteria 1601
79 Ga0197907_10560341 3300020069 Bacteria 574
80 Ga0197907_11019179 3300020069 Bacteria 508
81 Ga0197907_11172187 3300020069 Bacteria 552
82 Ga0206356_11506728 3300020070 Bacteria 1560
83 Ga0206349_1351591 3300020075 Bacteria 858
84 Ga0206352_10590155 3300020078 Bacteria 649
85 Ga0206354_11276608 3300020081 Bacteria 1412
86 Ga0206353_11788827 3300020082 Bacteria 942
87 Ga0206353_11986489 3300020082 Bacteria 800
88 Ga0207688_10676897 3300025901 Bacteria 652
89 Ga0207662_10401863 3300025918 Bacteria 929
90 Ga0207662_10683632 3300025918 Bacteria 718
91 Ga0207652_10173077 3300025921 Bacteria 1938
92 Ga0207694_10450072 3300025924 Bacteria 1075
93 Ga0207659_10781709 3300025926 Bacteria 820
94 Ga0207687_10091372 3300025927 Bacteria 2220
95 Ga0207644_11034063 3300025931 Bacteria 690
96 Ga0207706_10113648 3300025933 Bacteria 2381
97 Ga0207709_10117228 3300025935 Bacteria 1791
98 Ga0207670_11336018 3300025936 Bacteria 608
99 Ga0207669_10639803 3300025937 Bacteria 869
100 Ga0207704_10390798 3300025938 Bacteria 1095
101 Ga0207704_11738627 3300025938 Bacteria 536
102 Ga0207691_10300405 3300025940 Bacteria 1379
103 Ga0207661_10375717 3300025944 Bacteria 1286
104 Ga0207661_10911937 3300025944 Bacteria 809
105 Ga0207679_10462871 3300025945 Bacteria 1126
106 Ga0207712_10499683 3300025961 Bacteria 1039
107 Ga0207668_11465688 3300025972 Bacteria 616
108 Ga0207658_10064812 3300025986 Bacteria 2742
109 Ga0207678_10945553 3300026067 Bacteria 762
110 Ga0207708_10013277 3300026075 Bacteria 6150
111 Ga0207702_10286320 3300026078 Bacteria 1560
112 Ga0207675_100399272 3300026118 Bacteria 1355
113 Ga0207683_10483750 3300026121 Bacteria 1142
114 Ga0207683_11722909 3300026121 Bacteria 576
115 Ga0207698_10146505 3300026142 Bacteria 2043
116 Ga0207698_11371641 3300026142 Bacteria 722
117 Ga0209813_10304875 3300027866 Bacteria 619
118 Ga0207428_10675221 3300027907 Bacteria 740
119 Ga0268264_10009136 3300028381 Bacteria 8217
120 Ga0307413_10555943 3300031824 Bacteria 932
121 Ga0307410_10016555 3300031852 Bacteria 4400
122 Ga0307410_10105736 3300031852 Bacteria 2027
123 Ga0307410_10245417 3300031852 Bacteria 1390
124 Ga0307410_10267123 3300031852 Bacteria 1337
125 Ga0307406_10468229 3300031901 Bacteria 1015
126 Ga0307407_10174970 3300031903 Bacteria 1417
127 Ga0307412_10105193 3300031911 Bacteria 2004
128 Ga0307412_11139437 3300031911 Bacteria 696
129 Ga0307409_100077257 3300031995 Bacteria 2674
130 Ga0307409_100216285 3300031995 Bacteria 1726
131 Ga0307409_100896130 3300031995 Bacteria 900
132 Ga0307416_100248169 3300032002 Bacteria 1730
133 Ga0307414_10238119 3300032004 Bacteria 1505
134 Ga0307411_10065107 3300032005 Bacteria 2443
135 Ga0307411_11857157 3300032005 Bacteria 560
136 Ga0307415_101746400 3300032126 Bacteria 601
137 Ga0373930_0039201 3300034816 Bacteria 1004
138 Ga0373947_0105334 3300035725 Bacteria 1777
139 Ga0395900_0179528 3300037418 Bacteria 2152
