F423728

General Info

Members Datasets Scaffolds Average Seq Length
365 215 365 116

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11203994|Ga0307410_112039942
Length 116
Sequence MTPLQTLAATVTLLALSNVFMTFAWYGHLKHLQASPWWIAALASWGIALAEYLLQVPANRIGYASGLTLAQLKILQEVITLVVFIPFAMFYMGEGLKLDYLWAGLCLVGAVYFIFR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
154 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
155 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
156 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.27
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10533442 3300005328 Bacteria 838
2 Ga0070683_100964566 3300005329 Bacteria 818
3 Ga0070690_100111925 3300005330 Bacteria 1823
4 Ga0068869_100043105 3300005334 Bacteria 3239
5 Ga0070680_101421803 3300005336 Bacteria 601
6 Ga0068868_100294877 3300005338 Bacteria 1376
7 Ga0070689_100251718 3300005340 Bacteria 1457
8 Ga0070689_100287822 3300005340 Bacteria 1365
9 Ga0070691_10194716 3300005341 Bacteria 1062
10 Ga0070687_100915030 3300005343 Bacteria 630
11 Ga0070692_10030392 3300005345 Bacteria 2701
12 Ga0070692_10183797 3300005345 Bacteria 1213
13 Ga0070668_100025325 3300005347 Bacteria 4498
14 Ga0070669_100009604 3300005353 Bacteria 6888
15 Ga0070669_101798312 3300005353 Bacteria 535
16 Ga0070675_101021148 3300005354 Bacteria 759
17 Ga0070674_100161098 3300005356 Bacteria 1702
18 Ga0070674_102005177 3300005356 Bacteria 527
19 Ga0070673_101009769 3300005364 Bacteria 775
20 Ga0070688_100024858 3300005365 Bacteria 3540
21 Ga0070703_10252772 3300005406 Bacteria 716
22 Ga0070701_10162240 3300005438 Bacteria 1295
23 Ga0070705_100007976 3300005440 Bacteria 5233
24 Ga0070705_100017863 3300005440 Bacteria 3709
25 Ga0070700_100001242 3300005441 Bacteria 12637
26 Ga0070700_100139106 3300005441 Bacteria 1648
27 Ga0070700_100493308 3300005441 Bacteria 940
28 Ga0070700_100615623 3300005441 Bacteria 853
29 Ga0070694_100035165 3300005444 Bacteria 3310
30 Ga0070694_100053786 3300005444 Bacteria 2726
31 Ga0070694_100057486 3300005444 Bacteria 2644
32 Ga0070694_100222050 3300005444 Bacteria 1417
33 Ga0070708_100164172 3300005445 Bacteria 2071
34 Ga0070681_10263578 3300005458 Bacteria 1635
35 Ga0070681_10891179 3300005458 Bacteria 808
36 Ga0068867_100000411 3300005459 Bacteria 28681
37 Ga0070706_100116289 3300005467 Bacteria 2491
38 Ga0070707_100559249 3300005468 Bacteria 1106
39 Ga0070707_101552249 3300005468 Bacteria 629
40 Ga0070698_100376731 3300005471 Bacteria 1351
41 Ga0070699_100260752 3300005518 Bacteria 1550
42 Ga0070679_100059221 3300005530 Bacteria 3817
43 Ga0070684_100701935 3300005535 Bacteria 943
44 Ga0070697_100003863 3300005536 Bacteria 11510
45 Ga0070672_101240055 3300005543 Bacteria 665
46 Ga0070686_100856186 3300005544 Bacteria 736
47 Ga0070695_100000952 3300005545 Bacteria 15714
48 Ga0070695_100242162 3300005545 Bacteria 1309
49 Ga0070696_100002104 3300005546 Bacteria 13090
50 Ga0070696_100014721 3300005546 Bacteria 5248
51 Ga0070696_100080593 3300005546 Bacteria 2305
52 Ga0070696_100850852 3300005546 Bacteria 754
53 Ga0070696_101831634 3300005546 Bacteria 525
54 Ga0070693_100283737 3300005547 Bacteria 1110
55 Ga0070704_100005457 3300005549 Bacteria 7408
56 Ga0070704_100076825 3300005549 Bacteria 2444
57 Ga0070704_100259142 3300005549 Bacteria 1432
58 Ga0068857_101356876 3300005577 Bacteria 691
59 Ga0068854_100230775 3300005578 Bacteria 1469
60 Ga0068856_100487216 3300005614 Bacteria 1254
61 Ga0068856_100841514 3300005614 Bacteria 937
62 Ga0070702_100115516 3300005615 Bacteria 1672
63 Ga0068859_100214713 3300005617 Bacteria 2011
64 Ga0068859_100496563 3300005617 Bacteria 1315
65 Ga0068859_101721095 3300005617 Bacteria 692
66 Ga0068864_100568370 3300005618 Bacteria 1098
67 Ga0068866_10369580 3300005718 Bacteria 917
68 Ga0068861_100005597 3300005719 Bacteria 8516
69 Ga0068861_100694899 3300005719 Bacteria 944
70 Ga0068870_10434562 3300005840 Bacteria 862
71 Ga0068870_10702095 3300005840 Bacteria 698
72 Ga0068863_100362152 3300005841 Bacteria 1414
73 Ga0068860_100151149 3300005843 Bacteria 2236
74 Ga0068862_100036242 3300005844 Bacteria 4181
75 Ga0068862_100146688 3300005844 Bacteria 2097
76 Ga0070715_10002815 3300006163 Bacteria 5417
77 Ga0070716_100632501 3300006173 Bacteria 809
78 Ga0070712_100585974 3300006175 Bacteria 943
79 Ga0068871_100445513 3300006358 Bacteria 1160
80 Ga0075428_100075543 3300006844 Bacteria 3679
81 Ga0075428_100325841 3300006844 Bacteria 1650
82 Ga0075428_101659480 3300006844 Bacteria 667
83 Ga0075430_100012241 3300006846 Bacteria 7300
84 Ga0075430_100310323 3300006846 Bacteria 1304
85 Ga0075431_101258158 3300006847 Bacteria 702
86 Ga0075433_10002030 3300006852 Bacteria 15277
87 Ga0075433_10117491 3300006852 Bacteria 2360
88 Ga0075433_10817238 3300006852 Bacteria 814
89 Ga0075433_10979115 3300006852 Bacteria 737
90 Ga0075434_100000204 3300006871 Bacteria 40084
91 Ga0075434_100000459 3300006871 Bacteria 30427
92 Ga0075434_100008705 3300006871 Bacteria 9444
93 Ga0075434_100573278 3300006871 Bacteria 1148
94 Ga0075434_101317507 3300006871 Bacteria 733
95 Ga0075434_101605435 3300006871 Bacteria 659
96 Ga0075429_100198740 3300006880 Bacteria 1756
97 Ga0068865_100038784 3300006881 Bacteria 3226
98 Ga0075436_100000422 3300006914 Bacteria 27110
