F423677

General Info

Members Datasets Scaffolds Average Seq Length
365 219 730 117

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10097308|Ga0157370_100973082
Length 143
Sequence MNLRKRKRGASAEVHTSAMNDIMFSTVANPNVIKLMLPKSSSGKSISKKTIVVSITQDLKYYVDKKEIPVANLSSTLEGYKKMAEELTIVLYVEKTVAIQDVVQVMDTAQKLNMKLVLATAPKGEFAVGSEQCAVDAGLITAN

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
113 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
114 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
115 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
116 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
173 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
181 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
182 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
183 2738541283 Pedobacter sp. OK701 Isolate Unclassified
184 2738541284 Pedobacter sp. YR016 Isolate Unclassified
185 2738541302 Pedobacter sp. CF074 Isolate Unclassified
186 2738543023 Pedobacter sp. OK628 Isolate Unclassified
187 2739367651 Pedobacter sp. OK291 Isolate Unclassified
188 2739367656 Pedobacter sp. CF523 Isolate Unclassified
189 2739367663 Pedobacter sp. YR510 Isolate Unclassified
190 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
191 2818991437 Pedobacter terrae 518 Isolate Unclassified
192 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
193 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
194 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
195 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
196 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
197 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
198 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
199 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
200 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
201 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
202 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
203 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
204 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
205 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
206 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
207 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
208 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
209 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
210 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
211 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
212 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
213 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
214 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
215 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
216 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
217 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
218 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
219 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.22
Metatranscriptomes 1.1
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 0.55
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10097308 3300013104 Bacteria 2760
2 SwRhRL2b_contig_359891 2162886007 Unclassified 1355
3 JGI24740J21852_10080218 3300001979 Bacteria 857
4 JGI24737J22298_10052672 3300001990 Bacteria 1234
5 JGI24735J21928_10016140 3300002067 Bacteria 2322
6 JGI24744J21845_10002464 3300002077 Bacteria 3773
7 JGI25162J39368_1000047 3300002737 Viruses 167507
8 JGI25162J39368_1000183 3300002737 Bacteria 67086
9 JGI25165J46597_1053646 3300003214 Bacteria 516
10 rootH1_10042054 3300003316 Bacteria 7047
11 rootH1_10054159 3300003323 Bacteria 4791
12 rootH1_10149458 3300003323 Bacteria 2037
13 Ga0065714_10002778 3300005288 Bacteria 20250
14 Ga0065714_10009792 3300005288 Bacteria 3475