140 Ga0395900_0214993 3300037418 Bacteria 1940
141 Ga0395900_0377305 3300037418 Bacteria 1387
142 Ga0395900_0684547 3300037418 Bacteria 960
143 Ga0395900_1774105 3300037418 Bacteria 528
144 Ga0395905_0088761 3300037471 Bacteria 2898
145 Ga0395905_0236664 3300037471 Bacteria 1707
146 Ga0395901_0041462 3300038443 Bacteria 4771
147 Ga0395901_0197249 3300038443 Bacteria 2111
148 Ga0395901_0290618 3300038443 Bacteria 1696
149 Ga0395901_0311197 3300038443 Bacteria 1631
150 Ga0395901_0434207 3300038443 Bacteria 1345
151 Ga0395901_0531055 3300038443 Bacteria 1194
152 Ga0395901_0647898 3300038443 Bacteria 1060
153 Ga0451800_1004522 3300041459 Bacteria 613
154 Ga0451839_0020018 3300041496 Bacteria 503
155 Ga0451849_0538255 3300041505 Bacteria 789
156 Ga0466972_0014596 3300044658 Bacteria 3933
157 Ga0466972_0155358 3300044658 Bacteria 1075
158 Ga0466972_0228180 3300044658 Bacteria 871
159 Ga0466965_0004112 3300044683 Bacteria 6464
160 Ga0466965_0004888 3300044683 Bacteria 5985
161 Ga0466965_0011257 3300044683 Bacteria 4189
162 Ga0466966_0082558 3300044684 Bacteria 2000
163 Ga0466966_0171046 3300044684 Bacteria 1320
164 Ga0466961_0008449 3300044693 Bacteria 6557
165 Ga0466963_0031372 3300044694 Bacteria 3435
166 Ga0466963_0234522 3300044694 Bacteria 1286
167 Ga0466963_0430427 3300044694 Bacteria 931
168 Ga0466963_0433200 3300044694 Bacteria 927
169 Ga0466964_0045982 3300044706 Bacteria 1778
170 Ga0466971_0003661 3300044719 Bacteria 6574
171 Ga0466970_0037846 3300044765 Bacteria 2558
172 Ga0466970_0043685 3300044765 Bacteria 2385
173 Ga0466970_0398067 3300044765 Bacteria 785
174 Ga0466957_0008103 3300044842 Bacteria 5961
175 Ga0466957_0555845 3300044842 Bacteria 800
176 Ga0466960_0003142 3300044901 Bacteria 6333
177 Ga0466960_0030317 3300044901 Bacteria 2488
178 Ga0466960_0047602 3300044901 Bacteria 2057
179 Ga0466960_0170294 3300044901 Bacteria 1175
180 Ga0466960_0176670 3300044901 Bacteria 1155
181 Ga0466960_0300613 3300044901 Bacteria 904
182 Ga0466960_0422071 3300044901 Bacteria 771
183 Ga0466960_0569955 3300044901 Bacteria 669
184 Ga0466960_0875281 3300044901 Bacteria 547
185 Ga0466958_0012653 3300045836 Bacteria 4784
186 Ga0466967_0026405 3300045976 Bacteria 4810
187 Ga0466967_0074415 3300045976 Bacteria 3050
188 Ga0466967_0095533 3300045976 Bacteria 2709
189 Ga0466967_0457092 3300045976 Bacteria 1248
190 Ga0466967_1058177 3300045976 Bacteria 808
191 Ga0466967_2030672 3300045976 Bacteria 571
192 Ga0466967_2293291 3300045976 Bacteria 535
193 Ga0495629_1146807 3300046459 Bacteria 501
194 Ga0495582_0017787 3300046473 Bacteria 3885
195 Ga0495664_0116077 3300046477 Bacteria 1618
196 Ga0495664_0369577 3300046477 Bacteria 863
197 Ga0495618_0626640 3300046514 Bacteria 638
198 Ga0495665_0370655 3300046531 Bacteria 728
199 Ga0495586_0451774 3300046535 Bacteria 741
200 Ga0495634_0468191 3300046642 Bacteria 742
201 Ga0495657_0176375 3300046675 Bacteria 1314
