F423457

General Info

Members Datasets Scaffolds Average Seq Length
364 225 728 151

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0313474|Ga0496118_0313474_231_755
Length 174
Sequence LTHFLDRRVYRLFWKIRQGPYQGVDMQLLSRRSLLGLAAVVDIAHHSRPTPVAAKALASRHALPPRHLETLLQTLVRHNILKGVRGPRGGYELARERRRISVGDIVRAAMTDAAGEDDPAPVSTLVDQVIAPAVNQASQSFLAELDQITVEDLCRDAERKHVFGGTPANIDFAI

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
210 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2909042592 Labrys sp. LIt4 Isolate Nodule
225 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.16
Metatranscriptomes 14.29
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0.27
Rhizoplane 5.22
Rhizosphere 74.18
Stem 0
Stem Tuber 0
Unclassified 13.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0313474 3300048921 Bacteria 855
2 JGI25151J46595_10000030 3300003187 Bacteria 202084
3 rootH2_10215561 3300003320 Bacteria 1467
4 Ga0006562J51391_1060397 3300003578 Bacteria 1620
5 Ga0055526_1000242 3300003771 Bacteria 46203
6 Ga0055524_1000069 3300003775 Bacteria 128956
7 Ga0055524_1032634 3300003775 Bacteria 1472
8 Ga0055534_1031163 3300003784 Bacteria 821
9 Ga0058862_12511734 3300004803 Bacteria 1109
10 Ga0070658_10303886 3300005327 Bacteria 1361
11 Ga0070680_100045882 3300005336 Bacteria 3554
12 Ga0070680_100949890 3300005336 Bacteria 742
13 Ga0070660_100269811 3300005339 Bacteria 1391
14 Ga0070660_100676231 3300005339 Unclassified 865
15 Ga0070669_100981221 3300005353 Bacteria 724
16 Ga0070671_100256848 3300005355 Bacteria 1485
17 Ga0070714_100000391 3300005435 Bacteria 32619
18 Ga0070714_100177010 3300005435 Unclassified 1939
19 Ga0070714_100290862 3300005435 Bacteria 1520
20 Ga0070713_100002616 3300005436 Bacteria 11760
21 Ga0070713_100053831 3300005436 Bacteria 3336
22 Ga0070713_100674417 3300005436 Bacteria 986
23 Ga0070710_10001805 3300005437 Bacteria 10113
24 Ga0070711_100116157 3300005439 Bacteria 1971
25 Ga0070711_100134580 3300005439 Bacteria 1845
26 Ga0070711_100276528 3300005439 Unclassified 1327
27 Ga0070711_100449416 3300005439 Bacteria 1055
28 Ga0070711_100558427 3300005439 Bacteria 950
29 Ga0070681_10027343 3300005458 Bacteria 5735
30 Ga0070706_100415132 3300005467 Bacteria 1253
31 Ga0070707_100429146 3300005468 Bacteria 1282
32 Ga0070698_100005573 3300005471 Bacteria 13763
33 Ga0070679_100075532 3300005530 Bacteria 3359
34 Ga0070697_100151035 3300005536 Bacteria 1958
35 Ga0070697_100701138 3300005536 Unclassified 893
36 Ga0070665_100169967 3300005548 Bacteria 2181
37 Ga0068852_100318811 3300005616 Bacteria 1509
38 Ga0068863_100471865 3300005841 Bacteria 1233
39 Ga0081540_1012498 3300005983 Bacteria 5582
40 Ga0070717_10004055 3300006028 Bacteria 10553
41 Ga0070717_10026868 3300006028 Bacteria 4596
42 Ga0070717_10945362 3300006028 Bacteria 785
43 Ga0070717_11207410 3300006028 Bacteria 688
44 Ga0075365_10379028 3300006038 Bacteria 998
45 Ga0070715_10124630 3300006163 Bacteria 1232
46 Ga0070715_10679128 3300006163 Unclassified 613
47 Ga0070712_100133058 3300006175 Bacteria 1887
48 Ga0070712_100154326 3300006175 Bacteria 1766
49 Ga0070712_100406719 3300006175 Bacteria 1125
50 Ga0070712_100723248 3300006175 Unclassified 850
51 Ga0075369_10016803 3300006186 Bacteria 2958
52 Ga0075370_10299762 3300006353 Bacteria 956
53 Ga0068871_101493305 3300006358 Unclassified 638
54 Ga0075431_101312966 3300006847 Bacteria 684
55 Ga0075433_11300002 3300006852 Bacteria 630
56 Ga0075436_100098348 3300006914 Bacteria 2037