15 Ga0065714_10064844 3300005288 Bacteria 17133
16 Ga0065714_10107329 3300005288 Bacteria 1534
17 Ga0065714_10123076 3300005288 Bacteria 1325
18 Ga0065714_10173432 3300005288 Bacteria 994
19 Ga0065704_10000572 3300005289 Bacteria 16112
20 Ga0065704_10076831 3300005289 Bacteria 4960
21 Ga0065704_10078663 3300005289 Bacteria 4360
22 Ga0065704_10085649 3300005289 Bacteria 3199
23 Ga0065704_10785441 3300005289 Bacteria 530
24 Ga0070658_10204621 3300005327 Bacteria 1666
25 Ga0070676_10022237 3300005328 Bacteria 3555
26 Ga0070660_100073975 3300005339 Bacteria 2665
27 Ga0070660_100369464 3300005339 Bacteria 1183
28 Ga0070671_100005292 3300005355 Bacteria 10296
29 Ga0070674_100696261 3300005356 Bacteria 868
30 Ga0070673_100234822 3300005364 Bacteria 1592
31 Ga0070688_100321567 3300005365 Bacteria 1124
32 Ga0070659_100000188 3300005366 Bacteria 47486
33 Ga0070659_100053485 3300005366 Bacteria 3178
34 Ga0070659_100054733 3300005366 Bacteria 3143
35 Ga0070711_101121904 3300005439 Bacteria 678
36 Ga0070678_100000566 3300005456 Bacteria 18121
37 Ga0070662_100000054 3300005457 Bacteria 60719
38 Ga0068867_100002713 3300005459 Bacteria 12487
39 Ga0070679_100706021 3300005530 Bacteria 951
40 Ga0070684_100004784 3300005535 Bacteria 10343
41 Ga0068853_101226056 3300005539 Bacteria 725
42 Ga0070672_100018247 3300005543 Bacteria 5067
43 Ga0070665_100000010 3300005548 Bacteria 529545
44 Ga0068855_100000054 3300005563 Bacteria 139322
45 Ga0068855_100000498 3300005563 Bacteria 48519
46 Ga0068855_100171497 3300005563 Bacteria 2457
47 Ga0068855_100360499 3300005563 Bacteria 1600
48 Ga0068857_101097927 3300005577 Bacteria 768
49 Ga0068854_100017464 3300005578 Bacteria 4800
50 Ga0068856_100000023 3300005614 Bacteria 141671
51 Ga0068856_100586726 3300005614 Bacteria 1136
52 Ga0068852_100004334 3300005616 Bacteria 10015
53 Ga0068852_100198159 3300005616 Bacteria 1899
54 Ga0068864_100687840 3300005618 Bacteria 998
55 Ga0068863_101252890 3300005841 Bacteria 748
56 Ga0068858_100247396 3300005842 Bacteria 1693
57 Ga0068858_100297091 3300005842 Bacteria 1540
58 Ga0068858_100603108 3300005842 Bacteria 1065
59 Ga0068860_101387277 3300005843 Bacteria 724
60 Ga0075369_10334731 3300006186 Bacteria 709
61 Ga0075366_10071550 3300006195 Bacteria 2066
62 Ga0097621_100000247 3300006237 Bacteria 36324
63 Ga0075370_10413541 3300006353 Bacteria 810
64 Ga0075370_10728978 3300006353 Bacteria 603
65 Ga0068871_100000893 3300006358 Bacteria 19894
66 Ga0068865_100000076 3300006881 Bacteria 51732
67 Ga0105240_10076325 3300009093 Bacteria 4131
68 Ga0105240_10297105 3300009093 Bacteria 1849
69 Ga0105240_10419004 3300009093 Bacteria 1505
70 Ga0105240_10570564 3300009093 Bacteria 1249
71 Ga0105240_10654096 3300009093 Bacteria 1151
72 Ga0105245_10155935 3300009098 Bacteria 2162
73 Ga0105243_10000003 3300009148 Bacteria 712931
74 Ga0105243_10072394 3300009148 Bacteria 2790
75 Ga0105241_10001338 3300009174 Bacteria 18702
76 Ga0105241_10039579 3300009174 Bacteria 3557
77 Ga0105241_10675680 3300009174 Bacteria 940
78 Ga0105241_11620326 3300009174 Bacteria 626
79 Ga0105242_10009392 3300009176 Bacteria 7504
80 Ga0105242_12432107 3300009176 Bacteria 571
81 Ga0105237_10002957 3300009545 Bacteria 20562
82 Ga0105237_10004826 3300009545 Bacteria 15486
83 Ga0105237_10026331 3300009545 Bacteria 5944
84 Ga0105237_10406252 3300009545 Bacteria 1367
85 Ga0105237_10415344 3300009545 Bacteria 1351
86 Ga0105237_12508061 3300009545 Unclassified 526
87 Ga0105238_10004834 3300009551 Bacteria 13328
88 Ga0105238_10083840 3300009551 Bacteria 3176
89 Ga0105249_11218706 3300009553 Bacteria 824
90 Ga0105239_10000040 3300010375 Bacteria 201445
91 Ga0105239_10000816 3300010375 Bacteria 44236
92 Ga0105239_10003173 3300010375 Bacteria 20361
