F423558

General Info

Members Datasets Scaffolds Average Seq Length
365 208 730 250

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100005103|Ga0070680_1000051036
Length 248
Sequence MSRLKDKVAVVTGASKGIGASIAKALASEGASVVVNYSSARSDADKVVTQIRNQGGKAIALQADVSKASDVQRLFEETKKAFGKIDVLVNNAGVYEFAPIGDFTEEQFRRMFDTNVLGVLLASREASKYFGEGGAIINIGSVVTQLTPPASAVYAGTKAAVDAITRVLAKELGPKRIRVNSINPGMVETEGVHAAGIIGSDFQKQAEAQTPLGRIGQPEDIAPLAVFLASQDSGWLTGELVTAAGGMR

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
208 2842694124 Methylopila sp. R-72369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.27
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0
Rhizoplane 1.37
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100005103 3300005336 Bacteria 9912
2 JGI25153J46596_10000579 3300003215 Bacteria 22505
3 Ga0065715_10003083 3300005293 Bacteria 10232
4 Ga0065707_10322098 3300005295 Bacteria 964
5 Ga0070690_100072156 3300005330 Bacteria 2244
6 Ga0070690_100091273 3300005330 Bacteria 2006
7 Ga0070690_100463531 3300005330 Bacteria 942
8 Ga0070670_100023501 3300005331 Bacteria 5306
9 Ga0070677_10263039 3300005333 Bacteria 862
10 Ga0068869_100009361 3300005334 Bacteria 6356
11 Ga0070666_10001793 3300005335 Bacteria 13078
12 Ga0070666_10251388 3300005335 Bacteria 1252
13 Ga0070680_100348454 3300005336 Bacteria 1259
14 Ga0068868_100000185 3300005338 Bacteria 41542
15 Ga0068868_100013533 3300005338 Bacteria 5984
16 Ga0070689_100009352 3300005340 Bacteria 6945
17 Ga0070689_100088236 3300005340 Bacteria 2441
18 Ga0070689_100111373 3300005340 Bacteria 2177
19 Ga0070689_100290164 3300005340 Bacteria 1359
20 Ga0070675_100000473 3300005354 Bacteria 27518
21 Ga0070675_100160712 3300005354 Bacteria 1932
22 Ga0070675_100529777 3300005354 Bacteria 1064
23 Ga0070671_100029543 3300005355 Bacteria 4519
24 Ga0070671_100050454 3300005355 Bacteria 3461
25 Ga0070673_100043693 3300005364 Bacteria 3464
26 Ga0070673_100384051 3300005364 Bacteria 1253
27 Ga0070667_100335901 3300005367 Bacteria 1366
28 Ga0070709_10103173 3300005434 Bacteria 1903
29 Ga0070714_100017647 3300005435 Bacteria 5785
30 Ga0070714_100269167 3300005435 Bacteria 1579
31 Ga0070713_100000020 3300005436 Bacteria 108930
32 Ga0070701_10006077 3300005438 Bacteria 5050
33 Ga0070701_10065654 3300005438 Bacteria 1926
34 Ga0070701_10406114 3300005438 Bacteria 864
35 Ga0070700_100385748 3300005441 Unclassified 1049
36 Ga0070708_100015461 3300005445 Bacteria 6305
37 Ga0070708_100238096 3300005445 Bacteria 1709
38 Ga0070708_100311556 3300005445 Bacteria 1482
39 Ga0070708_100326903 3300005445 Bacteria 1445
40 Ga0070678_100004920 3300005456 Bacteria 7641
41 Ga0070678_100007438 3300005456 Bacteria 6499
42 Ga0070662_100040690 3300005457 Bacteria 3310
43 Ga0068867_100090420 3300005459 Unclassified 2322
44 Ga0068867_100189199 3300005459 Bacteria 1641
45 Ga0070685_10155913 3300005466 Bacteria 1451
46 Ga0070706_100043884 3300005467 Bacteria 4130
47 Ga0070706_100056871 3300005467 Bacteria 3609
48 Ga0070706_100077939 3300005467 Bacteria 3068
49 Ga0070706_100290046 3300005467 Bacteria 1527
50 Ga0070707_100001097 3300005468 Bacteria 26721
51 Ga0070707_100206725 3300005468 Bacteria 1913
52 Ga0070707_100846723 3300005468 Bacteria 879
53 Ga0070698_100030117 3300005471 Bacteria 5630
54 Ga0070698_100269617 3300005471 Bacteria 1634
55 Ga0070698_100804357 3300005471 Bacteria 884
56 Ga0070699_100000952 3300005518 Bacteria 26967
57 Ga0070699_100012437 3300005518 Bacteria 7344
58 Ga0070699_100189712 3300005518 Bacteria 1825
59 Ga0070699_100225251 3300005518 Bacteria 1672