202 Ga0495599_0427506 3300046678 Bacteria 786
203 Ga0495647_0237097 3300046681 Bacteria 809
204 Ga0495624_0305430 3300046690 Bacteria 959
205 Ga0495674_0660447 3300047319 Bacteria 824
206 Ga0495676_0137754 3300047321 Bacteria 1753
207 Ga0495676_0255042 3300047321 Bacteria 1195
208 Ga0495675_0606856 3300047444 Bacteria 620
209 Ga0496100_0163722 3300048903 Bacteria 1596
210 Ga0496100_0655696 3300048903 Bacteria 817
211 Ga0496101_0318749 3300048904 Bacteria 1219
212 Ga0496102_0125059 3300048905 Bacteria 2403
213 Ga0496102_0196124 3300048905 Bacteria 1903
214 Ga0496102_0314181 3300048905 Bacteria 1476
215 Ga0496103_0315165 3300048906 Bacteria 1006
216 Ga0496104_0011123 3300048907 Bacteria 8052
217 Ga0496104_0454986 3300048907 Bacteria 1192
218 Ga0496104_0988302 3300048907 Bacteria 746
219 Ga0496105_0152853 3300048908 Bacteria 1896
220 Ga0496107_0053045 3300048910 Bacteria 2925
221 Ga0496107_0182754 3300048910 Bacteria 1557
222 Ga0496109_0287258 3300048912 Bacteria 1550
223 Ga0496109_0397927 3300048912 Bacteria 1301
224 Ga0496109_0453270 3300048912 Bacteria 1211
225 Ga0496110_0243102 3300048913 Bacteria 1638
226 Ga0496110_0548482 3300048913 Bacteria 1051
227 Ga0496110_1231690 3300048913 Bacteria 657
228 Ga0496112_0524762 3300048915 Bacteria 1119
229 Ga0496113_0095073 3300048916 Bacteria 2303
230 Ga0496113_0401638 3300048916 Bacteria 1100
231 Ga0496114_0007513 3300048917 Bacteria 8620
232 Ga0496114_0202244 3300048917 Bacteria 1740
233 Ga0496114_0660972 3300048917 Bacteria 918
234 Ga0496114_0700695 3300048917 Bacteria 888
235 Ga0496114_0913955 3300048917 Bacteria 759
236 Ga0496114_1478568 3300048917 Bacteria 567
237 Ga0496115_0099765 3300048918 Bacteria 2380
238 Ga0496115_0181328 3300048918 Bacteria 1740
239 Ga0496115_0549516 3300048918 Bacteria 923
240 Ga0501291_086914 3300049514 Bacteria 632
241 Ga0501031_0065307 3300049568 Bacteria 2370
242 Ga0501031_0182491 3300049568 Bacteria 1371
243 Ga0501032_0336827 3300049569 Bacteria 972
244 Ga0501033_0056389 3300049570 Bacteria 2904
245 Ga0501034_0545908 3300049571 Bacteria 1069
246 Ga0501036_0043782 3300049572 Bacteria 3791
247 Ga0501036_0139670 3300049572 Bacteria 2045
248 Ga0501036_0339735 3300049572 Bacteria 1254
249 Ga0501036_0898129 3300049572 Bacteria 727
250 Ga0501037_0603131 3300049573 Bacteria 737
251 Ga0501037_1134986 3300049573 Bacteria 505
252 Ga0501038_0170025 3300049574 Bacteria 1765
253 Ga0501038_0438515 3300049574 Bacteria 1006
254 Ga0501038_0704781 3300049574 Bacteria 756
255 Ga0501038_0791644 3300049574 Bacteria 705
256 Ga0501039_0020390 3300049575 Bacteria 5082
257 Ga0501039_0030676 3300049575 Bacteria 4145
258 Ga0501039_0205163 3300049575 Bacteria 1550
259 Ga0501039_0244111 3300049575 Bacteria 1412
260 Ga0501039_1310135 3300049575 Bacteria 559
261 Ga0501040_0426895 3300049576 Bacteria 953
262 Ga0501040_0645447 3300049576 Bacteria 765
263 Ga0501040_0723880 3300049576 Bacteria 720