93 Ga0105239_10031692 3300010375 Bacteria 5810
94 Ga0105239_10440140 3300010375 Bacteria 1478
95 Ga0105239_10450465 3300010375 Bacteria 1460
96 Ga0105246_10096958 3300011119 Bacteria 2138
97 Ga0157373_10000284 3300013100 Bacteria 40521
98 Ga0157373_10001086 3300013100 Bacteria 20964
99 Ga0157373_10003109 3300013100 Bacteria 12543
100 Ga0157373_10017898 3300013100 Bacteria 5159
101 Ga0157373_10050900 3300013100 Bacteria 2950
102 Ga0157373_10308459 3300013100 Bacteria 1124
103 Ga0157371_10000298 3300013102 Bacteria 65719
104 Ga0157371_10002900 3300013102 Bacteria 16037
105 Ga0157371_10002916 3300013102 Bacteria 15984
106 Ga0157371_10004305 3300013102 Bacteria 12488
107 Ga0157371_10017139 3300013102 Bacteria 5387
108 Ga0157370_10006117 3300013104 Bacteria 13356
109 Ga0157370_10011429 3300013104 Bacteria 9284
110 Ga0157370_10022056 3300013104 Bacteria 6340
111 Ga0157370_10024483 3300013104 Bacteria 5979
112 Ga0157370_10096665 3300013104 Bacteria 2771
113 Ga0157370_10253686 3300013104 Bacteria 1627
114 Ga0157370_10526931 3300013104 Bacteria 1084
115 Ga0157370_10547662 3300013104 Bacteria 1061
116 Ga0157370_10854015 3300013104 Bacteria 827
117 Ga0157369_10001614 3300013105 Bacteria 27591
118 Ga0157369_10115682 3300013105 Bacteria 2848
119 Ga0157374_10001476 3300013296 Bacteria 19869
120 Ga0157374_10002139 3300013296 Bacteria 16656
121 Ga0157374_11440780 3300013296 Bacteria 712
122 Ga0157378_10022103 3300013297 Bacteria 5597
123 Ga0163162_10000369 3300013306 Bacteria 40837
124 Ga0163162_10007367 3300013306 Bacteria 10697
125 Ga0163162_10971104 3300013306 Bacteria 960
126 Ga0163162_11161069 3300013306 Bacteria 876
127 Ga0157372_10000026 3300013307 Bacteria 195407
128 Ga0157372_10000071 3300013307 Bacteria 109638
129 Ga0157372_10001528 3300013307 Bacteria 25161
130 Ga0157372_10023226 3300013307 Bacteria 6720
131 Ga0157372_10045758 3300013307 Bacteria 4856
132 Ga0157372_10878220 3300013307 Bacteria 1041
133 Ga0157372_11120923 3300013307 Bacteria 910
134 Ga0157375_10014385 3300013308 Bacteria 7057
135 Ga0157375_10058272 3300013308 Bacteria 3820
136 Ga0182008_10000887 3300014497 Bacteria 20787
137 Ga0182008_10000955 3300014497 Bacteria 20144
138 Ga0182008_10014135 3300014497 Bacteria 4185
139 Ga0182008_10023941 3300014497 Bacteria 3112
140 Ga0157377_10012788 3300014745 Bacteria 4231
141 Ga0157376_10685257 3300014969 Bacteria 1028
142 Ga0182006_1000120 3300015261 Bacteria 84872
143 Ga0182006_1002423 3300015261 Bacteria 10195
144 Ga0182006_1013711 3300015261 Bacteria 3508
145 Ga0182007_10007410 3300015262 Bacteria 4603
146 Ga0182007_10023398 3300015262 Bacteria 2172
147 Ga0182007_10032936 3300015262 Bacteria 1758
148 Ga0163161_10001301 3300017792 Bacteria 18595
149 Ga0163161_10003310 3300017792 Bacteria 11307
150 Ga0163161_10165804 3300017792 Bacteria 1686
151 Ga0163161_11028874 3300017792 Bacteria 704
152 Ga0206351_10389565 3300020077 Bacteria 2016
153 Ga0206351_10854276 3300020077 Bacteria 1276
154 Ga0206352_10714335 3300020078 Bacteria 998
155 Ga0213872_10044609 3300021361 Bacteria 2017
156 Ga0209437_100089 3300025233 Bacteria 250476
157 Ga0209026_1000871 3300025250 Bacteria 15774
158 Ga0209026_1007522 3300025250 Bacteria 2437
159 Ga0209129_1034751 3300025258 Bacteria 824
160 Ga0209233_1001198 3300025261 Bacteria 10459
161 Ga0207642_10958978 3300025899 Bacteria 550
162 Ga0207647_10000046 3300025904 Bacteria 90148
163 Ga0207647_10000154 3300025904 Bacteria 54378
164 Ga0207647_10349621 3300025904 Bacteria 837
165 Ga0207645_10002749 3300025907 Bacteria 13705
166 Ga0207705_10603896 3300025909 Bacteria 853
167 Ga0207654_10002429 3300025911 Bacteria 9511
168 Ga0207654_10088640 3300025911 Bacteria 1881
169 Ga0207654_10735591 3300025911 Bacteria 710
170 Ga0207695_10057854 3300025913 Bacteria 4026