57 Ga0099795_10115902 3300007788 Unclassified 1066
58 Ga0099795_10164693 3300007788 Bacteria 917
59 Ga0105240_10047714 3300009093 Bacteria 5418
60 Ga0105240_10174556 3300009093 Bacteria 2542
61 Ga0111539_12128706 3300009094 Bacteria 651
62 Ga0105245_10286819 3300009098 Bacteria 1611
63 Ga0105248_10115221 3300009177 Bacteria 3031
64 Ga0105237_10212112 3300009545 Bacteria 1936
65 Ga0105237_10319335 3300009545 Bacteria 1556
66 Ga0105238_10348022 3300009551 Bacteria 1471
67 Ga0105238_10452752 3300009551 Bacteria 1281
68 Ga0105238_11559859 3300009551 Bacteria 690
69 Ga0105239_10452816 3300010375 Bacteria 1456
70 Ga0105239_10477447 3300010375 Bacteria 1416
71 Ga0105246_11367160 3300011119 Bacteria 659
72 Ga0154010_126738 3300013062 Bacteria 821
73 Ga0157370_10052986 3300013104 Bacteria 3871
74 Ga0157370_10311106 3300013104 Bacteria 1454
75 Ga0157369_10806026 3300013105 Bacteria 965
76 Ga0157369_10966390 3300013105 Bacteria 873
77 Ga0171462_1013 3300013250 Bacteria 202864
78 Ga0157379_11378577 3300014968 Bacteria 683
79 Ga0157379_11414716 3300014968 Bacteria 674
80 Ga0157376_10821691 3300014969 Bacteria 943
81 Ga0184594_125692 3300019181 Bacteria 981
82 Ga0184599_148206 3300019188 Bacteria 501
83 Ga0184600_144454 3300019190 Unclassified 698
84 Ga0197907_11357199 3300020069 Bacteria 1262
85 Ga0206356_10568433 3300020070 Bacteria 2171
86 Ga0206355_1480517 3300020076 Bacteria 996
87 Ga0206352_10836830 3300020078 Bacteria 1043
88 Ga0206350_11648199 3300020080 Bacteria 1602
89 Ga0206354_11021053 3300020081 Bacteria 1089
90 Ga0206353_11510193 3300020082 Unclassified 1232
91 Ga0213873_10035633 3300021358 Bacteria 1260
92 Ga0213872_10019040 3300021361 Bacteria 3163
93 Ga0213872_10140772 3300021361 Bacteria 1059
94 Ga0213872_10144713 3300021361 Bacteria 1041
95 Ga0213876_10021495 3300021384 Bacteria 3411
96 Ga0213876_10039869 3300021384 Unclassified 2481
97 Ga0213876_10084503 3300021384 Bacteria 1679
98 Ga0213875_10000114 3300021388 Bacteria 91363
99 Ga0213875_10418792 3300021388 Bacteria 640
100 Ga0224712_10007964 3300022467 Bacteria 3109
101 Ga0224712_10319795 3300022467 Bacteria 729
102 Ga0247550_103752 3300023660 Unclassified 562
103 Ga0228598_1054837 3300024227 Bacteria 791
104 Ga0209673_1045147 3300025273 Bacteria 1213
105 Ga0209675_1017853 3300025291 Bacteria 2008
106 Ga0209025_1000063 3300025294 Bacteria 303962
107 Ga0209564_1000043 3300025295 Bacteria 388153
108 Ga0209564_1000052 3300025295 Bacteria 356578
109 Ga0209758_1128897 3300025297 Bacteria 672
110 Ga0209256_1000172 3300025299 Bacteria 129025
111 Ga0209256_1001436 3300025299 Bacteria 24668
112 Ga0209257_1109992 3300025304 Bacteria 659
113 Ga0207692_10006696 3300025898 Bacteria 4684
114 Ga0207680_10186683 3300025903 Bacteria 1405
115 Ga0207685_10159533 3300025905 Unclassified 1028
116 Ga0207699_10025639 3300025906 Bacteria 3239
117 Ga0207705_10542800 3300025909 Bacteria 904
118 Ga0207684_10020379 3300025910 Bacteria 5664
119 Ga0207707_10099241 3300025912 Bacteria 2545
120 Ga0207695_10111739 3300025913 Bacteria 2711
121 Ga0207695_10219475 3300025913 Bacteria 1809
122 Ga0207695_10803090 3300025913 Bacteria 821
123 Ga0207671_10109788 3300025914 Bacteria 2098
124 Ga0207693_10007842 3300025915 Bacteria 8765
125 Ga0207693_10462262 3300025915 Bacteria 991
126 Ga0207663_10091867 3300025916 Bacteria 2016
127 Ga0207663_10840964 3300025916 Unclassified 732
128 Ga0207657_10182923 3300025919 Bacteria 1693
129 Ga0207657_10774647 3300025919 Unclassified 742