264 Ga0501041_0044937 3300049577 Bacteria 2684
265 Ga0501041_0138458 3300049577 Bacteria 1517
266 Ga0501041_0528361 3300049577 Bacteria 751
267 Ga0501042_0031999 3300049578 Bacteria 3723
268 Ga0501042_0132791 3300049578 Bacteria 1794
269 Ga0501042_0201020 3300049578 Bacteria 1437
270 Ga0501042_0367961 3300049578 Bacteria 1040
271 Ga0501042_0570104 3300049578 Bacteria 823
272 Ga0501046_0088868 3300049580 Bacteria 2379
273 Ga0501046_0386833 3300049580 Bacteria 1012
274 Ga0501048_0016191 3300049582 Bacteria 5497
275 Ga0501048_0114365 3300049582 Bacteria 1906
276 Ga0501048_0231813 3300049582 Bacteria 1310
277 Ga0501067_0037208 3300049583 Bacteria 2703
278 Ga0501067_0152596 3300049583 Bacteria 1287
279 Ga0501068_0046830 3300049584 Bacteria 2607
280 Ga0501068_0146541 3300049584 Bacteria 1482
281 Ga0501069_0120388 3300049585 Bacteria 1499
282 Ga0501069_0269939 3300049585 Bacteria 994
283 Ga0501069_0896673 3300049585 Bacteria 539
284 Ga0501070_0026257 3300049586 Bacteria 4889
285 Ga0501070_0145829 3300049586 Bacteria 1954
286 Ga0501070_0828251 3300049586 Bacteria 725
287 Ga0501071_0030649 3300049587 Bacteria 3805
288 Ga0501071_0237413 3300049587 Bacteria 1374
289 Ga0501072_0097414 3300049588 Bacteria 2338
290 Ga0501072_0124687 3300049588 Bacteria 2052
291 Ga0501072_0179355 3300049588 Bacteria 1689
292 Ga0501072_0986311 3300049588 Bacteria 657
293 Ga0501073_0195684 3300049589 Bacteria 1398
294 Ga0501073_0635251 3300049589 Bacteria 737
295 Ga0501074_0144477 3300049590 Bacteria 1701
296 Ga0501074_0169856 3300049590 Bacteria 1557
297 Ga0501074_0439542 3300049590 Bacteria 925
298 Ga0501074_1064076 3300049590 Bacteria 568
299 Ga0501075_0179898 3300049591 Bacteria 1613
300 Ga0501075_0192727 3300049591 Bacteria 1554
301 Ga0501076_0128865 3300049592 Bacteria 2051
302 Ga0501076_0169465 3300049592 Bacteria 1779
303 Ga0501077_0029835 3300049593 Bacteria 3468
304 Ga0501077_0231646 3300049593 Bacteria 1174
305 Ga0501077_0756681 3300049593 Bacteria 625
306 Ga0501256_041141 3300049685 Bacteria 549
307 Ga0501079_1129087 3300049741 Bacteria 617
308 Ga0501080_0140501 3300049742 Bacteria 2233
309 Ga0501080_0717600 3300049742 Bacteria 881
310 Ga0501080_1526588 3300049742 Bacteria 567
311 Ga0501081_0054091 3300049743 Bacteria 2773
312 Ga0501081_0089193 3300049743 Bacteria 2167
313 Ga0501081_0506254 3300049743 Bacteria 900
314 Ga0501083_0218850 3300049744 Bacteria 1241
315 Ga0501035_0151876 3300049822 Bacteria 2009
316 Ga0501035_0789674 3300049822 Bacteria 759
317 Ga0501044_0301752 3300049823 Bacteria 1530
318 Ga0501045_0035753 3300049824 Bacteria 3607
319 Ga0501045_0088732 3300049824 Bacteria 2284
320 Ga0501045_0135167 3300049824 Bacteria 1833
321 Ga0501045_0257498 3300049824 Bacteria 1299
322 Ga0501045_0263902 3300049824 Bacteria 1282
323 Ga0501045_0644548 3300049824 Bacteria 783
324 nmdc:mga03683_217550_c1 3300050489 Bacteria 880
325 nmdc:mga03n38_180230_c1 3300050490 Bacteria 1082