99 Ga0075436_100002022 3300006914 Bacteria 13988
100 Ga0075436_100016016 3300006914 Bacteria 5133
101 Ga0075436_100136738 3300006914 Bacteria 1721
102 Ga0097620_100214716 3300006931 Bacteria 2011
103 Ga0097620_100496577 3300006931 Bacteria 1315
104 Ga0097620_101721114 3300006931 Bacteria 692
105 Ga0075435_100002321 3300007076 Bacteria 12584
106 Ga0075435_100009283 3300007076 Bacteria 7110
107 Ga0075435_100013170 3300007076 Bacteria 6144
108 Ga0075435_100036719 3300007076 Bacteria 3896
109 Ga0075435_100074762 3300007076 Bacteria 2773
110 Ga0099794_10119782 3300007265 Bacteria 1323
111 Ga0111539_10017399 3300009094 Bacteria 8897
112 Ga0111539_10056671 3300009094 Bacteria 4656
113 Ga0111539_10068781 3300009094 Bacteria 4181
114 Ga0111539_10139311 3300009094 Bacteria 2841
115 Ga0111539_10748710 3300009094 Bacteria 1137
116 Ga0105245_10881505 3300009098 Bacteria 936
117 Ga0114129_10648507 3300009147 Bacteria 1363
118 Ga0105243_10038134 3300009148 Bacteria 3741
119 Ga0105243_10724914 3300009148 Bacteria 972
120 Ga0105242_10619035 3300009176 Bacteria 1048
121 Ga0105249_10045458 3300009553 Bacteria 3994
122 Ga0105249_11547422 3300009553 Bacteria 735
123 Ga0157324_1023302 3300012506 Bacteria 648
124 Ga0157369_12179328 3300013105 Bacteria 562
125 Ga0157380_10114893 3300014326 Bacteria 2269
126 Ga0157376_10924331 3300014969 Bacteria 892
127 Ga0163161_11074013 3300017792 Bacteria 691
128 Ga0209676_1057319 3300025292 Bacteria 988
129 Ga0207653_10088106 3300025885 Bacteria 1084
130 Ga0207642_10013483 3300025899 Bacteria 2983
131 Ga0207645_10088150 3300025907 Bacteria 1994
132 Ga0207643_10398426 3300025908 Bacteria 870
133 Ga0207684_10197025 3300025910 Bacteria 1737
134 Ga0207707_10014335 3300025912 Bacteria 6903
135 Ga0207707_10487040 3300025912 Bacteria 1053
136 Ga0207693_11040787 3300025915 Bacteria 624
137 Ga0207663_10201571 3300025916 Bacteria 1436
138 Ga0207660_10115641 3300025917 Bacteria 2025
139 Ga0207660_10337881 3300025917 Bacteria 1205
140 Ga0207660_10525549 3300025917 Bacteria 961
141 Ga0207662_10245235 3300025918 Bacteria 1174
142 Ga0207662_10484363 3300025918 Bacteria 850
143 Ga0207652_10029715 3300025921 Bacteria 4572
144 Ga0207646_10263469 3300025922 Bacteria 1558
145 Ga0207646_11615303 3300025922 Bacteria 559
146 Ga0207681_10004257 3300025923 Bacteria 8833
147 Ga0207681_10273354 3300025923 Bacteria 1327
148 Ga0207659_10183341 3300025926 Bacteria 1660
149 Ga0207706_10485369 3300025933 Bacteria 1067
150 Ga0207686_10337438 3300025934 Bacteria 1131
151 Ga0207709_10003295 3300025935 Bacteria 9691
152 Ga0207670_10034262 3300025936 Bacteria 3280
153 Ga0207670_10421944 3300025936 Bacteria 1070
154 Ga0207704_10069943 3300025938 Bacteria 2220
155 Ga0207665_10170397 3300025939 Bacteria 1572
156 Ga0207691_10061833 3300025940 Bacteria 3401
157 Ga0207689_10047546 3300025942 Bacteria 3541
158 Ga0207651_10271031 3300025960 Bacteria 1398
159 Ga0207712_10052869 3300025961 Bacteria 2847
160 Ga0207712_10523186 3300025961 Bacteria 1017
161 Ga0207668_10001354 3300025972 Bacteria 14504
162 Ga0207640_10607090 3300025981 Bacteria 927
163 Ga0207677_10312050 3300026023 Bacteria 1303
164 Ga0207703_11117848 3300026035 Bacteria 757
165 Ga0207708_10009983 3300026075 Bacteria 7050
166 Ga0207708_10082939 3300026075 Bacteria 2464
167 Ga0207708_10425801 3300026075 Bacteria 1101
168 Ga0207702_10132473 3300026078 Bacteria 2245
169 Ga0207702_10258395 3300026078 Bacteria 1639
170 Ga0207648_10000711 3300026089 Bacteria 37350
171 Ga0207674_11099465 3300026116 Bacteria 764
172 Ga0207675_101269004 3300026118 Bacteria 757
173 Ga0209967_1005168 3300027364 Bacteria 1748
174 Ga0209967_1071095 3300027364 Bacteria 543
175 Ga0209981_1032005 3300027378 Bacteria 773
176 Ga0209996_1013025 3300027395 Bacteria 1121
177 Ga0210000_1008066 3300027462 Bacteria 1544
178 Ga0209995_1016723 3300027471 Bacteria 1205
179 Ga0209999_1003976 3300027543 Bacteria 2660
180 Ga0209971_1059215 3300027682 Bacteria 927
181 Ga0209974_10371935 3300027876 Bacteria 557
182 Ga0207428_10016796 3300027907 Bacteria 6291
183 Ga0207428_10062873 3300027907 Bacteria 2934
184 Ga0207428_10092334 3300027907 Bacteria 2349
185 Ga0268265_10000628 3300028380 Bacteria 35160
186 Ga0268265_10120765 3300028380 Bacteria 2158
187 Ga0268264_10865876 3300028381 Bacteria 905
188 Ga0265328_10000746 3300031239 Bacteria 15079
189 Ga0265331_10000121 3300031250 Bacteria 102519
190 Ga0265327_10000269 3300031251 Bacteria 102772
191 Ga0307408_100276877 3300031548 Bacteria 1396
192 Ga0307408_100498646 3300031548 Bacteria 1065
193 Ga0307408_101949682 3300031548 Bacteria 564
194 Ga0307405_10416927 3300031731 Bacteria 1055
195 Ga0307405_10520594 3300031731 Bacteria 957
196 Ga0307413_10004205 3300031824 Bacteria 6219
197 Ga0307413_10091278 3300031824 Bacteria 1984
198 Ga0307413_10332341 3300031824 Bacteria 1165
199 Ga0307413_10650833 3300031824 Bacteria 869
200 Ga0307410_10002575 3300031852 Bacteria 8800
201 Ga0307410_10234119 3300031852 Bacteria 1420
202 Ga0307410_11203994 3300031852 Bacteria 660
203 Ga0307410_11512938 3300031852 Bacteria 591
204 Ga0307406_10161693 3300031901 Bacteria 1610
205 Ga0307406_10342340 3300031901 Bacteria 1165
206 Ga0307406_10350147 3300031901 Bacteria 1154