60 Ga0070679_100475221 3300005530 Bacteria 1194
61 Ga0070679_100614688 3300005530 Bacteria 1030
62 Ga0070697_100088653 3300005536 Bacteria 2555
63 Ga0070697_100181214 3300005536 Bacteria 1785
64 Ga0070696_100086578 3300005546 Bacteria 2225
65 Ga0070665_100168121 3300005548 Bacteria 2195
66 Ga0070704_100126523 3300005549 Bacteria 1973
67 Ga0068857_100487448 3300005577 Bacteria 1156
68 Ga0068856_100725310 3300005614 Bacteria 1014
69 Ga0068852_100569246 3300005616 Bacteria 1135
70 Ga0068859_100001283 3300005617 Bacteria 25657
71 Ga0068859_100002872 3300005617 Bacteria 17487
72 Ga0068859_100053951 3300005617 Bacteria 4042
73 Ga0068859_100346217 3300005617 Bacteria 1581
74 Ga0068864_100001050 3300005618 Bacteria 23192
75 Ga0068864_100006289 3300005618 Bacteria 9741
76 Ga0068864_100016258 3300005618 Bacteria 6193
77 Ga0068861_100059735 3300005719 Bacteria 2920
78 Ga0068861_100180506 3300005719 Bacteria 1757
79 Ga0068851_10096127 3300005834 Bacteria 1566
80 Ga0068870_10039543 3300005840 Bacteria 2441
81 Ga0068870_10223881 3300005840 Bacteria 1153
82 Ga0068863_100004913 3300005841 Bacteria 13173
83 Ga0068858_100000885 3300005842 Bacteria 31082
84 Ga0068858_100082292 3300005842 Bacteria 2992
85 Ga0068858_100085719 3300005842 Bacteria 2931
86 Ga0068860_100035440 3300005843 Bacteria 4786
87 Ga0068860_100057107 3300005843 Bacteria 3710
88 Ga0068860_100109826 3300005843 Bacteria 2636
89 Ga0068862_100032108 3300005844 Bacteria 4435
90 Ga0070716_100049798 3300006173 Bacteria 2375
91 Ga0075362_10178612 3300006177 Bacteria 1028
92 Ga0097621_100054390 3300006237 Bacteria 3264
93 Ga0097621_100117828 3300006237 Bacteria 2250
94 Ga0097621_100237790 3300006237 Bacteria 1591
95 Ga0068871_100016654 3300006358 Bacteria 5545
96 Ga0075430_100309610 3300006846 Bacteria 1306
97 Ga0075431_100044886 3300006847 Bacteria 4558
98 Ga0075431_100422508 3300006847 Bacteria 1332
99 Ga0075433_10000475 3300006852 Bacteria 26124
100 Ga0075433_10231296 3300006852 Bacteria 1642
101 Ga0075434_100001631 3300006871 Bacteria 19094
102 Ga0075434_100015814 3300006871 Bacteria 7244
103 Ga0068865_100119408 3300006881 Bacteria 1958
104 Ga0075436_100015719 3300006914 Bacteria 5182
105 Ga0075436_100079282 3300006914 Bacteria 2275
106 Ga0097620_100001283 3300006931 Bacteria 25657
107 Ga0097620_100002873 3300006931 Bacteria 17487
108 Ga0097620_100053951 3300006931 Bacteria 4042
109 Ga0097620_100346221 3300006931 Bacteria 1581
110 Ga0075435_100032751 3300007076 Bacteria 4106
111 Ga0075435_100037763 3300007076 Bacteria 3848
112 Ga0099795_10004788 3300007788 Bacteria 3531
113 Ga0111539_10737435 3300009094 Bacteria 1147
114 Ga0105245_10216731 3300009098 Bacteria 1845
115 Ga0105245_10658924 3300009098 Bacteria 1077
116 Ga0105247_10001650 3300009101 Bacteria 15779
117 Ga0114129_10017153 3300009147 Bacteria 10312
118 Ga0114129_10243932 3300009147 Unclassified 2414
119 Ga0114129_10518131 3300009147 Unclassified 1555
120 Ga0105242_10029043 3300009176 Bacteria 4407
121 Ga0105248_10019050 3300009177 Bacteria 7588
122 Ga0105248_10029339 3300009177 Bacteria 6137
123 Ga0105248_10779353 3300009177 Bacteria 1079
124 Ga0105237_10496450 3300009545 Bacteria 1227
125 Ga0105249_10156342 3300009553 Bacteria 2199
126 Ga0105249_10332354 3300009553 Bacteria 1534
127 Ga0157370_10014852 3300013104 Bacteria 7946
128 Ga0157369_10036365 3300013105 Bacteria 5396
129 Ga0157374_10001295 3300013296 Bacteria 21281
130 Ga0157374_10021504 3300013296 Bacteria 5742
131 Ga0157378_10015680 3300013297 Bacteria 6636