171 Ga0207695_10315188 3300025913 Bacteria 1454
172 Ga0207695_10325405 3300025913 Bacteria 1426
173 Ga0207695_10411913 3300025913 Bacteria 1236
174 Ga0207695_10446506 3300025913 Bacteria 1176
175 Ga0207671_10001544 3300025914 Bacteria 26333
176 Ga0207671_10002724 3300025914 Bacteria 18482
177 Ga0207671_10006180 3300025914 Bacteria 10754
178 Ga0207671_10084684 3300025914 Bacteria 2381
179 Ga0207657_10076882 3300025919 Bacteria 2815
180 Ga0207657_10205105 3300025919 Bacteria 1584
181 Ga0207694_10016160 3300025924 Bacteria 5633
182 Ga0207687_10100515 3300025927 Bacteria 2128
183 Ga0207690_10000293 3300025932 Bacteria 35416
184 Ga0207690_10015214 3300025932 Bacteria 4659
185 Ga0207706_10000669 3300025933 Bacteria 36066
186 Ga0207686_10010643 3300025934 Bacteria 5012
187 Ga0207709_10000008 3300025935 Bacteria 713099
188 Ga0207709_10107112 3300025935 Bacteria 1860
189 Ga0207669_10526582 3300025937 Bacteria 950
190 Ga0207704_10000189 3300025938 Bacteria 32372
191 Ga0207691_10184478 3300025940 Bacteria 1822
192 Ga0207689_10915038 3300025942 Bacteria 740
193 Ga0207667_10000023 3300025949 Bacteria 362527
194 Ga0207667_10001774 3300025949 Bacteria 27165
195 Ga0207667_10142595 3300025949 Bacteria 2467
196 Ga0207667_11187449 3300025949 Bacteria 743
197 Ga0207651_10322548 3300025960 Bacteria 1291
198 Ga0207640_10017829 3300025981 Bacteria 4160
199 Ga0207677_10006981 3300026023 Bacteria 6211
200 Ga0207703_10236908 3300026035 Bacteria 1639
201 Ga0207703_10342684 3300026035 Bacteria 1374
202 Ga0207703_10656831 3300026035 Bacteria 995
203 Ga0207639_10698464 3300026041 Bacteria 941
204 Ga0207678_10013879 3300026067 Bacteria 7078
205 Ga0207702_10000314 3300026078 Bacteria 55437
206 Ga0207702_10775872 3300026078 Bacteria 947
207 Ga0207641_11079372 3300026088 Bacteria 801
208 Ga0207648_10001991 3300026089 Bacteria 22314
209 Ga0207676_10709684 3300026095 Bacteria 975
210 Ga0207674_11055485 3300026116 Bacteria 782
211 Ga0207683_10003548 3300026121 Bacteria 13605
212 Ga0207698_10003020 3300026142 Bacteria 10086
213 Ga0207698_10174082 3300026142 Bacteria 1899
214 Ga0268266_10000032 3300028379 Bacteria 395079
215 Ga0268264_11547518 3300028381 Bacteria 674
216 Ga0307517_10000429 3300028786 Bacteria 72171
217 Ga0265338_10567413 3300028800 Bacteria 793
218 Ga0316177_1080885 3300030731 Bacteria 8701
219 Ga0316176_1109633 3300030732 Bacteria 12836
220 Ga0316178_1165156 3300030735 Bacteria 806
221 Ga0316183_1003610 3300030742 Bacteria 136078
222 Ga0316181_1086706 3300030744 Bacteria 24726
223 Ga0316181_1255294 3300030744 Bacteria 1903
224 Ga0316182_1139787 3300030745 Bacteria 1203
225 Ga0307513_10222514 3300031456 Bacteria 1707
226 Ga0307408_100001086 3300031548 Bacteria 20801
227 Ga0307408_100001939 3300031548 Bacteria 14992
228 Ga0307408_100002564 3300031548 Bacteria 12675
229 Ga0307405_10341164 3300031731 Bacteria 1152
230 Ga0307405_11997512 3300031731 Bacteria 519
231 Ga0307413_10193666 3300031824 Bacteria 1462
232 Ga0307410_11673545 3300031852 Bacteria 563
233 Ga0307412_10000142 3300031911 Bacteria 51770
234 Ga0307412_10002695 3300031911 Bacteria 9861
235 Ga0307414_10000269 3300032004 Bacteria 32505
236 Ga0307414_10000863 3300032004 Bacteria 15478
237 Ga0307414_10010667 3300032004 Bacteria 5347
238 Ga0307414_10024215 3300032004 Unclassified 3867
239 Ga0307414_10047794 3300032004 Bacteria 2948
240 Ga0307414_10060957 3300032004 Bacteria 2670
241 Ga0307414_10090959 3300032004 Unclassified 2266
242 Ga0307414_10157729 3300032004 Bacteria 1799
243 Ga0307414_10208106 3300032004 Bacteria 1597
244 Ga0307414_10311869 3300032004 Bacteria 1335
245 Ga0307414_11527565 3300032004 Bacteria 622
246 Ga0307411_10218425 3300032005 Unclassified 1477
247 Ga0395899_0000055 3300037312 Bacteria 220579
248 Ga0395899_0016579 3300037312 Bacteria 5619