207 Ga0307407_10146250 3300031903 Bacteria 1531
208 Ga0307407_10271903 3300031903 Bacteria 1170
209 Ga0307407_10699485 3300031903 Bacteria 763
210 Ga0307412_10163763 3300031911 Bacteria 1656
211 Ga0307412_10389042 3300031911 Bacteria 1132
212 Ga0307409_100024407 3300031995 Bacteria 4216
213 Ga0307409_100281309 3300031995 Bacteria 1538
214 Ga0307409_101475582 3300031995 Bacteria 707
215 Ga0307409_101607190 3300031995 Bacteria 678
216 Ga0307409_102516332 3300031995 Bacteria 543
217 Ga0307416_100016954 3300032002 Bacteria 5080
218 Ga0307416_100361228 3300032002 Bacteria 1474
219 Ga0307416_100834224 3300032002 Bacteria 1019
220 Ga0307416_101296979 3300032002 Bacteria 834
221 Ga0307416_103016768 3300032002 Bacteria 563
222 Ga0307416_103304538 3300032002 Bacteria 540
223 Ga0307414_10009778 3300032004 Bacteria 5527
224 Ga0307414_10047221 3300032004 Bacteria 2962
225 Ga0307411_10005239 3300032005 Bacteria 6345
226 Ga0307411_10022177 3300032005 Bacteria 3733
227 Ga0307411_10068479 3300032005 Bacteria 2393
228 Ga0307411_10288283 3300032005 Bacteria 1310
229 Ga0307411_11644642 3300032005 Bacteria 593
230 Ga0307415_100808705 3300032126 Bacteria 856
231 Ga0307415_101015279 3300032126 Bacteria 772
232 Ga0373950_0064126 3300034818 Bacteria 742
233 Ga0373940_0083047 3300035088 Bacteria 950
234 Ga0373939_0034505 3300035114 Bacteria 1485
235 Ga0373954_0000001 3300035118 Bacteria 158201
236 Ga0373955_0135735 3300035172 Bacteria 1439
237 Ga0373955_0255378 3300035172 Bacteria 1051
238 Ga0373942_0006906 3300035207 Bacteria 2623
239 Ga0373961_0365520 3300035241 Bacteria 547
240 Ga0373962_0080713 3300035242 Bacteria 987
241 Ga0373933_0016956 3300035724 Bacteria 4083
242 Ga0373937_0001626 3300036401 Bacteria 18870
243 Ga0373937_0125828 3300036401 Bacteria 2391
244 Ga0439436_0081232 3300041404 Bacteria 902
245 Ga0439439_0021682 3300041406 Bacteria 1601
246 Ga0439461_0169370 3300041410 Bacteria 573
247 Ga0451807_2115134 3300041486 Bacteria 763
248 Ga0451839_0204151 3300041496 Bacteria 747
249 Ga0439437_043146 3300042000 Bacteria 588
250 Ga0439441_001496 3300042001 Bacteria 3078
251 Ga0439451_034328 3300042009 Bacteria 1020
252 Ga0450913_008891 3300042117 Bacteria 781
253 Ga0450917_002893 3300042120 Bacteria 1233
254 Ga0450888_045804 3300042126 Bacteria 618
255 Ga0450902_056201 3300042137 Bacteria 678
256 Ga0439435_0000410 3300042436 Bacteria 6651
257 Ga0439444_0003661 3300042437 Bacteria 2184
258 Ga0451577_0006728 3300042876 Bacteria 11405
259 Ga0451577_0008815 3300042876 Bacteria 9770
260 Ga0451577_0189892 3300042876 Bacteria 1853
261 Ga0451577_0290851 3300042876 Bacteria 1480
262 Ga0451577_0634336 3300042876 Bacteria 969
263 Ga0451577_1110882 3300042876 Bacteria 707
264 Ga0453683_0079414 3300044673 Bacteria 2055
265 Ga0453684_0000014 3300044712 Bacteria 993311
266 Ga0453684_0000736 3300044712 Bacteria 114722
267 Ga0453684_0002679 3300044712 Bacteria 42376
268 Ga0453684_0103075 3300044712 Bacteria 3488
269 Ga0453684_0418773 3300044712 Bacteria 1497
270 Ga0453684_2193156 3300044712 Bacteria 552
271 Ga0451576_0000166 3300045051 Bacteria 166647
272 Ga0451576_0000519 3300045051 Bacteria 84375
273 Ga0451576_0002813 3300045051 Bacteria 25067
274 Ga0451576_0005086 3300045051 Bacteria 16671
275 Ga0451576_0008685 3300045051 Bacteria 11893
276 Ga0451576_0074373 3300045051 Bacteria 3536
277 Ga0451576_0167101 3300045051 Bacteria 2296
278 Ga0451576_0250132 3300045051 Bacteria 1852
279 Ga0451576_0280442 3300045051 Bacteria 1742
280 Ga0451576_1151716 3300045051 Bacteria 811
281 Ga0451576_1413987 3300045051 Bacteria 724
282 Ga0495651_0454601 3300046462 Bacteria 827
283 Ga0495584_0110777 3300046491 Bacteria 1389
284 Ga0495584_0648459 3300046491 Bacteria 538
285 Ga0495607_0386767 3300046501 Bacteria 639
286 Ga0495644_0246163 3300046523 Bacteria 694
287 Ga0495642_0080376 3300046528 Bacteria 1372
288 Ga0495652_0276726 3300046529 Bacteria 1231
289 Ga0495598_0230608 3300046537 Bacteria 679
290 Ga0495598_0242539 3300046537 Bacteria 665
291 Ga0495609_0213726 3300046538 Bacteria 803
292 Ga0495621_0005546 3300046539 Bacteria 3633
293 Ga0495656_0183684 3300046615 Bacteria 1029
294 Ga0495659_0059445 3300046664 Bacteria 1408
295 Ga0495669_0251530 3300046684 Bacteria 849
296 Ga0495669_0500577 3300046684 Bacteria 591
297 Ga0495670_0409181 3300046691 Bacteria 733
298 Ga0495671_0504197 3300046692 Bacteria 577
299 Ga0495600_0328494 3300046809 Bacteria 961
300 Ga0495604_0119453 3300047317 Bacteria 1910
301 Ga0495677_0048516 3300047445 Bacteria 1560
302 Ga0501299_165015 3300049522 Bacteria 569
303 Ga0501040_0598169 3300049576 Bacteria 797
304 Ga0501042_0388408 3300049578 Bacteria 1011
305 Ga0501042_0415144 3300049578 Bacteria 975
306 Ga0501042_0610719 3300049578 Bacteria 793
307 Ga0501048_0565948 3300049582 Bacteria 816
308 Ga0501048_0897612 3300049582 Bacteria 637
309 Ga0501067_0589169 3300049583 Bacteria 623
310 Ga0501070_0843294 3300049586 Bacteria 717
311 Ga0501071_0347610 3300049587 Bacteria 1128
312 Ga0501072_0652507 3300049588 Bacteria 828
313 Ga0501072_0777491 3300049588 Bacteria 750
314 Ga0501073_0292257 3300049589 Bacteria 1124
315 Ga0501074_0192517 3300049590 Bacteria 1454
316 Ga0501075_0650893 3300049591 Bacteria 803
317 Ga0501076_0349928 3300049592 Bacteria 1213