130 Ga0207681_10905542 3300025923 Bacteria 739
131 Ga0207700_10030426 3300025928 Bacteria 3824
132 Ga0207700_10147485 3300025928 Bacteria 1941
133 Ga0207700_10273633 3300025928 Bacteria 1450
134 Ga0207664_10000688 3300025929 Bacteria 23140
135 Ga0207664_10127870 3300025929 Bacteria 2135
136 Ga0207644_10104527 3300025931 Bacteria 2132
137 Ga0207644_10354519 3300025931 Bacteria 1192
138 Ga0207644_10760582 3300025931 Bacteria 810
139 Ga0207704_10678688 3300025938 Bacteria 851
140 Ga0207665_10132457 3300025939 Bacteria 1771
141 Ga0207711_10373281 3300025941 Bacteria 1323
142 Ga0207679_11374884 3300025945 Bacteria 648
143 Ga0207639_10394030 3300026041 Bacteria 1246
144 Ga0207639_10562814 3300026041 Bacteria 1048
145 Ga0207702_10276329 3300026078 Bacteria 1586
146 Ga0207648_10183269 3300026089 Bacteria 1853
147 Ga0207675_102605203 3300026118 Unclassified 515
148 Ga0207698_10468412 3300026142 Bacteria 1220
149 Ga0268266_10127264 3300028379 Bacteria 2275
150 Ga0268266_10734777 3300028379 Bacteria 952
151 Ga0268266_10767178 3300028379 Bacteria 931
152 Ga0307515_10313942 3300028794 Bacteria 1240
153 Ga0265767_104913 3300030836 Bacteria 799
154 Ga0265766_1004652 3300030863 Unclassified 844
155 Ga0265766_1009045 3300030863 Bacteria 692
156 Ga0265777_112194 3300030877 Unclassified 646
157 Ga0265770_1059108 3300030878 Unclassified 710
158 Ga0265772_103373 3300030886 Bacteria 658
159 Ga0265769_103673 3300030888 Bacteria 866
160 Ga0265769_111369 3300030888 Unclassified 618
161 Ga0265769_114649 3300030888 Bacteria 577
162 Ga0265768_102254 3300030963 Unclassified 973
163 Ga0265771_1013255 3300031010 Unclassified 639
164 Ga0265771_1026494 3300031010 Unclassified 533
165 Ga0265774_103953 3300031011 Unclassified 602
166 Ga0265773_1003368 3300031018 Bacteria 1044
167 Ga0265773_1037288 3300031018 Unclassified 545
168 Ga0265760_10099676 3300031090 Unclassified 917
169 Ga0265760_10117177 3300031090 Unclassified 853
170 Ga0265330_10196292 3300031235 Bacteria 854
171 Ga0265330_10469793 3300031235 Bacteria 534
172 Ga0265328_10011506 3300031239 Bacteria 3533
173 Ga0265328_10290724 3300031239 Bacteria 630
174 Ga0265325_10035407 3300031241 Bacteria 2652
175 Ga0265325_10089382 3300031241 Bacteria 1521
176 Ga0265325_10118437 3300031241 Unclassified 1279
177 Ga0265325_10199252 3300031241 Bacteria 924
178 Ga0265325_10348564 3300031241 Bacteria 654
179 Ga0265340_10014098 3300031247 Bacteria 4184
180 Ga0265339_10008207 3300031249 Bacteria 6662
181 Ga0265331_10470711 3300031250 Bacteria 565
182 Ga0265327_10004761 3300031251 Bacteria 11814
183 Ga0265316_10081938 3300031344 Bacteria 2473
184 Ga0265316_10340320 3300031344 Bacteria 1087
185 Ga0265313_10131554 3300031595 Bacteria 1084
186 Ga0265314_10072981 3300031711 Bacteria 2290
187 Ga0265314_10123341 3300031711 Bacteria 1627
188 Ga0265342_10200957 3300031712 Bacteria 1083
189 Ga0265342_10457456 3300031712 Bacteria 654
190 Ga0247548_101497 3300031814 Unclassified 954
191 Ga0307510_10089726 3300033180 Bacteria 2925
192 Ga0307510_10504064 3300033180 Unclassified 653
193 Ga0373930_0132896 3300034816 Unclassified 614
194 Ga0373928_0093946 3300035084 Unclassified 774
195 Ga0373940_0139378 3300035088 Bacteria 766
196 Ga0373949_0092235 3300035090 Bacteria 821
197 Ga0373923_0239728 3300035111 Unclassified 847
198 Ga0373939_0366257 3300035114 Bacteria 590
199 Ga0373953_0006383 3300035117 Bacteria 3881
200 Ga0373953_0234095 3300035117 Bacteria 797
201 Ga0373954_0045411 3300035118 Bacteria 2053