326 nmdc:mga00v17_390733_c1 3300050491 Bacteria 904
327 nmdc:mga00v17_47809_c1 3300050491 Bacteria 2592
328 nmdc:mga00v17_566613_c1 3300050491 Bacteria 734
329 nmdc:mga0yw44_11346_c1 3300050492 Bacteria 4593
330 nmdc:mga0yw44_11957_c1 3300050492 Bacteria 4506
331 nmdc:mga0yw44_127434_c1 3300050492 Bacteria 1645
332 nmdc:mga0yw44_17848_c1 3300050492 Bacteria 3872
333 nmdc:mga0yw44_178603_c1 3300050492 Bacteria 1396
334 nmdc:mga0yw44_582496_c1 3300050492 Bacteria 760
335 nmdc:mga0yw44_710651_c1 3300050492 Bacteria 683
336 nmdc:mga0yw44_77317_c1 3300050492 Bacteria 2079
337 nmdc:mga06z11_134579_c1 3300050494 Bacteria 1006
338 nmdc:mga04h51_341020_c1 3300050495 Bacteria 618
339 nmdc:mga08y16_387916_c1 3300050511 Bacteria 1431
340 Ga0495601_0063625 3300053077 Bacteria 2345
341 Ga0495612_0596248 3300053078 Bacteria 510
342 Ga0495655_0043538 3300053083 Bacteria 1158
343 Ga0495595_0599028 3300053084 Bacteria 563
344 Ga0500644_0000463 3300053088 Bacteria 18396
345 Ga0501084_0258923 3300054114 Bacteria 1469
346 Ga0501084_0276336 3300054114 Bacteria 1418
347 Ga0501084_0480076 3300054114 Bacteria 1051
348 Ga0501084_0575866 3300054114 Bacteria 951
349 Ga0501084_0871899 3300054114 Bacteria 757
350 Ga0590071_075462 3300059421 Bacteria 834
351 Ga0590075_140118 3300059424 Bacteria 636
352 Ga0590077_012562 3300059426 Bacteria 1758
353 Ga0501082_0068183 3300060353 Bacteria 3063
354 Ga0501082_0332876 3300060353 Bacteria 1323
355 Ga0466962_0033195 3300061719 Bacteria 2469
356 Ga0530510_0008697 3300061734 Bacteria 7098
357 Ga0530510_0236839 3300061734 Bacteria 1358
358 Ga0530510_0532202 3300061734 Bacteria 892
359 Ga0530510_0636998 3300061734 Bacteria 811
360 2644034200 2643221604 Bacteria 5014917
361 2644102425 2643221617 Bacteria 5139111
362 2644118087 2643221620 Bacteria 5134593
363 2738871426 2738541305 Bacteria 4910150
364 2812333669 2811994874 Bacteria 5367947
365 2855389787 2855386786 Bacteria 4752232
366 Ga0501031_0495865
367 Ga0070683_100636920
368 Ga0070683_100902091
369 Ga0068868_101331916
370 Ga0070660_101049434
371 Ga0070689_102128166
372 Ga0070687_101020641
373 Ga0070692_10646020
374 Ga0070675_101981883
375 Ga0070674_100968315
376 Ga0070659_100376141
377 Ga0070667_100023734
378 Ga0070711_101413014
379 Ga0070700_100679971
380 Ga0070694_101342211
381 Ga0070678_100202928
382 Ga0070662_100524316
383 Ga0068867_101494303
384 Ga0070679_100286642
385 Ga0070679_100575731
386 Ga0070684_100365720
387 Ga0070684_100470954
388 Ga0070684_101418696
389 Ga0070672_100164964
390 Ga0070672_102053898
391 Ga0070696_100000319
392 Ga0070704_101918229
393 Ga0068857_100416622
394 Ga0070702_100287347
395 Ga0070702_100441262
396 Ga0070702_101361098
397 Ga0068852_101966189
398 Ga0068860_100000672
399 Ga0081455_10001502
400 Ga0075365_10040734
401 Ga0075365_10070859
402 Ga0075365_10101043
403 Ga0075365_10104058
404 Ga0075365_10118920
405 Ga0075365_10438307