318 Ga0501076_0643129 3300049592 Bacteria 875
319 Ga0501202_088053 3300049652 Bacteria 739
320 Ga0501233_220256 3300049668 Bacteria 560
321 Ga0501235_123590 3300049669 Bacteria 650
322 Ga0501225_0302165 3300049705 Bacteria 542
323 Ga0501079_0040198 3300049741 Bacteria 3607
324 Ga0501080_0299357 3300049742 Bacteria 1459
325 Ga0501080_0408856 3300049742 Bacteria 1220
326 Ga0501081_0120766 3300049743 Bacteria 1866
327 Ga0501081_0385039 3300049743 Bacteria 1037
328 Ga0501083_0849326 3300049744 Bacteria 594
329 nmdc:mga05p37_387843_c1 3300050507 Bacteria 1634
330 nmdc:mga0qj67_29058_c1 3300050509 Bacteria 4293
331 nmdc:mga0qj67_551394_c1 3300050509 Bacteria 924
332 nmdc:mga06r32_1267736_c1 3300050510 Bacteria 682
333 nmdc:mga06r32_417686_c2 3300050510 Bacteria 961
334 nmdc:mga06r32_740478_c1 3300050510 Bacteria 947
335 nmdc:mga08y16_1106857_c1 3300050511 Bacteria 767
336 nmdc:mga08y16_198922_c1 3300050511 Bacteria 2077
337 nmdc:mga08y16_233384_c1 3300050511 Bacteria 1903
338 nmdc:mga08y16_281110_c1 3300050511 Bacteria 1717
339 nmdc:mga08y16_36452_c1 3300050511 Bacteria 5166
340 nmdc:mga08y16_9904_c2 3300050511 Bacteria 6954
341 nmdc:mga0n895_1196095_c1 3300050512 Bacteria 734
342 nmdc:mga0n895_134_c1 3300050512 Bacteria 44336
343 nmdc:mga0n895_1724_c1 3300050512 Bacteria 16524
344 nmdc:mga0n895_500_c1 3300050512 Bacteria 26537
345 nmdc:mga0n895_652696_c1 3300050512 Bacteria 1051
346 nmdc:mga0rr50_291_c1 3300050513 Bacteria 27216
347 nmdc:mga0rr50_2994_c1 3300050513 Bacteria 9660
348 nmdc:mga0rr50_464087_c1 3300050513 Bacteria 1074
349 nmdc:mga0rr50_57042_c1 3300050513 Bacteria 2920
350 nmdc:mga0rr50_8865_c1 3300050513 Bacteria 6282
351 nmdc:mga08x19_1128_c1 3300050514 Bacteria 16645
352 nmdc:mga08x19_13319_c1 3300050514 Bacteria 4969
353 nmdc:mga08x19_5846_c1 3300050514 Bacteria 7280
354 nmdc:mga08x19_8388_c1 3300050514 Bacteria 1725
355 nmdc:mga0a205_132093_c1 3300050515 Bacteria 2397
356 nmdc:mga0a205_601_c1 3300050515 Bacteria 28637
357 nmdc:mga0a205_668412_c1 3300050515 Bacteria 889
358 Ga0500616_0005156 3300053153 Bacteria 8971
359 Ga0501084_0026996 3300054114 Bacteria 4797
360 Ga0501084_0094228 3300054114 Bacteria 2514
361 Ga0590071_121577 3300059421 Bacteria 667
362 Ga0590074_066617 3300059423 Bacteria 675
363 Ga0590077_018426 3300059426 Bacteria 1474
364 Ga0501082_0746169 3300060353 Bacteria 857
365 Ga0530510_0452684 3300061734 Bacteria 971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100376731 Ga0070698_1003767312 113
2 3300005530 Ga0070679_100059221 Ga0070679_1000592214 113
3 3300005547 Ga0070693_100283737 Ga0070693_1002837372 113
4 3300009098 Ga0105245_10881505 Ga0105245_108815052 113
5 3300013105 Ga0157369_12179328 Ga0157369_121793282 113
6 3300017792 Ga0163161_11074013 Ga0163161_110740132 113
7 3300025292 Ga0209676_1057319 Ga0209676_10573192 113
8 3300025912 Ga0207707_10014335 Ga0207707_100143358 113
9 3300025921 Ga0207652_10029715 Ga0207652_100297151 113
10 3300031548 Ga0307408_101949682 Ga0307408_1019496821 113
11 3300031731 Ga0307405_10416927 Ga0307405_104169272 113
12 3300031824 Ga0307413_10004205 Ga0307413_100042052 113
13 3300031824 Ga0307413_10650833 Ga0307413_106508332 113
14 3300031852 Ga0307410_10002575 Ga0307410_1000257512 113
15 3300031901 Ga0307406_10161693 Ga0307406_101616932 113
16 3300031903 Ga0307407_10699485 Ga0307407_106994851 113
17 3300031911 Ga0307412_10163763 Ga0307412_101637633 113
18 3300031995 Ga0307409_100024407 Ga0307409_1000244075 113
19 3300031995 Ga0307409_101607190 Ga0307409_1016071901 113
20 3300032002 Ga0307416_100361228 Ga0307416_1003612282 113
21 3300032004 Ga0307414_10047221 Ga0307414_100472213 113
22 3300032005 Ga0307411_10005239 Ga0307411_100052399 113
23 3300032005 Ga0307411_10288283 Ga0307411_102882831 113
24 3300032005 Ga0307411_11644642 Ga0307411_116446422 113
25 3300032126 Ga0307415_100808705 Ga0307415_1008087051 113
26 3300041406 Ga0439439_0021682 Ga0439439_0021682_961_1314 113
27 3300041410 Ga0439461_0169370 Ga0439461_0169370_136_489 113
28 3300044712 Ga0453684_2193156 Ga0453684_2193156_85_432 113
29 3300045051 Ga0451576_0250132 Ga0451576_0250132_493_843 113
30 3300049586 Ga0501070_0843294 Ga0501070_0843294_305_658 113
31 3300049669 Ga0501235_123590 Ga0501235_123590_34_381 113
32 3300049742 Ga0501080_0299357 Ga0501080_0299357_162_515 113
33 3300049744 Ga0501083_0849326 Ga0501083_0849326_53_406 113
34 3300053153 Ga0500616_0005156 Ga0500616_0005156_6609_6950 113
35 3300031239 Ga0265328_10000746 Ga0265328_100007467 114
36 3300031250 Ga0265331_10000121 Ga0265331_1000012157 114
37 3300031251 Ga0265327_10000269 Ga0265327_1000026957 114
38 3300031852 Ga0307410_11203994 Ga0307410_112039942 114
39 3300042876 Ga0451577_0008815 Ga0451577_0008815_5091_5444 114
40 3300042876 Ga0451577_0290851 Ga0451577_0290851_752_1105 114
41 3300042876 Ga0451577_1110882 Ga0451577_1110882_138_485 114
42 3300044673 Ga0453683_0079414 Ga0453683_0079414_805_1158 114
43 3300044712 Ga0453684_0000014 Ga0453684_0000014_913449_913802 114
44 3300044712 Ga0453684_0000736 Ga0453684_0000736_72199_72552 114
45 3300044712 Ga0453684_0103075 Ga0453684_0103075_540_896 114
46 3300045051 Ga0451576_0000519 Ga0451576_0000519_72490_72843 114
47 3300045051 Ga0451576_0167101 Ga0451576_0167101_1479_1832 114