249 Ga0395899_0283565 3300037312 Bacteria 1126
250 Ga0395900_0003186 3300037418 Bacteria 17778
251 Ga0395900_0283676 3300037418 Bacteria 1647
252 Ga0395900_0523960 3300037418 Bacteria 1133
253 Ga0395900_1049931 3300037418 Bacteria 733
254 Ga0395905_0017392 3300037471 Bacteria 6827
255 Ga0395905_0261556 3300037471 Bacteria 1615
256 Ga0436361_1068986 3300039447 Bacteria 20698
257 Ga0451791_0190837 3300041451 Bacteria 685
258 Ga0451807_2426074 3300041486 Bacteria 567
259 Ga0451849_0766882 3300041505 Bacteria 676
260 Ga0439448_0010082 3300042005 Bacteria 2793
261 Ga0466969_0110923 3300044656 Bacteria 1284
262 Ga0466966_0006860 3300044684 Bacteria 7542
263 Ga0466961_0227467 3300044693 Bacteria 1148
264 Ga0466961_0951836 3300044693 Unclassified 511
265 Ga0466959_0225528 3300045049 Bacteria 1298
266 Ga0466958_0408810 3300045836 Bacteria 877
267 Ga0495585_0000173 3300046492 Bacteria 69500
268 Ga0495596_0111321 3300046500 Bacteria 1063
269 Ga0495606_0000008 3300046507 Bacteria 321373
270 Ga0495606_0009278 3300046507 Bacteria 8349
271 Ga0495606_0010713 3300046507 Bacteria 7563
272 Ga0495610_0002038 3300046512 Bacteria 17252
273 Ga0495616_0008951 3300046513 Bacteria 5883
274 Ga0495631_0011880 3300046518 Bacteria 4269
275 Ga0495631_0096576 3300046518 Bacteria 1272
276 Ga0495643_0235702 3300046522 Bacteria 861
277 Ga0495644_0005967 3300046523 Bacteria 4748
278 Ga0495633_0003104 3300046558 Bacteria 11274
279 Ga0495633_0124322 3300046558 Bacteria 1194
280 Ga0495668_0354379 3300046616 Bacteria 805
281 Ga0495625_0000017 3300046660 Bacteria 299728
282 Ga0495625_0004710 3300046660 Bacteria 12772
283 Ga0495625_0203102 3300046660 Bacteria 1307
284 Ga0495625_0268098 3300046660 Bacteria 1103
285 Ga0495625_0896457 3300046660 Bacteria 509
286 Ga0495661_0055661 3300046665 Bacteria 2370
287 Ga0495661_0362144 3300046665 Bacteria 712
288 Ga0495661_0457727 3300046665 Bacteria 613
289 Ga0495670_0279917 3300046691 Bacteria 892
290 Ga0495671_0066361 3300046692 Bacteria 1776
291 Ga0495671_0260089 3300046692 Bacteria 837
292 Ga0495649_0000121 3300046694 Bacteria 68443
293 Ga0495649_0152773 3300046694 Bacteria 1212
294 Ga0495589_0107017 3300046794 Bacteria 1351
295 Ga0495660_0002198 3300046810 Bacteria 12554
296 Ga0495687_004610 3300047443 Bacteria 9209
297 Ga0495687_147853 3300047443 Bacteria 807
298 Ga0495687_205626 3300047443 Bacteria 621
299 Ga0495677_0038259 3300047445 Bacteria 1753
300 Ga0495685_076360 3300047447 Bacteria 1118
301 Ga0495686_0001124 3300047472 Bacteria 31635
302 Ga0495686_0014982 3300047472 Bacteria 5315
303 Ga0496116_0005899 3300048919 Bacteria 11244
304 Ga0496117_0004631 3300048920 Bacteria 14982
305 Ga0496118_0062511 3300048921 Bacteria 2748
306 Ga0496122_0000782 3300048925 Bacteria 61189
307 Ga0496122_0003774 3300048925 Bacteria 19531
308 Ga0496123_0006205 3300048926 Bacteria 11666
309 Ga0496123_0076974 3300048926 Bacteria 2051
310 Ga0496125_0047151 3300048928 Bacteria 3607
311 Ga0496125_0097081 3300048928 Bacteria 2185
312 Ga0496126_0412285 3300048929 Bacteria 1094
313 Ga0495678_047832 3300049459 Bacteria 1672
314 Ga0501335_035450 3300049551 Bacteria 576
315 Ga0501034_0111114 3300049571 Bacteria 2731
316 Ga0501038_1161880 3300049574 Unclassified 562
317 Ga0501223_005645 3300049663 Bacteria 2620
318 Ga0501243_051783 3300049675 Bacteria 743
319 Ga0501241_007712 3300049758 Bacteria 1971
320 nmdc:mga0k408_273320_c1 3300050493 Bacteria 1009
321 nmdc:mga07m45_381952_c1 3300050496 Bacteria 818
322 Ga0500651_0000195 3300053093 Bacteria 38647
323 Ga0500608_116242 3300053122 Bacteria 1219
324 Ga0500618_016206 3300053125 Bacteria 1869
325 Ga0500568_0095099 3300053139 Bacteria 1121
326 Ga0500624_000837 3300053157 Bacteria 6970
327 2586210764 2585427687 Bacteria 5544917