132 Ga0157378_10091736 3300013297 Bacteria 2763
133 Ga0163162_10010058 3300013306 Bacteria 9198
134 Ga0163162_10148283 3300013306 Bacteria 2463
135 Ga0163162_10187241 3300013306 Bacteria 2197
136 Ga0163162_10777486 3300013306 Bacteria 1076
137 Ga0163162_11079225 3300013306 Bacteria 909
138 Ga0157372_10089369 3300013307 Unclassified 3500
139 Ga0157372_10248350 3300013307 Bacteria 2065
140 Ga0157375_10023946 3300013308 Bacteria 5642
141 Ga0157375_10079612 3300013308 Bacteria 3313
142 Ga0157375_10508684 3300013308 Bacteria 1368
143 Ga0157375_10719305 3300013308 Bacteria 1151
144 Ga0157375_11129729 3300013308 Bacteria 918
145 Ga0163163_10008307 3300014325 Bacteria 9215
146 Ga0163163_10362153 3300014325 Bacteria 1507
147 Ga0157380_10057090 3300014326 Bacteria 3107
148 Ga0157380_10255458 3300014326 Bacteria 1589
149 Ga0157377_10027378 3300014745 Bacteria 3060
150 Ga0157379_10002653 3300014968 Bacteria 15057
151 Ga0157376_10551186 3300014969 Bacteria 1141
152 Ga0224712_10144392 3300022467 Bacteria 1050
153 Ga0209758_1000523 3300025297 Bacteria 61460
154 Ga0207426_1029413 3300025302 Bacteria 1812
155 Ga0207697_10018027 3300025315 Bacteria 2898
156 Ga0207710_10000394 3300025900 Bacteria 29448
157 Ga0207680_10000931 3300025903 Bacteria 13816
158 Ga0207680_10279863 3300025903 Bacteria 1159
159 Ga0207699_10103898 3300025906 Bacteria 1808
160 Ga0207645_10043708 3300025907 Bacteria 2867
161 Ga0207643_10099681 3300025908 Bacteria 1703
162 Ga0207643_10211087 3300025908 Bacteria 1185
163 Ga0207705_10072571 3300025909 Bacteria 2497
164 Ga0207684_10027670 3300025910 Bacteria 4829
165 Ga0207684_10049471 3300025910 Bacteria 3566
166 Ga0207684_10135230 3300025910 Bacteria 2117
167 Ga0207684_10285453 3300025910 Bacteria 1423
168 Ga0207684_10299871 3300025910 Bacteria 1385
169 Ga0207684_10585578 3300025910 Bacteria 953
170 Ga0207695_10050651 3300025913 Bacteria 4366
171 Ga0207660_10231432 3300025917 Bacteria 1453
172 Ga0207652_10373992 3300025921 Bacteria 1286
173 Ga0207652_10594545 3300025921 Bacteria 993
174 Ga0207646_10180513 3300025922 Bacteria 1906
175 Ga0207646_10183442 3300025922 Bacteria 1890
176 Ga0207646_10430723 3300025922 Bacteria 1190
177 Ga0207681_10105009 3300025923 Bacteria 2044
178 Ga0207681_10266334 3300025923 Bacteria 1343
179 Ga0207650_10026301 3300025925 Bacteria 4149
180 Ga0207659_10007353 3300025926 Bacteria 6770
181 Ga0207659_10042333 3300025926 Bacteria 3193
182 Ga0207659_10455073 3300025926 Bacteria 1078
183 Ga0207687_10276504 3300025927 Bacteria 1344
184 Ga0207700_10000488 3300025928 Bacteria 23266
185 Ga0207664_10028060 3300025929 Unclassified 4274
186 Ga0207644_10000635 3300025931 Bacteria 22259
187 Ga0207644_10022096 3300025931 Bacteria 4343
188 Ga0207706_10064761 3300025933 Bacteria 3219
189 Ga0207670_10005595 3300025936 Bacteria 6907
190 Ga0207670_10087257 3300025936 Bacteria 2198
191 Ga0207670_10171066 3300025936 Bacteria 1629
192 Ga0207670_10172180 3300025936 Bacteria 1624
193 Ga0207670_10249243 3300025936 Bacteria 1372
194 Ga0207669_10554939 3300025937 Bacteria 927
195 Ga0207704_10028601 3300025938 Bacteria 3095
196 Ga0207665_10152571 3300025939 Bacteria 1656
197 Ga0207691_10482640 3300025940 Bacteria 1053
198 Ga0207691_10576750 3300025940 Bacteria 953
199 Ga0207711_10007617 3300025941 Bacteria 9056
200 Ga0207711_10473858 3300025941 Bacteria 1166
201 Ga0207689_10015844 3300025942 Bacteria 6384
202 Ga0207679_10595115 3300025945 Bacteria 996
203 Ga0207667_10167465 3300025949 Bacteria 2259
204 Ga0207651_10005276 3300025960 Bacteria 6611