48 3300045051 Ga0451576_1413987 Ga0451576_1413987_57_404 114
49 3300005328 Ga0070676_10533442 Ga0070676_105334421 115
50 3300005329 Ga0070683_100964566 Ga0070683_1009645661 115
51 3300005330 Ga0070690_100111925 Ga0070690_1001119253 115
52 3300005334 Ga0068869_100043105 Ga0068869_1000431053 115
53 3300005336 Ga0070680_101421803 Ga0070680_1014218032 115
54 3300005338 Ga0068868_100294877 Ga0068868_1002948773 115
55 3300005340 Ga0070689_100251718 Ga0070689_1002517181 115
56 3300005340 Ga0070689_100287822 Ga0070689_1002878222 115
57 3300005341 Ga0070691_10194716 Ga0070691_101947162 115
58 3300005343 Ga0070687_100915030 Ga0070687_1009150301 115
59 3300005345 Ga0070692_10030392 Ga0070692_100303922 115
60 3300005345 Ga0070692_10183797 Ga0070692_101837973 115
61 3300005347 Ga0070668_100025325 Ga0070668_1000253257 115
62 3300005353 Ga0070669_100009604 Ga0070669_1000096048 115
63 3300005353 Ga0070669_101798312 Ga0070669_1017983121 115
64 3300005354 Ga0070675_101021148 Ga0070675_1010211482 115
65 3300005356 Ga0070674_100161098 Ga0070674_1001610983 115
66 3300005356 Ga0070674_102005177 Ga0070674_1020051771 115
67 3300005364 Ga0070673_101009769 Ga0070673_1010097692 115
68 3300005365 Ga0070688_100024858 Ga0070688_1000248582 115
69 3300005406 Ga0070703_10252772 Ga0070703_102527722 115
70 3300005438 Ga0070701_10162240 Ga0070701_101622402 115
71 3300005440 Ga0070705_100007976 Ga0070705_1000079762 115
72 3300005440 Ga0070705_100017863 Ga0070705_1000178635 115
73 3300005441 Ga0070700_100001242 Ga0070700_1000012426 115
74 3300005441 Ga0070700_100139106 Ga0070700_1001391063 115
75 3300005441 Ga0070700_100493308 Ga0070700_1004933082 115
76 3300005441 Ga0070700_100615623 Ga0070700_1006156232 115
77 3300005444 Ga0070694_100035165 Ga0070694_1000351653 115
78 3300005444 Ga0070694_100053786 Ga0070694_1000537863 115
79 3300005444 Ga0070694_100057486 Ga0070694_1000574863 115
80 3300005444 Ga0070694_100222050 Ga0070694_1002220501 115
81 3300005445 Ga0070708_100164172 Ga0070708_1001641723 115
82 3300005458 Ga0070681_10263578 Ga0070681_102635783 115
83 3300005458 Ga0070681_10891179 Ga0070681_108911792 115
84 3300005459 Ga0068867_100000411 Ga0068867_10000041130 115
85 3300005467 Ga0070706_100116289 Ga0070706_1001162892 115
86 3300005468 Ga0070707_100559249 Ga0070707_1005592492 115
87 3300005468 Ga0070707_101552249 Ga0070707_1015522492 115
88 3300005518 Ga0070699_100260752 Ga0070699_1002607523 115
89 3300005535 Ga0070684_100701935 Ga0070684_1007019352 115
90 3300005536 Ga0070697_100003863 Ga0070697_1000038639 115
91 3300005543 Ga0070672_101240055 Ga0070672_1012400552 115
92 3300005544 Ga0070686_100856186 Ga0070686_1008561861 115
93 3300005545 Ga0070695_100000952 Ga0070695_1000009527 115
94 3300005545 Ga0070695_100242162 Ga0070695_1002421621 115
95 3300005546 Ga0070696_100002104 Ga0070696_10000210411 115
96 3300005546 Ga0070696_100014721 Ga0070696_1000147214 115
97 3300005546 Ga0070696_100080593 Ga0070696_1000805932 115
98 3300005546 Ga0070696_100850852 Ga0070696_1008508522 115
99 3300005546 Ga0070696_101831634 Ga0070696_1018316341 115
100 3300005549 Ga0070704_100005457 Ga0070704_1000054574 115
101 3300005549 Ga0070704_100076825 Ga0070704_1000768253 115
102 3300005549 Ga0070704_100259142 Ga0070704_1002591423 115
103 3300005577 Ga0068857_101356876 Ga0068857_1013568761 115
104 3300005578 Ga0068854_100230775 Ga0068854_1002307752 115
105 3300005614 Ga0068856_100487216 Ga0068856_1004872162 115
106 3300005614 Ga0068856_100841514 Ga0068856_1008415142 115
107 3300005615 Ga0070702_100115516 Ga0070702_1001155163 115
108 3300005617 Ga0068859_100214713 Ga0068859_1002147132 115
109 3300005617 Ga0068859_100496563 Ga0068859_1004965632 115
110 3300005617 Ga0068859_101721095 Ga0068859_1017210952 115
111 3300005618 Ga0068864_100568370 Ga0068864_1005683702 115
112 3300005718 Ga0068866_10369580 Ga0068866_103695802 115
113 3300005719 Ga0068861_100005597 Ga0068861_1000055972 115
114 3300005719 Ga0068861_100694899 Ga0068861_1006948992 115
115 3300005840 Ga0068870_10434562 Ga0068870_104345622 115
116 3300005840 Ga0068870_10702095 Ga0068870_107020952 115
117 3300005841 Ga0068863_100362152 Ga0068863_1003621522 115
118 3300005843 Ga0068860_100151149 Ga0068860_1001511494 115
119 3300005844 Ga0068862_100036242 Ga0068862_1000362426 115
120 3300005844 Ga0068862_100146688 Ga0068862_1001466882 115
121 3300006163 Ga0070715_10002815 Ga0070715_100028155 115
122 3300006173 Ga0070716_100632501 Ga0070716_1006325012 115
123 3300006175 Ga0070712_100585974 Ga0070712_1005859742 115
124 3300006358 Ga0068871_100445513 Ga0068871_1004455132 115
125 3300006844 Ga0075428_100075543 Ga0075428_1000755433 115
126 3300006844 Ga0075428_100325841 Ga0075428_1003258412 115
127 3300006844 Ga0075428_101659480 Ga0075428_1016594801 115
128 3300006846 Ga0075430_100012241 Ga0075430_1000122418 115
129 3300006846 Ga0075430_100310323 Ga0075430_1003103232 115
130 3300006847 Ga0075431_101258158 Ga0075431_1012581582 115
131 3300006852 Ga0075433_10002030 Ga0075433_100020304 115
132 3300006852 Ga0075433_10117491 Ga0075433_101174913 115
133 3300006852 Ga0075433_10817238 Ga0075433_108172382 115
134 3300006852 Ga0075433_10979115 Ga0075433_109791151 115
135 3300006871 Ga0075434_100000204 Ga0075434_10000020421 115
136 3300006871 Ga0075434_100000459 Ga0075434_10000045926 115
