F423443

General Info

Members Datasets Scaffolds Average Seq Length
364 216 728 316

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0003365|Ga0496100_0003365_4007_5110
Length 367
Sequence MLESVAAIGTDAQSAEAGELAAQHAILTERCGLLDRSERGKLALSGAGAIDFLNGQVTNELADLCPGEGRYAAFLTHKGKMLGDLRILAVASSADHSDAAGAGEVPVELLLDTERVALQELFDMIRRFKVGYGVELHKRTLERGLLSLIGPQSERVAGILAAGDATASDADDCGGAAXXPLPADEHSHAKVEIDGIGALAIRTDVGVDLLCDSADTERLREALLARGAQAVSEQAAECLRVERGRPRYGLDVDASTIPQEAGLNERAVSFTKGCYVGQETVARLYYRGKPNRHLRGLRLSAPVALGAELRLGERTVGRVGGVALSPVLGPIALALVRREAGPGATVQVGEDGVSAQVVELPFDAAGR

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 12.09
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0003365 3300048903 Bacteria 8326
2 Ga0070658_10205938 3300005327 Bacteria 1661
3 Ga0070676_10056528 3300005328 Bacteria 2319
4 Ga0070683_100008908 3300005329 Bacteria 8551
5 Ga0070683_100073536 3300005329 Bacteria 3191
6 Ga0070683_100103686 3300005329 Bacteria 2681
7 Ga0070683_100122342 3300005329 Bacteria 2459
8 Ga0070683_100164532 3300005329 Bacteria 2105
9 Ga0068869_100007610 3300005334 Bacteria 6934
10 Ga0070682_100002310 3300005337 Bacteria 10541
11 Ga0070682_100172709 3300005337 Bacteria 1503
12 Ga0068868_100016846 3300005338 Bacteria 5435
13 Ga0068868_100020122 3300005338 Bacteria 5007
14 Ga0068868_100097097 3300005338 Bacteria 2381
15 Ga0070660_100260555 3300005339 Bacteria 1416
16 Ga0070661_100177578 3300005344 Bacteria 1619
17 Ga0070692_10210479 3300005345 Bacteria 1144
18 Ga0070675_100029867 3300005354 Bacteria 4398
19 Ga0070674_100121592 3300005356 Bacteria 1933
20 Ga0070674_100153824 3300005356 Bacteria 1738
21 Ga0070688_100007793 3300005365 Bacteria 5784
22 Ga0070659_100000039 3300005366 Bacteria 104397
23 Ga0070659_100193912 3300005366 Bacteria 1670
24 Ga0070714_100000385 3300005435 Bacteria 32922
25 Ga0070714_100003010 3300005435 Bacteria 12496
26 Ga0070714_100258484 3300005435 Bacteria 1612
27 Ga0070710_10199302 3300005437 Bacteria 1263
28 Ga0070701_10004203 3300005438 Bacteria 5799
29 Ga0070711_100079317 3300005439 Bacteria 2335
30 Ga0070705_100235525 3300005440 Bacteria 1276
31 Ga0070700_100001751 3300005441 Bacteria 10913
32 Ga0070700_100020997 3300005441 Bacteria 3792
33 Ga0070662_100011280 3300005457 Bacteria 5891
34 Ga0068867_100182525 3300005459 Bacteria 1669
35 Ga0070685_10011035 3300005466 Bacteria 4715
36 Ga0070684_100129049 3300005535 Bacteria 2280
37 Ga0070684_100365033 3300005535 Bacteria 1329
38 Ga0070684_100460710 3300005535 Bacteria 1175
39 Ga0070686_100046477 3300005544 Bacteria 2740
40 Ga0070665_100010286 3300005548 Bacteria 9467
41 Ga0070664_100005446 3300005564 Bacteria 10218
42 Ga0070664_100075696 3300005564 Bacteria 2891
43 Ga0070664_100403060 3300005564 Bacteria 1251
44 Ga0068857_100015937 3300005577 Bacteria 6581