328 2722730556 2721755487 Bacteria 6357185
329 2738759593 2738541283 Bacteria 7222293
330 2738763781 2738541284 Bacteria 5199923
331 2738852363 2738541302 Bacteria 5944758
332 2739304495 2738543023 Bacteria 6767879
333 2739589747 2739367651 Bacteria 6359826
334 2739617944 2739367656 Bacteria 5152243
335 2739644106 2739367663 Bacteria 5040914
336 2776614916 2775506987 Bacteria 5373360
337 2819550343 2818991437 Bacteria 5805520
338 2842722460 2842722452 Bacteria 6263924
339 2842906055 2842903701 Bacteria 6986368
340 2842914619 2842909656 Bacteria 6185908
341 2849286345 2849281842 Bacteria 6065644
342 2852624878 2852623160 Bacteria 4376875
343 2852630035 2852627209 Bacteria 5896285
344 2857632326 2857627736 Bacteria 5625397
345 2884936227 2884933994 Bacteria 4535041
346 2890739554 2890737413 Bacteria 4269751
347 2896112366 2896109856 Bacteria 7140722
348 2896319505 2896317667 Bacteria 4606601
349 2896346088 2896344016 Bacteria 3811746
350 2898714279 2898713307 Bacteria 4110805
351 2902049069 2902048731 Bacteria 4976191
352 2904449788 2904445276 Bacteria 5310396
353 2904785174 2904780799 Bacteria 5840761
354 2919181744 2919177583 Bacteria 5641607
355 2919188323 2919186247 Bacteria 6244071
356 2919442712 2919437846 Bacteria 6199444
357 2928078584 2928078545 Bacteria 6534839
358 2928151739 2928147474 Bacteria 6512076
359 2932084354 2932082852 Bacteria 6563563
360 2939664410 2939664404 Bacteria 6364494
361 2945999410 2945997725 Bacteria 6404843
362 2954016137 2954016120 Bacteria 6446024
363 2977233637 2977232053 Bacteria 5485925
364 3003236216 3003233435 Bacteria 4458031
365 8055588897 8055588893 Bacteria 3619545
366 Ga0157370_10097308
367 SwRhRL2b_contig_359891
368 JGI24740J21852_10080218
369 JGI24737J22298_10052672
370 JGI24735J21928_10016140
371 JGI24744J21845_10002464
372 JGI25162J39368_1000047
373 JGI25162J39368_1000183
374 JGI25165J46597_1053646
375 rootH1_10042054
376 rootH1_10054159
377 rootH1_10149458
378 Ga0065714_10002778
379 Ga0065714_10009792
380 Ga0065714_10064844
381 Ga0065714_10107329
382 Ga0065714_10123076
383 Ga0065714_10173432
384 Ga0065704_10000572
385 Ga0065704_10076831
386 Ga0065704_10078663
387 Ga0065704_10085649
388 Ga0065704_10785441
389 Ga0070658_10204621
390 Ga0070676_10022237
391 Ga0070660_100073975
392 Ga0070660_100369464
393 Ga0070671_100005292
394 Ga0070674_100696261
395 Ga0070673_100234822
396 Ga0070688_100321567
397 Ga0070659_100000188
398 Ga0070659_100053485
399 Ga0070659_100054733
400 Ga0070711_101121904
401 Ga0070678_100000566
402 Ga0070662_100000054
403 Ga0068867_100002713
404 Ga0070679_100706021
405 Ga0070684_100004784
406 Ga0068853_101226056
407 Ga0070672_100018247
408 Ga0070665_100000010
409 Ga0068855_100000054
410 Ga0068855_100000498
411 Ga0068855_100171497
412 Ga0068855_100360499
413 Ga0068857_101097927
414 Ga0068854_100017464
415 Ga0068856_100000023
416 Ga0068856_100586726
417 Ga0068852_100004334
418 Ga0068852_100198159
419 Ga0068864_100687840
420 Ga0068863_101252890
421 Ga0068858_100247396
422 Ga0068858_100297091
423 Ga0068858_100603108
424 Ga0068860_101387277
425 Ga0075369_10334731
426 Ga0075366_10071550
427 Ga0097621_100000247
428 Ga0075370_10413541
429 Ga0075370_10728978
430 Ga0068871_100000893
431 Ga0068865_100000076
432 Ga0105240_10076325
433 Ga0105240_10297105
434 Ga0105240_10419004
435 Ga0105240_10570564
436 Ga0105240_10654096
437 Ga0105245_10155935
438 Ga0105243_10000003
439 Ga0105243_10072394
440 Ga0105241_10001338
441 Ga0105241_10039579
442 Ga0105241_10675680
443 Ga0105241_11620326
444 Ga0105242_10009392
445 Ga0105242_12432107
446 Ga0105237_10002957
447 Ga0105237_10004826
448 Ga0105237_10026331
449 Ga0105237_10406252
450 Ga0105237_10415344
451 Ga0105237_12508061
452 Ga0105238_10004834
453 Ga0105238_10083840
454 Ga0105249_11218706