406 Ga0075368_10388592
407 Ga0075364_10073535
408 Ga0075364_10243865
409 Ga0075364_10899570
410 Ga0075432_10183489
411 Ga0075362_10571160
412 Ga0075367_10201817
413 Ga0075367_10228986
414 Ga0075434_100823557
415 Ga0068865_100262970
416 Ga0111539_10052403
417 Ga0111539_10258698
418 Ga0111539_12320719
419 Ga0105245_11377353
420 Ga0105247_10774634
421 Ga0105243_10243891
422 Ga0105243_11044654
423 Ga0105243_11750324
424 Ga0105237_11657602
425 Ga0105238_12518545
426 Ga0105249_10311950
427 Ga0105239_12565685
428 Ga0105246_11781279
429 Ga0157371_10466159
430 Ga0157371_11028690
431 Ga0157370_10155780
432 Ga0157369_10696077
433 Ga0157372_13108705
434 Ga0157375_10825110
435 Ga0157375_11620349
436 Ga0157375_12063145
437 Ga0157375_12575274
438 Ga0163163_10131107
439 Ga0163163_11102838
440 Ga0163163_11438319
441 Ga0163163_12631886
442 Ga0157380_10454603
443 Ga0182008_10080698
444 Ga0197907_10560341
445 Ga0197907_11019179
446 Ga0197907_11172187
447 Ga0206356_11506728
448 Ga0206349_1351591
449 Ga0206352_10590155
450 Ga0206354_11276608
451 Ga0206353_11788827
452 Ga0206353_11986489
453 Ga0207688_10676897
454 Ga0207662_10401863
455 Ga0207662_10683632
456 Ga0207652_10173077
457 Ga0207694_10450072
458 Ga0207659_10781709
459 Ga0207687_10091372
460 Ga0207644_11034063
461 Ga0207706_10113648
462 Ga0207709_10117228
463 Ga0207670_11336018
464 Ga0207669_10639803
465 Ga0207704_10390798
466 Ga0207704_11738627
467 Ga0207691_10300405
468 Ga0207661_10375717
469 Ga0207661_10911937
470 Ga0207679_10462871
471 Ga0207712_10499683
472 Ga0207668_11465688
473 Ga0207658_10064812
474 Ga0207678_10945553
475 Ga0207708_10013277
476 Ga0207702_10286320
477 Ga0207675_100399272
478 Ga0207683_10483750
479 Ga0207683_11722909
480 Ga0207698_10146505
481 Ga0207698_11371641
482 Ga0209813_10304875
483 Ga0207428_10675221
484 Ga0268264_10009136
485 Ga0307413_10555943
486 Ga0307410_10016555
487 Ga0307410_10105736
488 Ga0307410_10245417
489 Ga0307410_10267123
490 Ga0307406_10468229
491 Ga0307407_10174970
492 Ga0307412_10105193
493 Ga0307412_11139437
494 Ga0307409_100077257
495 Ga0307409_100216285
496 Ga0307409_100896130
497 Ga0307416_100248169
498 Ga0307414_10238119
499 Ga0307411_10065107
500 Ga0307411_11857157
501 Ga0307415_101746400
502 Ga0373930_0039201
503 Ga0373947_0105334
504 Ga0395900_0179528
505 Ga0395900_0214993
506 Ga0395900_0377305
507 Ga0395900_0684547
508 Ga0395900_1774105
509 Ga0395905_0088761
510 Ga0395905_0236664
511 Ga0395901_0041462
512 Ga0395901_0197249
513 Ga0395901_0290618
514 Ga0395901_0311197
515 Ga0395901_0434207
516 Ga0395901_0531055
517 Ga0395901_0647898
518 Ga0451800_1004522
519 Ga0451839_0020018
520 Ga0451849_0538255
521 Ga0466972_0014596
522 Ga0466972_0155358
523 Ga0466972_0228180
524 Ga0466965_0004112
525 Ga0466965_0004888
526 Ga0466965_0011257
527 Ga0466966_0082558
528 Ga0466966_0171046
529 Ga0466961_0008449
530 Ga0466963_0031372
531 Ga0466963_0234522
532 Ga0466963_0430427