45 Ga0068857_100040903 3300005577 Bacteria 4110
46 Ga0068854_100086578 3300005578 Bacteria 2323
47 Ga0068854_100170408 3300005578 Bacteria 1693
48 Ga0068856_100084981 3300005614 Bacteria 3144
49 Ga0070702_100020595 3300005615 Bacteria 3457
50 Ga0070702_100041844 3300005615 Bacteria 2572
51 Ga0068852_100098562 3300005616 Bacteria 2632
52 Ga0068859_100079291 3300005617 Bacteria 3323
53 Ga0068859_100447403 3300005617 Bacteria 1388
54 Ga0068864_100019151 3300005618 Bacteria 5722
55 Ga0068864_100144612 3300005618 Bacteria 2148
56 Ga0068861_100207786 3300005719 Bacteria 1647
57 Ga0068858_100031564 3300005842 Bacteria 4921
58 Ga0068860_100090822 3300005843 Bacteria 2909
59 Ga0068862_100267588 3300005844 Bacteria 1562
60 Ga0081455_10003242 3300005937 Bacteria 18848
61 Ga0081538_10001913 3300005981 Bacteria 20841
62 Ga0081540_1001320 3300005983 Bacteria 21640
63 Ga0081539_10003509 3300005985 Bacteria 19131
64 Ga0081539_10012577 3300005985 Bacteria 6500
65 Ga0075363_100002097 3300006048 Bacteria 7991
66 Ga0070712_100000170 3300006175 Bacteria 35641
67 Ga0070712_100041232 3300006175 Bacteria 3169
68 Ga0070712_100257285 3300006175 Bacteria 1398
69 Ga0075430_100185537 3300006846 Bacteria 1730
70 Ga0075430_100342200 3300006846 Bacteria 1235
71 Ga0075431_100033015 3300006847 Bacteria 5334
72 Ga0075431_100270249 3300006847 Bacteria 1723
73 Ga0075433_10173316 3300006852 Bacteria 1920
74 Ga0075429_100055926 3300006880 Bacteria 3434
75 Ga0068865_100016668 3300006881 Bacteria 4707
76 Ga0068865_100037943 3300006881 Bacteria 3257
77 Ga0075436_100174578 3300006914 Bacteria 1517
78 Ga0097620_100079292 3300006931 Bacteria 3323
79 Ga0097620_100447349 3300006931 Bacteria 1388
80 Ga0075435_100120317 3300007076 Bacteria 2191
81 Ga0105240_10005188 3300009093 Bacteria 19491
82 Ga0111539_10098770 3300009094 Bacteria 3429
83 Ga0111539_10296282 3300009094 Bacteria 1882
84 Ga0105245_10008025 3300009098 Bacteria 9234
85 Ga0105245_10041285 3300009098 Bacteria 4112
86 Ga0105245_10206966 3300009098 Bacteria 1886
87 Ga0105245_10288000 3300009098 Bacteria 1608
88 Ga0105247_10091504 3300009101 Bacteria 1932
89 Ga0105247_10219711 3300009101 Bacteria 1286
90 Ga0105243_10036994 3300009148 Bacteria 3791
91 Ga0105243_10077674 3300009148 Bacteria 2701
92 Ga0105243_10155547 3300009148 Bacteria 1966
93 Ga0105242_10164311 3300009176 Bacteria 1946
94 Ga0105242_10238623 3300009176 Bacteria 1633
95 Ga0105248_10089489 3300009177 Bacteria 3465
96 Ga0105237_10002133 3300009545 Bacteria 24902
97 Ga0105249_10025775 3300009553 Bacteria 5296
98 Ga0105249_10304981 3300009553 Bacteria 1598
99 Ga0105239_10130878 3300010375 Bacteria 2791
100 Ga0105239_10754109 3300010375 Bacteria 1114
101 Ga0157374_10135368 3300013296 Bacteria 2388
102 Ga0157374_10504158 3300013296 Bacteria 1215