137 3300006871 Ga0075434_100008705 Ga0075434_10000870512 115
138 3300006871 Ga0075434_100573278 Ga0075434_1005732781 115
139 3300006871 Ga0075434_101317507 Ga0075434_1013175072 115
140 3300006871 Ga0075434_101605435 Ga0075434_1016054352 115
141 3300006880 Ga0075429_100198740 Ga0075429_1001987403 115
142 3300006881 Ga0068865_100038784 Ga0068865_1000387843 115
143 3300006914 Ga0075436_100000422 Ga0075436_10000042212 115
144 3300006914 Ga0075436_100002022 Ga0075436_1000020228 115
145 3300006914 Ga0075436_100016016 Ga0075436_1000160166 115
146 3300006914 Ga0075436_100136738 Ga0075436_1001367383 115
147 3300006931 Ga0097620_100214716 Ga0097620_1002147162 115
148 3300006931 Ga0097620_100496577 Ga0097620_1004965772 115
149 3300006931 Ga0097620_101721114 Ga0097620_1017211142 115
150 3300007076 Ga0075435_100002321 Ga0075435_10000232113 115
151 3300007076 Ga0075435_100009283 Ga0075435_1000092832 115
152 3300007076 Ga0075435_100013170 Ga0075435_1000131702 115
153 3300007076 Ga0075435_100036719 Ga0075435_1000367195 115
154 3300007076 Ga0075435_100074762 Ga0075435_1000747623 115
155 3300007265 Ga0099794_10119782 Ga0099794_101197823 115
156 3300009094 Ga0111539_10017399 Ga0111539_100173998 115
157 3300009094 Ga0111539_10056671 Ga0111539_100566716 115
158 3300009094 Ga0111539_10068781 Ga0111539_100687812 115
159 3300009094 Ga0111539_10139311 Ga0111539_101393114 115
160 3300009094 Ga0111539_10748710 Ga0111539_107487102 115
161 3300009147 Ga0114129_10648507 Ga0114129_106485073 115
162 3300009148 Ga0105243_10038134 Ga0105243_100381343 115
163 3300009148 Ga0105243_10724914 Ga0105243_107249142 115
164 3300009176 Ga0105242_10619035 Ga0105242_106190352 115
165 3300009553 Ga0105249_10045458 Ga0105249_100454583 115
166 3300009553 Ga0105249_11547422 Ga0105249_115474222 115
167 3300012506 Ga0157324_1023302 Ga0157324_10233021 115
168 3300014326 Ga0157380_10114893 Ga0157380_101148932 115
169 3300014969 Ga0157376_10924331 Ga0157376_109243312 115
170 3300025885 Ga0207653_10088106 Ga0207653_100881062 115
171 3300025899 Ga0207642_10013483 Ga0207642_100134834 115
172 3300025907 Ga0207645_10088150 Ga0207645_100881502 115
173 3300025908 Ga0207643_10398426 Ga0207643_103984262 115
174 3300025910 Ga0207684_10197025 Ga0207684_101970252 115
175 3300025912 Ga0207707_10487040 Ga0207707_104870402 115
176 3300025915 Ga0207693_11040787 Ga0207693_110407872 115
177 3300025916 Ga0207663_10201571 Ga0207663_102015712 115
178 3300025917 Ga0207660_10115641 Ga0207660_101156412 115
179 3300025917 Ga0207660_10337881 Ga0207660_103378812 115
180 3300025917 Ga0207660_10525549 Ga0207660_105255492 115
181 3300025918 Ga0207662_10245235 Ga0207662_102452353 115
182 3300025918 Ga0207662_10484363 Ga0207662_104843632 115
183 3300025922 Ga0207646_10263469 Ga0207646_102634692 115
184 3300025922 Ga0207646_11615303 Ga0207646_116153031 115
185 3300025923 Ga0207681_10004257 Ga0207681_100042573 115
186 3300025923 Ga0207681_10273354 Ga0207681_102733542 115
187 3300025926 Ga0207659_10183341 Ga0207659_101833413 115
188 3300025933 Ga0207706_10485369 Ga0207706_104853692 115
189 3300025934 Ga0207686_10337438 Ga0207686_103374382 115
190 3300025935 Ga0207709_10003295 Ga0207709_100032953 115
191 3300025936 Ga0207670_10034262 Ga0207670_100342624 115
192 3300025936 Ga0207670_10421944 Ga0207670_104219442 115
193 3300025938 Ga0207704_10069943 Ga0207704_100699432 115
194 3300025939 Ga0207665_10170397 Ga0207665_101703973 115
195 3300025940 Ga0207691_10061833 Ga0207691_100618334 115
196 3300025942 Ga0207689_10047546 Ga0207689_100475463 115
197 3300025960 Ga0207651_10271031 Ga0207651_102710312 115
198 3300025961 Ga0207712_10052869 Ga0207712_100528693 115
199 3300025961 Ga0207712_10523186 Ga0207712_105231862 115
200 3300025972 Ga0207668_10001354 Ga0207668_100013547 115
201 3300025981 Ga0207640_10607090 Ga0207640_106070902 115
202 3300026023 Ga0207677_10312050 Ga0207677_103120502 115
203 3300026035 Ga0207703_11117848 Ga0207703_111178482 115
204 3300026075 Ga0207708_10009983 Ga0207708_100099837 115
205 3300026075 Ga0207708_10082939 Ga0207708_100829394 115
206 3300026075 Ga0207708_10425801 Ga0207708_104258012 115
207 3300026078 Ga0207702_10132473 Ga0207702_101324733 115
208 3300026078 Ga0207702_10258395 Ga0207702_102583952 115
209 3300026089 Ga0207648_10000711 Ga0207648_1000071112 115
210 3300026116 Ga0207674_11099465 Ga0207674_110994652 115
211 3300026118 Ga0207675_101269004 Ga0207675_1012690042 115
212 3300027364 Ga0209967_1005168 Ga0209967_10051682 115
213 3300027364 Ga0209967_1071095 Ga0209967_10710951 115
214 3300027378 Ga0209981_1032005 Ga0209981_10320052 115
215 3300027395 Ga0209996_1013025 Ga0209996_10130252 115
216 3300027462 Ga0210000_1008066 Ga0210000_10080663 115
217 3300027471 Ga0209995_1016723 Ga0209995_10167232 115
218 3300027543 Ga0209999_1003976 Ga0209999_10039763 115
219 3300027682 Ga0209971_1059215 Ga0209971_10592152 115
220 3300027876 Ga0209974_10371935 Ga0209974_103719352 115
221 3300027907 Ga0207428_10016796 Ga0207428_100167966 115
222 3300027907 Ga0207428_10062873 Ga0207428_100628733 115
223 3300027907 Ga0207428_10092334 Ga0207428_100923342 115
224 3300028380 Ga0268265_10000628 Ga0268265_1000062810 115
225 3300028380 Ga0268265_10120765 Ga0268265_101207652 115