205 Ga0207651_10046625 3300025960 Bacteria 2916
206 Ga0207651_10294439 3300025960 Bacteria 1347
207 Ga0207651_10456140 3300025960 Bacteria 1097
208 Ga0207712_10096628 3300025961 Bacteria 2187
209 Ga0207658_10005671 3300025986 Bacteria 8539
210 Ga0207658_10277444 3300025986 Bacteria 1435
211 Ga0207677_10002592 3300026023 Bacteria 9508
212 Ga0207703_10001221 3300026035 Bacteria 24024
213 Ga0207703_10304939 3300026035 Bacteria 1454
214 Ga0207708_10450443 3300026075 Unclassified 1072
215 Ga0207641_10002167 3300026088 Bacteria 18497
216 Ga0207641_10021012 3300026088 Bacteria 5367
217 Ga0207648_10182065 3300026089 Bacteria 1860
218 Ga0207676_10001143 3300026095 Bacteria 19992
219 Ga0207676_10011429 3300026095 Bacteria 6345
220 Ga0207676_10089026 3300026095 Bacteria 2528
221 Ga0207675_100035909 3300026118 Bacteria 4623
222 Ga0207675_100335075 3300026118 Bacteria 1480
223 Ga0207683_10006411 3300026121 Bacteria 10076
224 Ga0207683_10010286 3300026121 Bacteria 7975
225 Ga0209588_1017600 3300027671 Bacteria 2217
226 Ga0268266_10234683 3300028379 Bacteria 1691
227 Ga0268266_10477486 3300028379 Bacteria 1188
228 Ga0268265_10034980 3300028380 Bacteria 3666
229 Ga0268265_10038250 3300028380 Bacteria 3528
230 Ga0268264_10048557 3300028381 Bacteria 3531
231 Ga0265327_10049450 3300031251 Bacteria 2205
232 Ga0265314_10036828 3300031711 Bacteria 3550
233 Ga0265342_10026767 3300031712 Bacteria 3611
234 Ga0307507_10198561 3300033179 Bacteria 1393
235 Ga0373944_0001047 3300035089 Bacteria 6838
236 Ga0373936_0033049 3300035113 Bacteria 2049
237 Ga0373945_0027841 3300035116 Bacteria 1976
238 Ga0373956_0067328 3300035119 Bacteria 1630
239 Ga0373943_0001017 3300035170 Bacteria 12445
240 Ga0373946_0002825 3300035171 Bacteria 6146
241 Ga0373946_0013053 3300035171 Bacteria 3117
242 Ga0373955_0084629 3300035172 Bacteria 1799
243 Ga0373924_0052449 3300035410 Bacteria 1693
244 Ga0373935_0003052 3300035692 Bacteria 9652
245 Ga0373927_0000746 3300035695 Bacteria 24846
246 Ga0373927_0002048 3300035695 Bacteria 14862
247 Ga0373927_0023416 3300035695 Bacteria 4044
248 Ga0373927_0142735 3300035695 Bacteria 1567
249 Ga0373933_0023995 3300035724 Bacteria 3491
250 Ga0373933_0154736 3300035724 Bacteria 1454
251 Ga0373947_0000265 3300035725 Bacteria 29669
252 Ga0373947_0002277 3300035725 Bacteria 11602
253 Ga0373947_0020888 3300035725 Bacteria 3785
254 Ga0373937_0140090 3300036401 Bacteria 2262
255 Ga0373937_0272473 3300036401 Bacteria 1598
256 Ga0373925_0000708 3300037068 Bacteria 31211
257 Ga0373925_0053789 3300037068 Bacteria 3010
258 Ga0373925_0069772 3300037068 Bacteria 2655
259 Ga0395899_0028421 3300037312 Bacteria 4211
260 Ga0395900_0003404 3300037418 Bacteria 17183
261 Ga0395900_0205602 3300037418 Bacteria 1990
262 Ga0395900_0213296 3300037418 Bacteria 1949
263 Ga0395900_0250808 3300037418 Bacteria 1771
264 Ga0395898_0002466 3300037466 Bacteria 21819
265 Ga0395898_0095842 3300037466 Bacteria 2850
266 Ga0395898_0200140 3300037466 Bacteria 1907
267 Ga0395905_0029005 3300037471 Bacteria 5216
268 Ga0395901_0009278 3300038443 Bacteria 9974
269 Ga0395901_0057072 3300038443 Bacteria 4061
270 Ga0395901_0072518 3300038443 Bacteria 3590
271 Ga0436361_1166356 3300039447 Bacteria 4507
272 Ga0495629_0048593 3300046459 Bacteria 2974
273 Ga0495653_0306697 3300046463 Bacteria 1034
274 Ga0495580_0004163 3300046472 Bacteria 12162
275 Ga0495580_0054238 3300046472 Bacteria 2828
276 Ga0495580_0294987 3300046472 Bacteria 1105
277 Ga0495582_0238180 3300046473 Bacteria 1043
278 Ga0495639_0185527 3300046475 Bacteria 1014