202 Ga0373960_0139085 3300035121 Bacteria 821
203 Ga0373955_0034959 3300035172 Bacteria 2658
204 Ga0373955_0245822 3300035172 Bacteria 1072
205 Ga0373955_0553644 3300035172 Bacteria 704
206 Ga0373924_0312933 3300035410 Bacteria 698
207 Ga0373931_0083287 3300035691 Bacteria 1769
208 Ga0373927_0152925 3300035695 Bacteria 1511
209 Ga0373927_0217594 3300035695 Bacteria 1255
210 Ga0373933_0002998 3300035724 Bacteria 9410
211 Ga0373937_0003970 3300036401 Bacteria 12514
212 Ga0373937_1374445 3300036401 Bacteria 654
213 Ga0265778_028371 3300036457 Bacteria 716
214 Ga0373925_0211546 3300037068 Bacteria 1545
215 Ga0373925_0586697 3300037068 Bacteria 918
216 Ga0373925_0834239 3300037068 Bacteria 760
217 Ga0373925_1295349 3300037068 Bacteria 598
218 Ga0373925_1771951 3300037068 Unclassified 504
219 Ga0395899_0017568 3300037312 Bacteria 5449
220 Ga0395900_0046850 3300037418 Bacteria 4451
221 Ga0395898_0809639 3300037466 Bacteria 877
222 Ga0395905_0214461 3300037471 Bacteria 1803
223 Ga0395905_0852694 3300037471 Bacteria 814
224 Ga0436364_0031482 3300037853 Bacteria 2838
225 Ga0436364_0169683 3300037853 Bacteria 86149
226 Ga0436364_0187611 3300037853 Bacteria 883
227 Ga0436364_0667041 3300037853 Bacteria 2536
228 Ga0436364_1043221 3300037853 Bacteria 42769
229 Ga0436364_1304174 3300037853 Unclassified 943
230 Ga0436364_1441876 3300037853 Bacteria 900
231 Ga0436364_1489020 3300037853 Bacteria 1145
232 Ga0395901_0718942 3300038443 Bacteria 994
233 Ga0395901_1209427 3300038443 Bacteria 721
234 Ga0436365_0117943 3300039437 Bacteria 5406
235 Ga0436365_0212978 3300039437 Bacteria 12450
236 Ga0436365_0538973 3300039437 Bacteria 762
237 Ga0436365_0805618 3300039437 Bacteria 2672
238 Ga0436365_1408391 3300039437 Bacteria 9451
239 Ga0436365_1576318 3300039437 Unclassified 4202
240 Ga0436365_1610172 3300039437 Bacteria 987
241 Ga0436365_1685425 3300039437 Bacteria 18306
242 Ga0436360_0078670 3300039438 Bacteria 929
243 Ga0436360_0123229 3300039438 Bacteria 1208
244 Ga0436360_0343446 3300039438 Bacteria 577
245 Ga0436360_0538841 3300039438 Bacteria 1085
246 Ga0436360_0665245 3300039438 Bacteria 1826
247 Ga0436360_0787495 3300039438 Bacteria 6461
248 Ga0436360_0849813 3300039438 Bacteria 1841
249 Ga0436360_0885824 3300039438 Bacteria 1232
250 Ga0436360_0922891 3300039438 Bacteria 736
251 Ga0436360_1026224 3300039438 Bacteria 4181
252 Ga0436360_1187899 3300039438 Bacteria 602
253 Ga0436360_1224164 3300039438 Unclassified 1125
254 Ga0436360_1305569 3300039438 Bacteria 1126
255 Ga0436361_0215586 3300039447 Bacteria 2614
256 Ga0436361_0237880 3300039447 Bacteria 3504
257 Ga0436361_0285134 3300039447 Bacteria 3111
258 Ga0436361_0438030 3300039447 Bacteria 2127
259 Ga0436361_0767987 3300039447 Bacteria 2664
260 Ga0436361_0856468 3300039447 Bacteria 1137
261 Ga0436361_0999438 3300039447 Bacteria 1319
262 Ga0436361_1173763 3300039447 Bacteria 688
263 Ga0436363_0166005 3300039450 Bacteria 1880
264 Ga0436363_0550442 3300039450 Bacteria 1629
265 Ga0436363_1013773 3300039450 Unclassified 914
266 Ga0436363_1316108 3300039450 Unclassified 1012
267 Ga0436363_1593458 3300039450 Bacteria 1671
268 Ga0436362_0309348 3300039453 Bacteria 904
269 Ga0436362_0374241 3300039453 Bacteria 2313
270 Ga0436362_0505256 3300039453 Unclassified 782
271 Ga0436362_0567344 3300039453 Bacteria 1138
272 Ga0436362_0588451 3300039453 Bacteria 645
273 Ga0436362_0630723 3300039453 Bacteria 1295
274 Ga0436362_0724418 3300039453 Bacteria 2080