226 3300028381 Ga0268264_10865876 Ga0268264_108658762 115
227 3300031548 Ga0307408_100276877 Ga0307408_1002768772 115
228 3300031548 Ga0307408_100498646 Ga0307408_1004986462 115
229 3300031731 Ga0307405_10520594 Ga0307405_105205942 115
230 3300031824 Ga0307413_10091278 Ga0307413_100912783 115
231 3300031824 Ga0307413_10332341 Ga0307413_103323412 115
232 3300031852 Ga0307410_10234119 Ga0307410_102341192 115
233 3300031852 Ga0307410_11512938 Ga0307410_115129382 115
234 3300031901 Ga0307406_10342340 Ga0307406_103423401 115
235 3300031901 Ga0307406_10350147 Ga0307406_103501472 115
236 3300031903 Ga0307407_10146250 Ga0307407_101462503 115
237 3300031903 Ga0307407_10271903 Ga0307407_102719033 115
238 3300031911 Ga0307412_10389042 Ga0307412_103890422 115
239 3300031995 Ga0307409_100281309 Ga0307409_1002813092 115
240 3300031995 Ga0307409_101475582 Ga0307409_1014755822 115
241 3300031995 Ga0307409_102516332 Ga0307409_1025163322 115
242 3300032002 Ga0307416_100016954 Ga0307416_1000169542 115
243 3300032002 Ga0307416_100834224 Ga0307416_1008342242 115
244 3300032002 Ga0307416_101296979 Ga0307416_1012969791 115
245 3300032002 Ga0307416_103016768 Ga0307416_1030167681 115
246 3300032002 Ga0307416_103304538 Ga0307416_1033045382 115
247 3300032004 Ga0307414_10009778 Ga0307414_100097784 115
248 3300032005 Ga0307411_10022177 Ga0307411_100221774 115
249 3300032005 Ga0307411_10068479 Ga0307411_100684792 115
250 3300032126 Ga0307415_101015279 Ga0307415_1010152792 115
251 3300034818 Ga0373950_0064126 Ga0373950_0064126_382_729 115
252 3300035088 Ga0373940_0083047 Ga0373940_0083047_532_879 115
253 3300035114 Ga0373939_0034505 Ga0373939_0034505_118_465 115
254 3300035118 Ga0373954_0000001 Ga0373954_0000001_3263_3616 115
255 3300035172 Ga0373955_0135735 Ga0373955_0135735_991_1344 115
256 3300035172 Ga0373955_0255378 Ga0373955_0255378_600_947 115
257 3300035207 Ga0373942_0006906 Ga0373942_0006906_770_1120 115
258 3300035241 Ga0373961_0365520 Ga0373961_0365520_83_442 115
259 3300035242 Ga0373962_0080713 Ga0373962_0080713_443_802 115
260 3300035724 Ga0373933_0016956 Ga0373933_0016956_439_792 115
261 3300036401 Ga0373937_0001626 Ga0373937_0001626_6802_7155 115
262 3300036401 Ga0373937_0125828 Ga0373937_0125828_120_479 115
263 3300041404 Ga0439436_0081232 Ga0439436_0081232_156_503 115
264 3300041486 Ga0451807_2115134 Ga0451807_2115134_147_494 115
265 3300041496 Ga0451839_0204151 Ga0451839_0204151_30_377 115
266 3300042000 Ga0439437_043146 Ga0439437_043146_205_552 115
267 3300042001 Ga0439441_001496 Ga0439441_001496_2655_3002 115
268 3300042009 Ga0439451_034328 Ga0439451_034328_596_943 115
269 3300042117 Ga0450913_008891 Ga0450913_008891_300_653 115
270 3300042120 Ga0450917_002893 Ga0450917_002893_752_1099 115
271 3300042126 Ga0450888_045804 Ga0450888_045804_19_366 115
272 3300042137 Ga0450902_056201 Ga0450902_056201_78_431 115
273 3300042436 Ga0439435_0000410 Ga0439435_0000410_1432_1779 115
274 3300042437 Ga0439444_0003661 Ga0439444_0003661_1533_1880 115
275 3300042876 Ga0451577_0006728 Ga0451577_0006728_10979_11341 115
276 3300042876 Ga0451577_0189892 Ga0451577_0189892_1261_1623 115
277 3300042876 Ga0451577_0634336 Ga0451577_0634336_200_562 115
278 3300044712 Ga0453684_0002679 Ga0453684_0002679_20137_20496 115
279 3300044712 Ga0453684_0418773 Ga0453684_0418773_513_866 115
280 3300045051 Ga0451576_0000166 Ga0451576_0000166_58564_58926 115
281 3300045051 Ga0451576_0002813 Ga0451576_0002813_12334_12696 115
282 3300045051 Ga0451576_0005086 Ga0451576_0005086_12505_12855 115
283 3300045051 Ga0451576_0008685 Ga0451576_0008685_3176_3535 115
284 3300045051 Ga0451576_0074373 Ga0451576_0074373_712_1059 115
285 3300045051 Ga0451576_0280442 Ga0451576_0280442_580_942 115
286 3300045051 Ga0451576_1151716 Ga0451576_1151716_15_377 115
287 3300046462 Ga0495651_0454601 Ga0495651_0454601_385_744 115
288 3300046491 Ga0495584_0110777 Ga0495584_0110777_234_584 115
289 3300046491 Ga0495584_0648459 Ga0495584_0648459_19_366 115
290 3300046501 Ga0495607_0386767 Ga0495607_0386767_216_563 115
291 3300046523 Ga0495644_0246163 Ga0495644_0246163_238_588 115
292 3300046528 Ga0495642_0080376 Ga0495642_0080376_927_1277 115
293 3300046529 Ga0495652_0276726 Ga0495652_0276726_70_417 115
294 3300046537 Ga0495598_0230608 Ga0495598_0230608_290_637 115
295 3300046537 Ga0495598_0242539 Ga0495598_0242539_236_586 115
296 3300046538 Ga0495609_0213726 Ga0495609_0213726_341_688 115
297 3300046539 Ga0495621_0005546 Ga0495621_0005546_2779_3126 115
298 3300046615 Ga0495656_0183684 Ga0495656_0183684_236_586 115
299 3300046664 Ga0495659_0059445 Ga0495659_0059445_614_964 115
300 3300046684 Ga0495669_0251530 Ga0495669_0251530_487_834 115
301 3300046684 Ga0495669_0500577 Ga0495669_0500577_126_476 115
302 3300046691 Ga0495670_0409181 Ga0495670_0409181_190_537 115
303 3300046692 Ga0495671_0504197 Ga0495671_0504197_79_429 115
304 3300046809 Ga0495600_0328494 Ga0495600_0328494_544_891 115
305 3300047317 Ga0495604_0119453 Ga0495604_0119453_450_797 115
306 3300047445 Ga0495677_0048516 Ga0495677_0048516_1105_1452 115
307 3300049522 Ga0501299_165015 Ga0501299_165015_94_447 115
308 3300049576 Ga0501040_0598169 Ga0501040_0598169_402_755 115
309 3300049578 Ga0501042_0388408 Ga0501042_0388408_279_626 115