279 Ga0495639_0231958 3300046475 Bacteria 909
280 Ga0495662_0003429 3300046476 Bacteria 8033
281 Ga0495664_0006429 3300046477 Bacteria 6489
282 Ga0495618_0003660 3300046514 Bacteria 9527
283 Ga0495630_0014043 3300046517 Bacteria 5828
284 Ga0495630_0019499 3300046517 Bacteria 4985
285 Ga0495630_0159144 3300046517 Bacteria 1719
286 Ga0495666_0013147 3300046526 Bacteria 4123
287 Ga0495665_0008180 3300046531 Bacteria 5672
288 Ga0495665_0022563 3300046531 Bacteria 3383
289 Ga0495640_0063655 3300046533 Bacteria 2497
290 Ga0495640_0073733 3300046533 Bacteria 2284
291 Ga0495640_0395552 3300046533 Bacteria 849
292 Ga0495586_0002246 3300046535 Bacteria 10510
293 Ga0495645_0003435 3300046543 Bacteria 10739
294 Ga0495667_0107349 3300046559 Bacteria 1804
295 Ga0495656_0194867 3300046615 Bacteria 1003
296 Ga0495634_0009067 3300046642 Bacteria 7355
297 Ga0495634_0026746 3300046642 Bacteria 4023
298 Ga0495634_0034551 3300046642 Bacteria 3469
299 Ga0495634_0036521 3300046642 Bacteria 3360
300 Ga0495635_0000439 3300046663 Bacteria 26328
301 Ga0495635_0415231 3300046663 Bacteria 893
302 Ga0495659_0010399 3300046664 Bacteria 2985
303 Ga0495659_0045206 3300046664 Bacteria 1586
304 Ga0495647_0084966 3300046681 Bacteria 1289
305 Ga0495669_0086083 3300046684 Bacteria 1447
306 Ga0495613_0001993 3300046689 Bacteria 15501
307 Ga0495624_0007835 3300046690 Bacteria 7495
308 Ga0495624_0035961 3300046690 Bacteria 3195
309 Ga0495624_0135706 3300046690 Bacteria 1508
310 Ga0495674_0003173 3300047319 Bacteria 15959
311 Ga0495674_0178316 3300047319 Bacteria 1770
312 Ga0495674_0316289 3300047319 Bacteria 1273
313 Ga0495674_0462735 3300047319 Bacteria 1018
314 Ga0495676_0042462 3300047321 Bacteria 3733
315 Ga0495680_0015605 3300047322 Bacteria 6550
316 Ga0495684_0015611 3300047471 Bacteria 5845
317 Ga0495684_0029017 3300047471 Bacteria 4246
318 Ga0495684_0110248 3300047471 Bacteria 2077
319 Ga0496107_0153781 3300048910 Bacteria 1703
320 Ga0496108_0192014 3300048911 Bacteria 1770
321 Ga0496109_0166640 3300048912 Bacteria 2066
322 Ga0496109_0234915 3300048912 Bacteria 1725
323 Ga0496110_0514573 3300048913 Bacteria 1089
324 Ga0501034_0000235 3300049571 Bacteria 102844
325 Ga0501034_0010363 3300049571 Bacteria 9714
326 Ga0501034_0032463 3300049571 Bacteria 5302
327 Ga0501067_0232572 3300049583 Bacteria 1026
328 Ga0501070_0064821 3300049586 Bacteria 3025
329 Ga0501083_0211483 3300049744 Bacteria 1264
330 nmdc:mga0k408_35392_c1 3300050493 Bacteria 2864
331 nmdc:mga05p37_1152_c1 3300050507 Bacteria 30449
332 nmdc:mga05p37_159428_c1 3300050507 Bacteria 2756
333 nmdc:mga05p37_198970_c1 3300050507 Bacteria 2428
334 nmdc:mga05p37_240799_c1 3300050507 Unclassified 2175
335 nmdc:mga05p37_547964_c1 3300050507 Bacteria 1317
336 nmdc:mga05p37_664079_c1 3300050507 Bacteria 1165
337 nmdc:mga09592_270299_c1 3300050508 Bacteria 1474
338 nmdc:mga09592_703916_c1 3300050508 Bacteria 859
339 nmdc:mga0qj67_275924_c1 3300050509 Bacteria 1363
340 nmdc:mga06r32_11990_c1 3300050510 Bacteria 7812
341 nmdc:mga08y16_555730_c1 3300050511 Bacteria 1161
342 nmdc:mga0n895_3236_c1 3300050512 Bacteria 13054
343 nmdc:mga0n895_3609_c1 3300050512 Bacteria 12512
344 nmdc:mga0n895_365137_c1 3300050512 Bacteria 1462
345 nmdc:mga0rr50_180790_c1 3300050513 Bacteria 1724
346 nmdc:mga0rr50_29525_c1 3300050513 Bacteria 3869
347 nmdc:mga0rr50_380165_c1 3300050513 Bacteria 1191
348 nmdc:mga08x19_57152_c1 3300050514 Bacteria 2520
349 nmdc:mga08x19_85563_c1 3300050514 Bacteria 2075
350 nmdc:mga0a205_2997_c1 3300050515 Bacteria 14965