455 Ga0105239_10000040
456 Ga0105239_10000816
457 Ga0105239_10003173
458 Ga0105239_10031692
459 Ga0105239_10440140
460 Ga0105239_10450465
461 Ga0105246_10096958
462 Ga0157373_10000284
463 Ga0157373_10001086
464 Ga0157373_10003109
465 Ga0157373_10017898
466 Ga0157373_10050900
467 Ga0157373_10308459
468 Ga0157371_10000298
469 Ga0157371_10002900
470 Ga0157371_10002916
471 Ga0157371_10004305
472 Ga0157371_10017139
473 Ga0157370_10006117
474 Ga0157370_10011429
475 Ga0157370_10022056
476 Ga0157370_10024483
477 Ga0157370_10096665
478 Ga0157370_10253686
479 Ga0157370_10526931
480 Ga0157370_10547662
481 Ga0157370_10854015
482 Ga0157369_10001614
483 Ga0157369_10115682
484 Ga0157374_10001476
485 Ga0157374_10002139
486 Ga0157374_11440780
487 Ga0157378_10022103
488 Ga0163162_10000369
489 Ga0163162_10007367
490 Ga0163162_10971104
491 Ga0163162_11161069
492 Ga0157372_10000026
493 Ga0157372_10000071
494 Ga0157372_10001528
495 Ga0157372_10023226
496 Ga0157372_10045758
497 Ga0157372_10878220
498 Ga0157372_11120923
499 Ga0157375_10014385
500 Ga0157375_10058272
501 Ga0182008_10000887
502 Ga0182008_10000955
503 Ga0182008_10014135
504 Ga0182008_10023941
505 Ga0157377_10012788
506 Ga0157376_10685257
507 Ga0182006_1000120
508 Ga0182006_1002423
509 Ga0182006_1013711
510 Ga0182007_10007410
511 Ga0182007_10023398
512 Ga0182007_10032936
513 Ga0163161_10001301
514 Ga0163161_10003310
515 Ga0163161_10165804
516 Ga0163161_11028874
517 Ga0206351_10389565
518 Ga0206351_10854276
519 Ga0206352_10714335
520 Ga0213872_10044609
521 Ga0209437_100089
522 Ga0209026_1000871
523 Ga0209026_1007522
524 Ga0209129_1034751
525 Ga0209233_1001198
526 Ga0207642_10958978
527 Ga0207647_10000046
528 Ga0207647_10000154
529 Ga0207647_10349621
530 Ga0207645_10002749
531 Ga0207705_10603896
532 Ga0207654_10002429
533 Ga0207654_10088640
534 Ga0207654_10735591
535 Ga0207695_10057854
536 Ga0207695_10315188
537 Ga0207695_10325405
538 Ga0207695_10411913
539 Ga0207695_10446506
540 Ga0207671_10001544
541 Ga0207671_10002724
542 Ga0207671_10006180
543 Ga0207671_10084684
544 Ga0207657_10076882
545 Ga0207657_10205105
546 Ga0207694_10016160
547 Ga0207687_10100515
548 Ga0207690_10000293
549 Ga0207690_10015214
550 Ga0207706_10000669
551 Ga0207686_10010643
552 Ga0207709_10000008
553 Ga0207709_10107112
554 Ga0207669_10526582
555 Ga0207704_10000189
556 Ga0207691_10184478
557 Ga0207689_10915038
558 Ga0207667_10000023
559 Ga0207667_10001774
560 Ga0207667_10142595
561 Ga0207667_11187449
562 Ga0207651_10322548
563 Ga0207640_10017829
564 Ga0207677_10006981
565 Ga0207703_10236908
566 Ga0207703_10342684
567 Ga0207703_10656831
568 Ga0207639_10698464
569 Ga0207678_10013879
570 Ga0207702_10000314
571 Ga0207702_10775872
572 Ga0207641_11079372
573 Ga0207648_10001991
574 Ga0207676_10709684
575 Ga0207674_11055485
576 Ga0207683_10003548
577 Ga0207698_10003020
578 Ga0207698_10174082
579 Ga0268266_10000032
580 Ga0268264_11547518
581 Ga0307517_10000429
582 Ga0265338_10567413
583 Ga0316177_1080885
584 Ga0316176_1109633
585 Ga0316178_1165156
586 Ga0316183_1003610
587 Ga0316181_1086706
588 Ga0316181_1255294
589 Ga0316182_1139787
590 Ga0307513_10222514
591 Ga0307408_100001086
592 Ga0307408_100001939
593 Ga0307408_100002564
594 Ga0307405_10341164
595 Ga0307405_11997512
596 Ga0307413_10193666
597 Ga0307410_11673545
598 Ga0307412_10000142
599 Ga0307412_10002695
600 Ga0307414_10000269
601 Ga0307414_10000863
602 Ga0307414_10010667
603 Ga0307414_10024215
604 Ga0307414_10047794
605 Ga0307414_10060957
606 Ga0307414_10090959
607 Ga0307414_10157729
608 Ga0307414_10208106
609 Ga0307414_10311869
610 Ga0307414_11527565
611 Ga0307411_10218425
612 Ga0395899_0000055
613 Ga0395899_0016579
614 Ga0395899_0283565
615 Ga0395900_0003186
616 Ga0395900_0283676
617 Ga0395900_0523960
618 Ga0395900_1049931