275 Ga0436362_1185708 3300039453 Bacteria 1343
276 Ga0451853_2748029 3300041512 Bacteria 633
277 Ga0466959_0746414 3300045049 Unclassified 655
278 Ga0466958_0643885 3300045836 Bacteria 690
279 Ga0495580_0153376 3300046472 Bacteria 1596
280 Ga0495643_0095850 3300046522 Bacteria 1526
281 Ga0495652_0902743 3300046529 Bacteria 583
282 Ga0495640_0152414 3300046533 Unclassified 1485
283 Ga0495586_0040911 3300046535 Bacteria 2495
284 Ga0495645_0359781 3300046543 Bacteria 936
285 Ga0495667_0092654 3300046559 Bacteria 1956
286 Ga0495635_0190869 3300046663 Bacteria 1391
287 Ga0495661_0308454 3300046665 Bacteria 790
288 Ga0495604_0428971 3300047317 Bacteria 867
289 Ga0495684_0434281 3300047471 Bacteria 916
290 Ga0496100_0685661 3300048903 Bacteria 799
291 Ga0496101_0052232 3300048904 Bacteria 2947
292 Ga0496102_0375371 3300048905 Bacteria 1338
293 Ga0496104_0037496 3300048907 Bacteria 4534
294 Ga0496104_0780872 3300048907 Bacteria 862
295 Ga0496104_1450634 3300048907 Unclassified 589
296 Ga0496106_0116522 3300048909 Bacteria 2084
297 Ga0496107_0227207 3300048910 Bacteria 1389
298 Ga0496107_0413990 3300048910 Bacteria 1002
299 Ga0496108_0280068 3300048911 Unclassified 1452
300 Ga0496109_0424587 3300048912 Unclassified 1256
301 Ga0496110_0181149 3300048913 Bacteria 1913
302 Ga0496111_0194140 3300048914 Bacteria 1509
303 Ga0496111_0257181 3300048914 Unclassified 1296
304 Ga0496111_1061042 3300048914 Bacteria 579
305 Ga0496112_0444673 3300048915 Bacteria 1234
306 Ga0496113_0071834 3300048916 Bacteria 2633
307 Ga0496114_0080270 3300048917 Bacteria 2755
308 Ga0496115_0049743 3300048918 Bacteria 3356
309 Ga0496117_0063988 3300048920 Bacteria 2511
310 Ga0496118_0130890 3300048921 Bacteria 1612
311 Ga0496122_0142727 3300048925 Bacteria 1494
312 Ga0496122_0151447 3300048925 Bacteria 1431
313 Ga0496123_0096545 3300048926 Bacteria 1734
314 Ga0496123_0293051 3300048926 Bacteria 780
315 Ga0496125_0071691 3300048928 Bacteria 2705
316 Ga0496125_0120390 3300048928 Bacteria 1874
317 Ga0496126_0044110 3300048929 Bacteria 4109
318 Ga0496126_0758726 3300048929 Unclassified 748
319 Ga0496126_1241727 3300048929 Bacteria 546
320 Ga0501034_0333845 3300049571 Bacteria 1447
321 Ga0501047_0287570 3300049581 Bacteria 1488
322 Ga0501069_0021102 3300049585 Bacteria 3533
323 Ga0501072_0962035 3300049588 Bacteria 666
324 Ga0501080_0418629 3300049742 Unclassified 1204
325 Ga0501083_0001709 3300049744 Bacteria 14961
326 Ga0501035_0832611 3300049822 Bacteria 735
327 nmdc:mga0yw44_231512_c1 3300050492 Bacteria 1226
328 nmdc:mga08y16_465913_c1 3300050511 Bacteria 1287
329 nmdc:mga0rr50_742741_c1 3300050513 Bacteria 837
330 nmdc:mga0rr50_894188_c1 3300050513 Bacteria 757
331 nmdc:mga0sz30_137677_c1 3300050516 Bacteria 1077
332 nmdc:mga0sz30_55037_c1 3300050516 Bacteria 1693
333 nmdc:mga0sz30_88765_c1 3300050516 Bacteria 1343
334 Ga0495595_0058954 3300053084 Bacteria 1794
335 Ga0495619_0096284 3300053085 Bacteria 2009
336 Ga0495619_0982847 3300053085 Unclassified 565
337 Ga0500578_0199057 3300053086 Bacteria 1227
338 Ga0500646_0157818 3300053090 Bacteria 756
339 Ga0500569_100684 3300053109 Bacteria 947
340 Ga0500595_169214 3300053119 Bacteria 608
341 Ga0500561_0072950 3300053137 Bacteria 986
342 Ga0500573_0447341 3300053140 Bacteria 598
343 Ga0500622_0102568 3300053156 Bacteria 1407
344 Ga0500636_0010834 3300053177 Bacteria 5328
345 Ga0587066_047393 3300059490 Bacteria 833
346 Ga0587066_051221 3300059490 Bacteria 813