351 nmdc:mga0a205_40930_c1 3300050515 Bacteria 4462
352 Ga0495601_0000523 3300053077 Bacteria 20305
353 Ga0495619_0010143 3300053085 Bacteria 5933
354 Ga0495619_0016027 3300053085 Bacteria 4744
355 Ga0500651_0025587 3300053093 Bacteria 3704
356 Ga0500562_037266 3300053108 Bacteria 1290
357 Ga0500642_0108559 3300053130 Bacteria 1295
358 Ga0500559_0012844 3300053136 Bacteria 3554
359 Ga0500616_0003646 3300053153 Bacteria 11570
360 Ga0500622_0008223 3300053156 Bacteria 5857
361 Ga0500636_0055450 3300053177 Bacteria 2323
362 Ga0500645_000051 3300053730 Bacteria 98521
363 Ga0501082_0028475 3300060353 Bacteria 4813
364 2585897169 2585427608 Bacteria 6544331
365 2842695877 2842694124 Bacteria 4063419
366 Ga0070680_100005103
367 JGI25153J46596_10000579
368 Ga0065715_10003083
369 Ga0065707_10322098
370 Ga0070690_100072156
371 Ga0070690_100091273
372 Ga0070690_100463531
373 Ga0070670_100023501
374 Ga0070677_10263039
375 Ga0068869_100009361
376 Ga0070666_10001793
377 Ga0070666_10251388
378 Ga0070680_100348454
379 Ga0068868_100000185
380 Ga0068868_100013533
381 Ga0070689_100009352
382 Ga0070689_100088236
383 Ga0070689_100111373
384 Ga0070689_100290164
385 Ga0070675_100000473
386 Ga0070675_100160712
387 Ga0070675_100529777
388 Ga0070671_100029543
389 Ga0070671_100050454
390 Ga0070673_100043693
391 Ga0070673_100384051
392 Ga0070667_100335901
393 Ga0070709_10103173
394 Ga0070714_100017647
395 Ga0070714_100269167
396 Ga0070713_100000020
397 Ga0070701_10006077
398 Ga0070701_10065654
399 Ga0070701_10406114
400 Ga0070700_100385748
401 Ga0070708_100015461
402 Ga0070708_100238096
403 Ga0070708_100311556
404 Ga0070708_100326903
405 Ga0070678_100004920
406 Ga0070678_100007438
407 Ga0070662_100040690
408 Ga0068867_100090420
409 Ga0068867_100189199
410 Ga0070685_10155913
411 Ga0070706_100043884
412 Ga0070706_100056871
413 Ga0070706_100077939
414 Ga0070706_100290046
415 Ga0070707_100001097
416 Ga0070707_100206725
417 Ga0070707_100846723
418 Ga0070698_100030117
419 Ga0070698_100269617
420 Ga0070698_100804357
421 Ga0070699_100000952
422 Ga0070699_100012437
423 Ga0070699_100189712
424 Ga0070699_100225251
425 Ga0070679_100475221
426 Ga0070679_100614688
427 Ga0070697_100088653
428 Ga0070697_100181214
429 Ga0070696_100086578
430 Ga0070665_100168121
431 Ga0070704_100126523
432 Ga0068857_100487448
433 Ga0068856_100725310
434 Ga0068852_100569246
435 Ga0068859_100001283
436 Ga0068859_100002872
437 Ga0068859_100053951
438 Ga0068859_100346217
439 Ga0068864_100001050
440 Ga0068864_100006289
441 Ga0068864_100016258
442 Ga0068861_100059735
443 Ga0068861_100180506
444 Ga0068851_10096127
445 Ga0068870_10039543
446 Ga0068870_10223881
447 Ga0068863_100004913
448 Ga0068858_100000885
449 Ga0068858_100082292
450 Ga0068858_100085719
451 Ga0068860_100035440
452 Ga0068860_100057107
453 Ga0068860_100109826
454 Ga0068862_100032108
455 Ga0070716_100049798
456 Ga0075362_10178612
457 Ga0097621_100054390
458 Ga0097621_100117828
459 Ga0097621_100237790
460 Ga0068871_100016654
461 Ga0075430_100309610
462 Ga0075431_100044886
463 Ga0075431_100422508
464 Ga0075433_10000475
465 Ga0075433_10231296
466 Ga0075434_100001631
467 Ga0075434_100015814
468 Ga0068865_100119408
469 Ga0075436_100015719
470 Ga0075436_100079282
471 Ga0097620_100001283
472 Ga0097620_100002873
473 Ga0097620_100053951
474 Ga0097620_100346221
475 Ga0075435_100032751
476 Ga0075435_100037763
477 Ga0099795_10004788
478 Ga0111539_10737435
479 Ga0105245_10216731
480 Ga0105245_10658924
481 Ga0105247_10001650
482 Ga0114129_10017153