310 3300049578 Ga0501042_0415144 Ga0501042_0415144_81_428 115
311 3300049578 Ga0501042_0610719 Ga0501042_0610719_415_768 115
312 3300049582 Ga0501048_0565948 Ga0501048_0565948_47_400 115
313 3300049582 Ga0501048_0897612 Ga0501048_0897612_182_529 115
314 3300049583 Ga0501067_0589169 Ga0501067_0589169_78_425 115
315 3300049587 Ga0501071_0347610 Ga0501071_0347610_410_763 115
316 3300049588 Ga0501072_0652507 Ga0501072_0652507_309_656 115
317 3300049588 Ga0501072_0777491 Ga0501072_0777491_289_636 115
318 3300049589 Ga0501073_0292257 Ga0501073_0292257_66_413 115
319 3300049590 Ga0501074_0192517 Ga0501074_0192517_245_592 115
320 3300049591 Ga0501075_0650893 Ga0501075_0650893_375_722 115
321 3300049592 Ga0501076_0349928 Ga0501076_0349928_489_836 115
322 3300049592 Ga0501076_0643129 Ga0501076_0643129_10_363 115
323 3300049652 Ga0501202_088053 Ga0501202_088053_59_412 115
324 3300049668 Ga0501233_220256 Ga0501233_220256_40_387 115
325 3300049705 Ga0501225_0302165 Ga0501225_0302165_82_429 115
326 3300049741 Ga0501079_0040198 Ga0501079_0040198_1378_1725 115
327 3300049742 Ga0501080_0408856 Ga0501080_0408856_752_1099 115
328 3300049743 Ga0501081_0120766 Ga0501081_0120766_68_415 115
329 3300049743 Ga0501081_0385039 Ga0501081_0385039_579_932 115
330 3300050507 nmdc:mga05p37_387843_c1 nmdc:mga05p37_387843_c1_929_1276 115
331 3300050509 nmdc:mga0qj67_29058_c1 nmdc:mga0qj67_29058_c1_1886_2233 115
332 3300050509 nmdc:mga0qj67_551394_c1 nmdc:mga0qj67_551394_c1_316_666 115
333 3300050510 nmdc:mga06r32_1267736_c1 nmdc:mga06r32_1267736_c1_96_443 115
334 3300050510 nmdc:mga06r32_417686_c2 nmdc:mga06r32_417686_c2_428_775 115
335 3300050510 nmdc:mga06r32_740478_c1 nmdc:mga06r32_740478_c1_538_885 115
336 3300050511 nmdc:mga08y16_1106857_c1 nmdc:mga08y16_1106857_c1_229_576 115
337 3300050511 nmdc:mga08y16_198922_c1 nmdc:mga08y16_198922_c1_1564_1911 115
338 3300050511 nmdc:mga08y16_233384_c1 nmdc:mga08y16_233384_c1_479_826 115
339 3300050511 nmdc:mga08y16_281110_c1 nmdc:mga08y16_281110_c1_823_1170 115
340 3300050511 nmdc:mga08y16_36452_c1 nmdc:mga08y16_36452_c1_2748_3095 115
341 3300050511 nmdc:mga08y16_9904_c2 nmdc:mga08y16_9904_c2_5378_5728 115
342 3300050512 nmdc:mga0n895_1196095_c1 nmdc:mga0n895_1196095_c1_204_563 115
343 3300050512 nmdc:mga0n895_134_c1 nmdc:mga0n895_134_c1_27361_27711 115
344 3300050512 nmdc:mga0n895_1724_c1 nmdc:mga0n895_1724_c1_7262_7609 115
345 3300050512 nmdc:mga0n895_500_c1 nmdc:mga0n895_500_c1_23337_23684 115
346 3300050512 nmdc:mga0n895_652696_c1 nmdc:mga0n895_652696_c1_548_895 115
347 3300050513 nmdc:mga0rr50_291_c1 nmdc:mga0rr50_291_c1_9468_9818 115
348 3300050513 nmdc:mga0rr50_2994_c1 nmdc:mga0rr50_2994_c1_2237_2584 115
349 3300050513 nmdc:mga0rr50_464087_c1 nmdc:mga0rr50_464087_c1_155_502 115
350 3300050513 nmdc:mga0rr50_57042_c1 nmdc:mga0rr50_57042_c1_1138_1485 115
351 3300050513 nmdc:mga0rr50_8865_c1 nmdc:mga0rr50_8865_c1_2130_2477 115
352 3300050514 nmdc:mga08x19_1128_c1 nmdc:mga08x19_1128_c1_7509_7859 115
353 3300050514 nmdc:mga08x19_13319_c1 nmdc:mga08x19_13319_c1_1723_2070 115
354 3300050514 nmdc:mga08x19_5846_c1 nmdc:mga08x19_5846_c1_469_816 115
355 3300050514 nmdc:mga08x19_8388_c1 nmdc:mga08x19_8388_c1_413_760 115
356 3300050515 nmdc:mga0a205_132093_c1 nmdc:mga0a205_132093_c1_1233_1580 115
357 3300050515 nmdc:mga0a205_601_c1 nmdc:mga0a205_601_c1_22351_22701 115
358 3300050515 nmdc:mga0a205_668412_c1 nmdc:mga0a205_668412_c1_23_370 115
359 3300054114 Ga0501084_0026996 Ga0501084_0026996_1801_2148 115
360 3300054114 Ga0501084_0094228 Ga0501084_0094228_1109_1459 115
361 3300059421 Ga0590071_121577 Ga0590071_121577_76_423 115
362 3300059423 Ga0590074_066617 Ga0590074_066617_96_443 115
363 3300059426 Ga0590077_018426 Ga0590077_018426_450_797 115
364 3300060353 Ga0501082_0746169 Ga0501082_0746169_266_619 115
365 3300061734 Ga0530510_0452684 Ga0530510_0452684_581_931 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

10

115

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.6844 5 111
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6826 5 112
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6623 5 112
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.6586 5 111
5gou-assembly1.cif.gz_E structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.6388 1 64
ID Description Score Start End Superfamily
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7228 5 115 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7199 10 114 1.10.3730.20
af_Q20231_29_140_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7161 3 114 1.10.3730.20
af_C6S3G0_14_136_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7156 8 114 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7125 9 115 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3L7XYB8-F1-model_v4 EamA domain-containing protein 0.9393 15 115 GO:0016020
AF-A0A7X6TJ39-F1-model_v4 DMT family protein 0.9286 3 79 GO:0016020
AF-A0A517P949-F1-model_v4 Bacterial Transmembrane Pair family protein 0.9175 3 115 GO:0016020
AF-A0A1G8ZZM0-F1-model_v4 DMT family protein 0.9158 5 115 GO:0016020
AF-A0A2H0CFC1-F1-model_v4 DMT family protein 0.9142 4 115 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.35 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map