347 Ga0587073_0042074 3300059492 Bacteria 1000
348 Ga0587073_0068252 3300059492 Bacteria 852
349 Ga0587077_026277 3300059493 Bacteria 1074
350 Ga0587077_047868 3300059493 Bacteria 884
351 Ga0587080_041002 3300059503 Bacteria 844
352 Ga0587080_043033 3300059503 Bacteria 829
353 Ga0587082_041529 3300059504 Bacteria 845
354 Ga0587085_022467 3300059506 Bacteria 973
355 Ga0587088_050882 3300059508 Bacteria 811
356 Ga0587090_109407 3300059510 Bacteria 587
357 Ga0587092_036072 3300059512 Unclassified 841
358 Ga0587094_035009 3300059513 Bacteria 795
359 Ga0587101_017376 3300059623 Bacteria 996
360 Ga0587109_043034 3300059624 Bacteria 902
361 Ga0587071_052682 3300060344 Bacteria 846
362 Ga0501082_0038964 3300060353 Bacteria 4099
363 2909044824 2909042592 Bacteria 6499737
364 3003670765 3003665799 Bacteria 7279786
365 Ga0496118_0313474
366 JGI25151J46595_10000030
367 rootH2_10215561
368 Ga0006562J51391_1060397
369 Ga0055526_1000242
370 Ga0055524_1000069
371 Ga0055524_1032634
372 Ga0055534_1031163
373 Ga0058862_12511734
374 Ga0070658_10303886
375 Ga0070680_100045882
376 Ga0070680_100949890
377 Ga0070660_100269811
378 Ga0070660_100676231
379 Ga0070669_100981221
380 Ga0070671_100256848
381 Ga0070714_100000391
382 Ga0070714_100177010
383 Ga0070714_100290862
384 Ga0070713_100002616
385 Ga0070713_100053831
386 Ga0070713_100674417
387 Ga0070710_10001805
388 Ga0070711_100116157
389 Ga0070711_100134580
390 Ga0070711_100276528
391 Ga0070711_100449416
392 Ga0070711_100558427
393 Ga0070681_10027343
394 Ga0070706_100415132
395 Ga0070707_100429146
396 Ga0070698_100005573
397 Ga0070679_100075532
398 Ga0070697_100151035
399 Ga0070697_100701138
400 Ga0070665_100169967
401 Ga0068852_100318811
402 Ga0068863_100471865
403 Ga0081540_1012498
404 Ga0070717_10004055
405 Ga0070717_10026868
406 Ga0070717_10945362
407 Ga0070717_11207410
408 Ga0075365_10379028
409 Ga0070715_10124630
410 Ga0070715_10679128
411 Ga0070712_100133058
412 Ga0070712_100154326
413 Ga0070712_100406719
414 Ga0070712_100723248
415 Ga0075369_10016803
416 Ga0075370_10299762
417 Ga0068871_101493305
418 Ga0075431_101312966
419 Ga0075433_11300002
420 Ga0075436_100098348
421 Ga0099795_10115902
422 Ga0099795_10164693
423 Ga0105240_10047714
424 Ga0105240_10174556
425 Ga0111539_12128706
426 Ga0105245_10286819
427 Ga0105248_10115221
428 Ga0105237_10212112
429 Ga0105237_10319335
430 Ga0105238_10348022
431 Ga0105238_10452752
432 Ga0105238_11559859
433 Ga0105239_10452816
434 Ga0105239_10477447
435 Ga0105246_11367160
436 Ga0154010_126738
437 Ga0157370_10052986
438 Ga0157370_10311106
439 Ga0157369_10806026
440 Ga0157369_10966390
441 Ga0171462_1013
442 Ga0157379_11378577
443 Ga0157379_11414716
444 Ga0157376_10821691
445 Ga0184594_125692
446 Ga0184599_148206
447 Ga0184600_144454
448 Ga0197907_11357199
449 Ga0206356_10568433
450 Ga0206355_1480517
451 Ga0206352_10836830
452 Ga0206350_11648199
453 Ga0206354_11021053
454 Ga0206353_11510193
455 Ga0213873_10035633
456 Ga0213872_10019040
457 Ga0213872_10140772
458 Ga0213872_10144713
459 Ga0213876_10021495
460 Ga0213876_10039869
461 Ga0213876_10084503
462 Ga0213875_10000114
463 Ga0213875_10418792
464 Ga0224712_10007964
465 Ga0224712_10319795
466 Ga0247550_103752
467 Ga0228598_1054837
468 Ga0209673_1045147
469 Ga0209675_1017853
470 Ga0209025_1000063
471 Ga0209564_1000043
472 Ga0209564_1000052
473 Ga0209758_1128897
474 Ga0209256_1000172
475 Ga0209256_1001436
476 Ga0209257_1109992
477 Ga0207692_10006696
478 Ga0207680_10186683
479 Ga0207685_10159533