483 Ga0114129_10243932
484 Ga0114129_10518131
485 Ga0105242_10029043
486 Ga0105248_10019050
487 Ga0105248_10029339
488 Ga0105248_10779353
489 Ga0105237_10496450
490 Ga0105249_10156342
491 Ga0105249_10332354
492 Ga0157370_10014852
493 Ga0157369_10036365
494 Ga0157374_10001295
495 Ga0157374_10021504
496 Ga0157378_10015680
497 Ga0157378_10091736
498 Ga0163162_10010058
499 Ga0163162_10148283
500 Ga0163162_10187241
501 Ga0163162_10777486
502 Ga0163162_11079225
503 Ga0157372_10089369
504 Ga0157372_10248350
505 Ga0157375_10023946
506 Ga0157375_10079612
507 Ga0157375_10508684
508 Ga0157375_10719305
509 Ga0157375_11129729
510 Ga0163163_10008307
511 Ga0163163_10362153
512 Ga0157380_10057090
513 Ga0157380_10255458
514 Ga0157377_10027378
515 Ga0157379_10002653
516 Ga0157376_10551186
517 Ga0224712_10144392
518 Ga0209758_1000523
519 Ga0207426_1029413
520 Ga0207697_10018027
521 Ga0207710_10000394
522 Ga0207680_10000931
523 Ga0207680_10279863
524 Ga0207699_10103898
525 Ga0207645_10043708
526 Ga0207643_10099681
527 Ga0207643_10211087
528 Ga0207705_10072571
529 Ga0207684_10027670
530 Ga0207684_10049471
531 Ga0207684_10135230
532 Ga0207684_10285453
533 Ga0207684_10299871
534 Ga0207684_10585578
535 Ga0207695_10050651
536 Ga0207660_10231432
537 Ga0207652_10373992
538 Ga0207652_10594545
539 Ga0207646_10180513
540 Ga0207646_10183442
541 Ga0207646_10430723
542 Ga0207681_10105009
543 Ga0207681_10266334
544 Ga0207650_10026301
545 Ga0207659_10007353
546 Ga0207659_10042333
547 Ga0207659_10455073
548 Ga0207687_10276504
549 Ga0207700_10000488
550 Ga0207664_10028060
551 Ga0207644_10000635
552 Ga0207644_10022096
553 Ga0207706_10064761
554 Ga0207670_10005595
555 Ga0207670_10087257
556 Ga0207670_10171066
557 Ga0207670_10172180
558 Ga0207670_10249243
559 Ga0207669_10554939
560 Ga0207704_10028601
561 Ga0207665_10152571
562 Ga0207691_10482640
563 Ga0207691_10576750
564 Ga0207711_10007617
565 Ga0207711_10473858
566 Ga0207689_10015844
567 Ga0207679_10595115
568 Ga0207667_10167465
569 Ga0207651_10005276
570 Ga0207651_10046625
571 Ga0207651_10294439
572 Ga0207651_10456140
573 Ga0207712_10096628
574 Ga0207658_10005671
575 Ga0207658_10277444
576 Ga0207677_10002592
577 Ga0207703_10001221
578 Ga0207703_10304939
579 Ga0207708_10450443
580 Ga0207641_10002167
581 Ga0207641_10021012
582 Ga0207648_10182065
583 Ga0207676_10001143
584 Ga0207676_10011429
585 Ga0207676_10089026
586 Ga0207675_100035909
587 Ga0207675_100335075
588 Ga0207683_10006411
589 Ga0207683_10010286
590 Ga0209588_1017600
591 Ga0268266_10234683
592 Ga0268266_10477486
593 Ga0268265_10034980
594 Ga0268265_10038250
595 Ga0268264_10048557
596 Ga0265327_10049450
597 Ga0265314_10036828
598 Ga0265342_10026767
599 Ga0307507_10198561
600 Ga0373944_0001047
601 Ga0373936_0033049
602 Ga0373945_0027841
603 Ga0373956_0067328
604 Ga0373943_0001017
605 Ga0373946_0002825
606 Ga0373946_0013053
607 Ga0373955_0084629
608 Ga0373924_0052449
609 Ga0373935_0003052
610 Ga0373927_0000746
611 Ga0373927_0002048
612 Ga0373927_0023416
613 Ga0373927_0142735
614 Ga0373933_0023995
615 Ga0373933_0154736
616 Ga0373947_0000265
617 Ga0373947_0002277
618 Ga0373947_0020888
619 Ga0373937_0140090
620 Ga0373937_0272473
621 Ga0373925_0000708
622 Ga0373925_0053789
623 Ga0373925_0069772
624 Ga0395899_0028421
625 Ga0395900_0003404
626 Ga0395900_0205602
627 Ga0395900_0213296
628 Ga0395900_0250808
629 Ga0395898_0002466
630 Ga0395898_0095842
631 Ga0395898_0200140
632 Ga0395905_0029005
633 Ga0395901_0009278
634 Ga0395901_0057072
635 Ga0395901_0072518
636 Ga0436361_1166356