619 Ga0395905_0017392
620 Ga0395905_0261556
621 Ga0436361_1068986
622 Ga0451791_0190837
623 Ga0451807_2426074
624 Ga0451849_0766882
625 Ga0439448_0010082
626 Ga0466969_0110923
627 Ga0466966_0006860
628 Ga0466961_0227467
629 Ga0466961_0951836
630 Ga0466959_0225528
631 Ga0466958_0408810
632 Ga0495585_0000173
633 Ga0495596_0111321
634 Ga0495606_0000008
635 Ga0495606_0009278
636 Ga0495606_0010713
637 Ga0495610_0002038
638 Ga0495616_0008951
639 Ga0495631_0011880
640 Ga0495631_0096576
641 Ga0495643_0235702
642 Ga0495644_0005967
643 Ga0495633_0003104
644 Ga0495633_0124322
645 Ga0495668_0354379
646 Ga0495625_0000017
647 Ga0495625_0004710
648 Ga0495625_0203102
649 Ga0495625_0268098
650 Ga0495625_0896457
651 Ga0495661_0055661
652 Ga0495661_0362144
653 Ga0495661_0457727
654 Ga0495670_0279917
655 Ga0495671_0066361
656 Ga0495671_0260089
657 Ga0495649_0000121
658 Ga0495649_0152773
659 Ga0495589_0107017
660 Ga0495660_0002198
661 Ga0495687_004610
662 Ga0495687_147853
663 Ga0495687_205626
664 Ga0495677_0038259
665 Ga0495685_076360
666 Ga0495686_0001124
667 Ga0495686_0014982
668 Ga0496116_0005899
669 Ga0496117_0004631
670 Ga0496118_0062511
671 Ga0496122_0000782
672 Ga0496122_0003774
673 Ga0496123_0006205
674 Ga0496123_0076974
675 Ga0496125_0047151
676 Ga0496125_0097081
677 Ga0496126_0412285
678 Ga0495678_047832
679 Ga0501335_035450
680 Ga0501034_0111114
681 Ga0501038_1161880
682 Ga0501223_005645
683 Ga0501243_051783
684 Ga0501241_007712
685 nmdc:mga0k408_273320_c1
686 nmdc:mga07m45_381952_c1
687 Ga0500651_0000195
688 Ga0500608_116242
689 Ga0500618_016206
690 Ga0500568_0095099
691 Ga0500624_000837
692 2586210764
693 2722730556
694 2738759593
695 2738763781
696 2738852363
697 2739304495
698 2739589747
699 2739617944
700 2739644106
701 2776614916
702 2819550343
703 2842722460
704 2842906055
705 2842914619
706 2849286345
707 2852624878
708 2852630035
709 2857632326
710 2884936227
711 2890739554
712 2896112366
713 2896319505
714 2896346088
715 2898714279
716 2902049069
717 2904449788
718 2904785174
719 2919181744
720 2919188323
721 2919442712
722 2928078584
723 2928151739
724 2932084354
725 2939664410
726 2945999410
727 2954016137
728 2977233637
729 3003236216
730 8055588897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

8

123

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8605 51 121
6b2o-assembly1.cif.gz_F lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, c176a variant 0.8491 89 122
6b2o-assembly1.cif.gz_C lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, c176a variant 0.8417 89 122
6utr-assembly1.cif.gz_C lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with copper 0.834 89 122
6utr-assembly1.cif.gz_A lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with copper 0.8328 89 122
ID Description Score Start End Superfamily
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8048 72 124 3.40.50.2300
5iz4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7998 88 124 3.40.50.720
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.763 52 120 3.30.420.270
af_Q58422_5_263_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7554 86 122 3.40.50.620
2jnwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7545 73 123 3.40.50.10130
ID Description Score Start End GO Terms
AF-A0A2V7QGT6-F1-model_v4 Biopolymer transporter ExbD 0.8958 50 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A7C4PQF0-F1-model_v4 Biopolymer transporter ExbD 0.873 48 122 GO:0005886
GO:0015031
GO:0022857
AF-A0A6N4T904-F1-model_v4 Uncharacterized protein 0.8671 49 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A382I492-F1-model_v4 STAS domain-containing protein 0.8641 52 126 GO:0005886
GO:0022857
AF-A0A7W7ZKB7-F1-model_v4 Biopolymer transport protein ExbD 0.8417 51 122

Map