103 Ga0163162_10211519 3300013306 Bacteria 2069
104 Ga0157372_10008417 3300013307 Bacteria 10953
105 Ga0157375_10075707 3300013308 Bacteria 3391
106 Ga0157375_10310672 3300013308 Bacteria 1741
107 Ga0163163_10110751 3300014325 Bacteria 2774
108 Ga0163163_10652434 3300014325 Bacteria 1116
109 Ga0157380_10373542 3300014326 Bacteria 1343
110 Ga0157377_10207567 3300014745 Bacteria 1247
111 Ga0157379_10180982 3300014968 Bacteria 1904
112 Ga0157376_10232273 3300014969 Bacteria 1714
113 Ga0213875_10000092 3300021388 Bacteria 104416
114 Ga0213875_10020649 3300021388 Bacteria 3160
115 Ga0207692_10039922 3300025898 Bacteria 2313
116 Ga0207688_10001685 3300025901 Bacteria 11701
117 Ga0207688_10015748 3300025901 Bacteria 4100
118 Ga0207688_10018270 3300025901 Bacteria 3817
119 Ga0207705_10170047 3300025909 Bacteria 1641
120 Ga0207705_10271378 3300025909 Bacteria 1297
121 Ga0207695_10003738 3300025913 Bacteria 21160
122 Ga0207671_10005068 3300025914 Bacteria 12301
123 Ga0207693_10000028 3300025915 Bacteria 120041
124 Ga0207693_10009589 3300025915 Bacteria 7885
125 Ga0207693_10011577 3300025915 Bacteria 7135
126 Ga0207693_10080260 3300025915 Bacteria 2554
127 Ga0207693_10234087 3300025915 Bacteria 1442
128 Ga0207662_10008747 3300025918 Bacteria 5553
129 Ga0207650_10230489 3300025925 Bacteria 1494
130 Ga0207687_10013748 3300025927 Bacteria 5286
131 Ga0207687_10137557 3300025927 Bacteria 1849
132 Ga0207664_10000046 3300025929 Bacteria 140749
133 Ga0207664_10003020 3300025929 Bacteria 11190
134 Ga0207664_10152178 3300025929 Bacteria 1966
135 Ga0207644_10143212 3300025931 Bacteria 1843
136 Ga0207690_10000798 3300025932 Bacteria 20292
137 Ga0207706_10031240 3300025933 Bacteria 4745
138 Ga0207686_10277572 3300025934 Bacteria 1235
139 Ga0207686_10363174 3300025934 Bacteria 1093
140 Ga0207709_10001671 3300025935 Bacteria 14945
141 Ga0207709_10013607 3300025935 Bacteria 4489
142 Ga0207670_10027600 3300025936 Bacteria 3592
143 Ga0207669_10127643 3300025937 Bacteria 1741
144 Ga0207669_10148847 3300025937 Bacteria 1637
145 Ga0207704_10104214 3300025938 Bacteria 1899
146 Ga0207665_10125235 3300025939 Bacteria 1819
147 Ga0207711_10028754 3300025941 Bacteria 4682
148 Ga0207689_10052270 3300025942 Bacteria 3367
149 Ga0207689_10075452 3300025942 Bacteria 2771
150 Ga0207661_10021114 3300025944 Bacteria 4878
151 Ga0207661_10055739 3300025944 Bacteria 3172
152 Ga0207661_10170684 3300025944 Bacteria 1893
153 Ga0207661_10188163 3300025944 Bacteria 1808
154 Ga0207679_10053766 3300025945 Bacteria 2961
155 Ga0207679_10140608 3300025945 Bacteria 1951
156 Ga0207679_10143769 3300025945 Bacteria 1932
157 Ga0207712_10008365 3300025961 Bacteria 6538
158 Ga0207640_10026964 3300025981 Bacteria 3496
159 Ga0207640_10097173 3300025981 Bacteria 2055