637 Ga0495629_0048593
638 Ga0495653_0306697
639 Ga0495580_0004163
640 Ga0495580_0054238
641 Ga0495580_0294987
642 Ga0495582_0238180
643 Ga0495639_0185527
644 Ga0495639_0231958
645 Ga0495662_0003429
646 Ga0495664_0006429
647 Ga0495618_0003660
648 Ga0495630_0014043
649 Ga0495630_0019499
650 Ga0495630_0159144
651 Ga0495666_0013147
652 Ga0495665_0008180
653 Ga0495665_0022563
654 Ga0495640_0063655
655 Ga0495640_0073733
656 Ga0495640_0395552
657 Ga0495586_0002246
658 Ga0495645_0003435
659 Ga0495667_0107349
660 Ga0495656_0194867
661 Ga0495634_0009067
662 Ga0495634_0026746
663 Ga0495634_0034551
664 Ga0495634_0036521
665 Ga0495635_0000439
666 Ga0495635_0415231
667 Ga0495659_0010399
668 Ga0495659_0045206
669 Ga0495647_0084966
670 Ga0495669_0086083
671 Ga0495613_0001993
672 Ga0495624_0007835
673 Ga0495624_0035961
674 Ga0495624_0135706
675 Ga0495674_0003173
676 Ga0495674_0178316
677 Ga0495674_0316289
678 Ga0495674_0462735
679 Ga0495676_0042462
680 Ga0495680_0015605
681 Ga0495684_0015611
682 Ga0495684_0029017
683 Ga0495684_0110248
684 Ga0496107_0153781
685 Ga0496108_0192014
686 Ga0496109_0166640
687 Ga0496109_0234915
688 Ga0496110_0514573
689 Ga0501034_0000235
690 Ga0501034_0010363
691 Ga0501034_0032463
692 Ga0501067_0232572
693 Ga0501070_0064821
694 Ga0501083_0211483
695 nmdc:mga0k408_35392_c1
696 nmdc:mga05p37_1152_c1
697 nmdc:mga05p37_159428_c1
698 nmdc:mga05p37_198970_c1
699 nmdc:mga05p37_240799_c1
700 nmdc:mga05p37_547964_c1
701 nmdc:mga05p37_664079_c1
702 nmdc:mga09592_270299_c1
703 nmdc:mga09592_703916_c1
704 nmdc:mga0qj67_275924_c1
705 nmdc:mga06r32_11990_c1
706 nmdc:mga08y16_555730_c1
707 nmdc:mga0n895_3236_c1
708 nmdc:mga0n895_3609_c1
709 nmdc:mga0n895_365137_c1
710 nmdc:mga0rr50_180790_c1
711 nmdc:mga0rr50_29525_c1
712 nmdc:mga0rr50_380165_c1
713 nmdc:mga08x19_57152_c1
714 nmdc:mga08x19_85563_c1
715 nmdc:mga0a205_2997_c1
716 nmdc:mga0a205_40930_c1
717 Ga0495601_0000523
718 Ga0495619_0010143
719 Ga0495619_0016027
720 Ga0500651_0025587
721 Ga0500562_037266
722 Ga0500642_0108559
723 Ga0500559_0012844
724 Ga0500616_0003646
725 Ga0500622_0008223
726 Ga0500636_0055450
727 Ga0500645_000051
728 Ga0501082_0028475
729 2585897169
730 2842695877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

196

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

248

0.96

PF08659

KR

KR domain

8

189

0.91

PF23441

1

248

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.9688 3 247
4mow-assembly1.cif.gz_C crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9687 3 247
4mow-assembly1.cif.gz_D crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9661 3 247
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9642 1 248
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9604 1 248
ID Description Score Start End Superfamily
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 3 247 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 4 248 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 3 247 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 2 248 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9509 2 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519VEW8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9907 1 180 GO:0016491
AF-A0A258K9P7-F1-model_v4 Oxidoreductase 0.9892 1 159
AF-A0A519VEW8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9852 1 180 GO:0016491
AF-A0A841K1G0-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.9851 1 248 GO:0016491
AF-A0A3E2NXJ3-F1-model_v4 SDR family oxidoreductase 0.9841 1 249 GO:0016491

Map