480 Ga0207699_10025639
481 Ga0207705_10542800
482 Ga0207684_10020379
483 Ga0207707_10099241
484 Ga0207695_10111739
485 Ga0207695_10219475
486 Ga0207695_10803090
487 Ga0207671_10109788
488 Ga0207693_10007842
489 Ga0207693_10462262
490 Ga0207663_10091867
491 Ga0207663_10840964
492 Ga0207657_10182923
493 Ga0207657_10774647
494 Ga0207681_10905542
495 Ga0207700_10030426
496 Ga0207700_10147485
497 Ga0207700_10273633
498 Ga0207664_10000688
499 Ga0207664_10127870
500 Ga0207644_10104527
501 Ga0207644_10354519
502 Ga0207644_10760582
503 Ga0207704_10678688
504 Ga0207665_10132457
505 Ga0207711_10373281
506 Ga0207679_11374884
507 Ga0207639_10394030
508 Ga0207639_10562814
509 Ga0207702_10276329
510 Ga0207648_10183269
511 Ga0207675_102605203
512 Ga0207698_10468412
513 Ga0268266_10127264
514 Ga0268266_10734777
515 Ga0268266_10767178
516 Ga0307515_10313942
517 Ga0265767_104913
518 Ga0265766_1004652
519 Ga0265766_1009045
520 Ga0265777_112194
521 Ga0265770_1059108
522 Ga0265772_103373
523 Ga0265769_103673
524 Ga0265769_111369
525 Ga0265769_114649
526 Ga0265768_102254
527 Ga0265771_1013255
528 Ga0265771_1026494
529 Ga0265774_103953
530 Ga0265773_1003368
531 Ga0265773_1037288
532 Ga0265760_10099676
533 Ga0265760_10117177
534 Ga0265330_10196292
535 Ga0265330_10469793
536 Ga0265328_10011506
537 Ga0265328_10290724
538 Ga0265325_10035407
539 Ga0265325_10089382
540 Ga0265325_10118437
541 Ga0265325_10199252
542 Ga0265325_10348564
543 Ga0265340_10014098
544 Ga0265339_10008207
545 Ga0265331_10470711
546 Ga0265327_10004761
547 Ga0265316_10081938
548 Ga0265316_10340320
549 Ga0265313_10131554
550 Ga0265314_10072981
551 Ga0265314_10123341
552 Ga0265342_10200957
553 Ga0265342_10457456
554 Ga0247548_101497
555 Ga0307510_10089726
556 Ga0307510_10504064
557 Ga0373930_0132896
558 Ga0373928_0093946
559 Ga0373940_0139378
560 Ga0373949_0092235
561 Ga0373923_0239728
562 Ga0373939_0366257
563 Ga0373953_0006383
564 Ga0373953_0234095
565 Ga0373954_0045411
566 Ga0373960_0139085
567 Ga0373955_0034959
568 Ga0373955_0245822
569 Ga0373955_0553644
570 Ga0373924_0312933
571 Ga0373931_0083287
572 Ga0373927_0152925
573 Ga0373927_0217594
574 Ga0373933_0002998
575 Ga0373937_0003970
576 Ga0373937_1374445
577 Ga0265778_028371
578 Ga0373925_0211546
579 Ga0373925_0586697
580 Ga0373925_0834239
581 Ga0373925_1295349
582 Ga0373925_1771951
583 Ga0395899_0017568
584 Ga0395900_0046850
585 Ga0395898_0809639
586 Ga0395905_0214461
587 Ga0395905_0852694
588 Ga0436364_0031482
589 Ga0436364_0169683
590 Ga0436364_0187611
591 Ga0436364_0667041
592 Ga0436364_1043221
593 Ga0436364_1304174
594 Ga0436364_1441876
595 Ga0436364_1489020
596 Ga0395901_0718942
597 Ga0395901_1209427
598 Ga0436365_0117943
599 Ga0436365_0212978
600 Ga0436365_0538973
601 Ga0436365_0805618
602 Ga0436365_1408391
603 Ga0436365_1576318
604 Ga0436365_1610172
605 Ga0436365_1685425
606 Ga0436360_0078670
607 Ga0436360_0123229
608 Ga0436360_0343446
609 Ga0436360_0538841
610 Ga0436360_0665245
611 Ga0436360_0787495
612 Ga0436360_0849813
613 Ga0436360_0885824
614 Ga0436360_0922891
615 Ga0436360_1026224
616 Ga0436360_1187899
617 Ga0436360_1224164
618 Ga0436360_1305569
619 Ga0436361_0215586
620 Ga0436361_0237880
621 Ga0436361_0285134
622 Ga0436361_0438030
623 Ga0436361_0767987
624 Ga0436361_0856468
625 Ga0436361_0999438
626 Ga0436361_1173763
627 Ga0436363_0166005
628 Ga0436363_0550442
629 Ga0436363_1013773
630 Ga0436363_1316108
631 Ga0436363_1593458
632 Ga0436362_0309348
633 Ga0436362_0374241