160 Ga0207677_10026769 3300026023 Bacteria 3622
161 Ga0207703_10234666 3300026035 Bacteria 1646
162 Ga0207678_10221082 3300026067 Bacteria 1621
163 Ga0207708_10000612 3300026075 Bacteria 27409
164 Ga0207708_10005793 3300026075 Bacteria 9133
165 Ga0207708_10018497 3300026075 Bacteria 5248
166 Ga0207648_10035760 3300026089 Bacteria 4377
167 Ga0207648_10236569 3300026089 Bacteria 1625
168 Ga0207676_10045237 3300026095 Bacteria 3400
169 Ga0207676_10052163 3300026095 Bacteria 3196
170 Ga0207676_10319840 3300026095 Bacteria 1424
171 Ga0207674_10022945 3300026116 Bacteria 6694
172 Ga0207674_10141232 3300026116 Bacteria 2367
173 Ga0207683_10037991 3300026121 Bacteria 4194
174 Ga0207683_10095910 3300026121 Bacteria 2644
175 Ga0207683_10156244 3300026121 Bacteria 2060
176 Ga0207698_10106537 3300026142 Bacteria 2338
177 Ga0207698_10213233 3300026142 Bacteria 1739
178 Ga0207428_10037191 3300027907 Bacteria 3962
179 Ga0207428_10222744 3300027907 Bacteria 1413
180 Ga0268266_10202825 3300028379 Bacteria 1816
181 Ga0268265_10201579 3300028380 Bacteria 1727
182 Ga0268264_10072667 3300028381 Bacteria 2917
183 Ga0265326_10000030 3300028558 Bacteria 96518
184 Ga0265334_10000026 3300028573 Bacteria 116448
185 Ga0265338_10000536 3300028800 Bacteria 66434
186 Ga0265327_10011196 3300031251 Bacteria 6212
187 Ga0307413_10125873 3300031824 Bacteria 1745
188 Ga0307413_10162178 3300031824 Bacteria 1572
189 Ga0307407_10257832 3300031903 Bacteria 1198
190 Ga0307409_100464108 3300031995 Bacteria 1225
191 Ga0307409_100631315 3300031995 Bacteria 1063
192 Ga0307416_100043418 3300032002 Bacteria 3520
193 Ga0307414_10473669 3300032004 Bacteria 1103
194 Ga0307415_100241408 3300032126 Bacteria 1462
195 Ga0307415_100315346 3300032126 Bacteria 1301
196 Ga0307415_100447648 3300032126 Bacteria 1116
197 Ga0373953_0020804 3300035117 Bacteria 2455
198 Ga0373943_0087275 3300035170 Bacteria 1610
199 Ga0373931_0197035 3300035691 Bacteria 1201
200 Ga0373947_0206025 3300035725 Bacteria 1288
201 Ga0395899_0203076 3300037312 Archaea 1381
202 Ga0395898_0001439 3300037466 Bacteria 33744
203 Ga0436364_0091249 3300037853 Bacteria 4023
204 Ga0436364_0527355 3300037853 Bacteria 148076
205 Ga0436364_1096798 3300037853 Bacteria 4883
206 Ga0395901_0157904 3300038443 Bacteria 2382
207 Ga0436365_0031167 3300039437 Bacteria 1074
208 Ga0436365_0307913 3300039437 Bacteria 5804
209 Ga0436365_0639034 3300039437 Bacteria 4134
210 Ga0436365_1570308 3300039437 Bacteria 1728
211 Ga0436363_0779769 3300039450 Bacteria 1082
212 Ga0436363_1564477 3300039450 Bacteria 1535
213 Ga0436362_0707868 3300039453 Bacteria 1129
214 Ga0451791_0997164 3300041451 Archaea 1875
215 Ga0466969_0026125 3300044656 Bacteria 2996
216 Ga0466966_0040983 3300044684 Bacteria 2978
217 Ga0466966_0097009 3300044684 Bacteria 1826