533 Ga0466963_0433200
534 Ga0466964_0045982
535 Ga0466971_0003661
536 Ga0466970_0037846
537 Ga0466970_0043685
538 Ga0466970_0398067
539 Ga0466957_0008103
540 Ga0466957_0555845
541 Ga0466960_0003142
542 Ga0466960_0030317
543 Ga0466960_0047602
544 Ga0466960_0170294
545 Ga0466960_0176670
546 Ga0466960_0300613
547 Ga0466960_0422071
548 Ga0466960_0569955
549 Ga0466960_0875281
550 Ga0466958_0012653
551 Ga0466967_0026405
552 Ga0466967_0074415
553 Ga0466967_0095533
554 Ga0466967_0457092
555 Ga0466967_1058177
556 Ga0466967_2030672
557 Ga0466967_2293291
558 Ga0495629_1146807
559 Ga0495582_0017787
560 Ga0495664_0116077
561 Ga0495664_0369577
562 Ga0495618_0626640
563 Ga0495665_0370655
564 Ga0495586_0451774
565 Ga0495634_0468191
566 Ga0495657_0176375
567 Ga0495599_0427506
568 Ga0495647_0237097
569 Ga0495624_0305430
570 Ga0495674_0660447
571 Ga0495676_0137754
572 Ga0495676_0255042
573 Ga0495675_0606856
574 Ga0496100_0163722
575 Ga0496100_0655696
576 Ga0496101_0318749
577 Ga0496102_0125059
578 Ga0496102_0196124
579 Ga0496102_0314181
580 Ga0496103_0315165
581 Ga0496104_0011123
582 Ga0496104_0454986
583 Ga0496104_0988302
584 Ga0496105_0152853
585 Ga0496107_0053045
586 Ga0496107_0182754
587 Ga0496109_0287258
588 Ga0496109_0397927
589 Ga0496109_0453270
590 Ga0496110_0243102
591 Ga0496110_0548482
592 Ga0496110_1231690
593 Ga0496112_0524762
594 Ga0496113_0095073
595 Ga0496113_0401638
596 Ga0496114_0007513
597 Ga0496114_0202244
598 Ga0496114_0660972
599 Ga0496114_0700695
600 Ga0496114_0913955
601 Ga0496114_1478568
602 Ga0496115_0099765
603 Ga0496115_0181328
604 Ga0496115_0549516
605 Ga0501291_086914
606 Ga0501031_0065307
607 Ga0501031_0182491
608 Ga0501032_0336827
609 Ga0501033_0056389
610 Ga0501034_0545908
611 Ga0501036_0043782
612 Ga0501036_0139670
613 Ga0501036_0339735
614 Ga0501036_0898129
615 Ga0501037_0603131
616 Ga0501037_1134986
617 Ga0501038_0170025
618 Ga0501038_0438515
619 Ga0501038_0704781
620 Ga0501038_0791644
621 Ga0501039_0020390
622 Ga0501039_0030676
623 Ga0501039_0205163
624 Ga0501039_0244111
625 Ga0501039_1310135
626 Ga0501040_0426895
627 Ga0501040_0645447
628 Ga0501040_0723880
629 Ga0501041_0044937
630 Ga0501041_0138458
631 Ga0501041_0528361
632 Ga0501042_0031999
633 Ga0501042_0132791
634 Ga0501042_0201020
635 Ga0501042_0367961
636 Ga0501042_0570104
637 Ga0501046_0088868
638 Ga0501046_0386833
639 Ga0501048_0016191
640 Ga0501048_0114365
641 Ga0501048_0231813
642 Ga0501067_0037208
643 Ga0501067_0152596
644 Ga0501068_0046830
645 Ga0501068_0146541
646 Ga0501069_0120388
647 Ga0501069_0269939
648 Ga0501069_0896673
649 Ga0501070_0026257
650 Ga0501070_0145829
651 Ga0501070_0828251
652 Ga0501071_0030649
653 Ga0501071_0237413
654 Ga0501072_0097414
655 Ga0501072_0124687
656 Ga0501072_0179355
657 Ga0501072_0986311
658 Ga0501073_0195684
659 Ga0501073_0635251
660 Ga0501074_0144477
661 Ga0501074_0169856
662 Ga0501074_0439542
663 Ga0501074_1064076
664 Ga0501075_0179898