634 Ga0436362_0505256
635 Ga0436362_0567344
636 Ga0436362_0588451
637 Ga0436362_0630723
638 Ga0436362_0724418
639 Ga0436362_1185708
640 Ga0451853_2748029
641 Ga0466959_0746414
642 Ga0466958_0643885
643 Ga0495580_0153376
644 Ga0495643_0095850
645 Ga0495652_0902743
646 Ga0495640_0152414
647 Ga0495586_0040911
648 Ga0495645_0359781
649 Ga0495667_0092654
650 Ga0495635_0190869
651 Ga0495661_0308454
652 Ga0495604_0428971
653 Ga0495684_0434281
654 Ga0496100_0685661
655 Ga0496101_0052232
656 Ga0496102_0375371
657 Ga0496104_0037496
658 Ga0496104_0780872
659 Ga0496104_1450634
660 Ga0496106_0116522
661 Ga0496107_0227207
662 Ga0496107_0413990
663 Ga0496108_0280068
664 Ga0496109_0424587
665 Ga0496110_0181149
666 Ga0496111_0194140
667 Ga0496111_0257181
668 Ga0496111_1061042
669 Ga0496112_0444673
670 Ga0496113_0071834
671 Ga0496114_0080270
672 Ga0496115_0049743
673 Ga0496117_0063988
674 Ga0496118_0130890
675 Ga0496122_0142727
676 Ga0496122_0151447
677 Ga0496123_0096545
678 Ga0496123_0293051
679 Ga0496125_0071691
680 Ga0496125_0120390
681 Ga0496126_0044110
682 Ga0496126_0758726
683 Ga0496126_1241727
684 Ga0501034_0333845
685 Ga0501047_0287570
686 Ga0501069_0021102
687 Ga0501072_0962035
688 Ga0501080_0418629
689 Ga0501083_0001709
690 Ga0501035_0832611
691 nmdc:mga0yw44_231512_c1
692 nmdc:mga08y16_465913_c1
693 nmdc:mga0rr50_742741_c1
694 nmdc:mga0rr50_894188_c1
695 nmdc:mga0sz30_137677_c1
696 nmdc:mga0sz30_55037_c1
697 nmdc:mga0sz30_88765_c1
698 Ga0495595_0058954
699 Ga0495619_0096284
700 Ga0495619_0982847
701 Ga0500578_0199057
702 Ga0500646_0157818
703 Ga0500569_100684
704 Ga0500595_169214
705 Ga0500561_0072950
706 Ga0500573_0447341
707 Ga0500622_0102568
708 Ga0500636_0010834
709 Ga0587066_047393
710 Ga0587066_051221
711 Ga0587073_0042074
712 Ga0587073_0068252
713 Ga0587077_026277
714 Ga0587077_047868
715 Ga0587080_041002
716 Ga0587080_043033
717 Ga0587082_041529
718 Ga0587085_022467
719 Ga0587088_050882
720 Ga0587090_109407
721 Ga0587092_036072
722 Ga0587094_035009
723 Ga0587101_017376
724 Ga0587109_043034
725 Ga0587071_052682
726 Ga0501082_0038964
727 2909044824
728 3003670765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

29

156

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9282 27 70
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9205 27 68
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9129 27 70
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9 5 68
7oyk-assembly1.cif.gz_AAA dna-binding domain of cggr in complex with the dna operator 0.8996 11 68
ID Description Score Start End Superfamily
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9282 27 70 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9205 27 68 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9109 12 68 1.10.10.10
af_Q54FP4_67_150_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9074 26 68 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9 5 68 1.10.10.10
ID Description Score Start End GO Terms
AF-C5TAY7-F1-model_v4 Transcriptional regulator, BadM/Rrf2 family 0.9066 2 137 GO:0003700
GO:0005829
AF-A0A1E1V0A9-F1-model_v4 Rrf2 family transcriptional regulator 0.903 1 150 GO:0003700
GO:0005829
AF-A0A0Q7TCE8-F1-model_v4 Rrf2 family transcriptional regulator 0.9008 1 136 GO:0003700
GO:0005829
AF-A0A1E1V0A9-F1-model_v4 Rrf2 family transcriptional regulator 0.8972 1 150 GO:0003700
GO:0005829
AF-A0A537NMF7-F1-model_v4 Rrf2 family transcriptional regulator 0.8927 1 150 GO:0003700
GO:0005829

Map