665 Ga0501075_0192727
666 Ga0501076_0128865
667 Ga0501076_0169465
668 Ga0501077_0029835
669 Ga0501077_0231646
670 Ga0501077_0756681
671 Ga0501256_041141
672 Ga0501079_1129087
673 Ga0501080_0140501
674 Ga0501080_0717600
675 Ga0501080_1526588
676 Ga0501081_0054091
677 Ga0501081_0089193
678 Ga0501081_0506254
679 Ga0501083_0218850
680 Ga0501035_0151876
681 Ga0501035_0789674
682 Ga0501044_0301752
683 Ga0501045_0035753
684 Ga0501045_0088732
685 Ga0501045_0135167
686 Ga0501045_0257498
687 Ga0501045_0263902
688 Ga0501045_0644548
689 nmdc:mga03683_217550_c1
690 nmdc:mga03n38_180230_c1
691 nmdc:mga00v17_390733_c1
692 nmdc:mga00v17_47809_c1
693 nmdc:mga00v17_566613_c1
694 nmdc:mga0yw44_11346_c1
695 nmdc:mga0yw44_11957_c1
696 nmdc:mga0yw44_127434_c1
697 nmdc:mga0yw44_17848_c1
698 nmdc:mga0yw44_178603_c1
699 nmdc:mga0yw44_582496_c1
700 nmdc:mga0yw44_710651_c1
701 nmdc:mga0yw44_77317_c1
702 nmdc:mga06z11_134579_c1
703 nmdc:mga04h51_341020_c1
704 nmdc:mga08y16_387916_c1
705 Ga0495601_0063625
706 Ga0495612_0596248
707 Ga0495655_0043538
708 Ga0495595_0599028
709 Ga0500644_0000463
710 Ga0501084_0258923
711 Ga0501084_0276336
712 Ga0501084_0480076
713 Ga0501084_0575866
714 Ga0501084_0871899
715 Ga0590071_075462
716 Ga0590075_140118
717 Ga0590077_012562
718 Ga0501082_0068183
719 Ga0501082_0332876
720 Ga0466962_0033195
721 Ga0530510_0008697
722 Ga0530510_0236839
723 Ga0530510_0532202
724 Ga0530510_0636998
725 2644034200
726 2644102425
727 2644118087
728 2738871426
729 2812333669
730 2855389787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

12

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9449 2 112
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9432 2 117
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9286 2 112
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9278 2 117
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.9141 9 116
ID Description Score Start End Superfamily
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9522 9 108 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9483 2 112 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9478 7 117 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9401 2 112 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9235 7 117 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A6J4KZQ8-F1-model_v4 Ribosomal silencing factor RsfS 1 1 117 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7W0GEE0-F1-model_v4 Ribosomal silencing factor RsfS 0.9977 1 117 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-F8B3R9-F1-model_v4 Ribosomal silencing factor RsfS 0.9971 1 117 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-C7Q898-F1-model_v4 Ribosomal silencing factor RsfS 0.9961 1 120 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A1Q7W3G4-F1-model_v4 Ribosomal silencing factor RsfS 0.996 1 120 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map