218 Ga0466961_0002526 3300044693 Bacteria 11346
219 Ga0466961_0046520 3300044693 Bacteria 2775
220 Ga0466963_0003616 3300044694 Bacteria 8884
221 Ga0466963_0017937 3300044694 Bacteria 4416
222 Ga0466963_0105070 3300044694 Bacteria 1935
223 Ga0466963_0106442 3300044694 Bacteria 1923
224 Ga0466963_0184816 3300044694 Bacteria 1456
225 Ga0466963_0185925 3300044694 Bacteria 1451
226 Ga0466957_0130788 3300044842 Bacteria 1608
227 Ga0466959_0005555 3300045049 Bacteria 8654
228 Ga0466959_0052220 3300045049 Bacteria 2995
229 Ga0466959_0200828 3300045049 Unclassified 1388
230 Ga0466958_0018761 3300045836 Bacteria 4018
231 Ga0466958_0026255 3300045836 Bacteria 3442
232 Ga0466958_0037581 3300045836 Bacteria 2901
233 Ga0466967_0001673 3300045976 Bacteria 13144
234 Ga0466967_0034830 3300045976 Bacteria 4278
235 Ga0466967_0048986 3300045976 Bacteria 3693
236 Ga0466967_0072721 3300045976 Bacteria 3083
237 Ga0466967_0225122 3300045976 Unclassified 1784
238 Ga0466967_0505742 3300045976 Bacteria 1186
239 Ga0495603_0118287 3300046455 Bacteria 1545
240 Ga0495641_0132882 3300046461 Bacteria 1111
241 Ga0495651_0076794 3300046462 Bacteria 2529
242 Ga0495653_0132742 3300046463 Bacteria 1760
243 Ga0495582_0215576 3300046473 Bacteria 1098
244 Ga0495664_0028182 3300046477 Bacteria 3279
245 Ga0495608_0013343 3300046511 Bacteria 5700
246 Ga0495618_0000054 3300046514 Bacteria 83787
247 Ga0495618_0026466 3300046514 Bacteria 3607
248 Ga0495620_0104779 3300046515 Bacteria 1125
249 Ga0495628_0171809 3300046516 Bacteria 1643
250 Ga0495630_0000548 3300046517 Bacteria 27475
251 Ga0495587_0051729 3300046536 Bacteria 2427
252 Ga0495645_0000354 3300046543 Bacteria 32418
253 Ga0495645_0007378 3300046543 Bacteria 7648
254 Ga0495667_0041334 3300046559 Bacteria 3058
255 Ga0495634_0027425 3300046642 Bacteria 3962
256 Ga0495635_0022679 3300046663 Bacteria 4376
257 Ga0495588_0155299 3300046674 Bacteria 1210
258 Ga0495657_0000006 3300046675 Bacteria 250610
259 Ga0495657_0012221 3300046675 Bacteria 6384
260 Ga0495600_0053163 3300046809 Bacteria 2645
261 Ga0495604_0001012 3300047317 Bacteria 23396
262 Ga0495604_0252898 3300047317 Bacteria 1200
263 Ga0495679_037124 3300047446 Bacteria 1535
264 Ga0495684_0010650 3300047471 Bacteria 7107
265 Ga0495602_0031326 3300048088 Bacteria 5029
266 Ga0495602_0176085 3300048088 Bacteria 1655
267 Ga0496100_0075031 3300048903 Bacteria 2267
268 Ga0496101_0037333 3300048904 Bacteria 3446
269 Ga0496102_0000096 3300048905 Bacteria 124941
270 Ga0496102_0031581 3300048905 Bacteria 4752
271 Ga0496102_0186294 3300048905 Bacteria 1956
272 Ga0496102_0304904 3300048905 Bacteria 1501
273 Ga0496103_0000035 3300048906 Bacteria 182242
274 Ga0496103_0032531 3300048906 Bacteria 3183
275 Ga0496104_0000028 3300048907 Bacteria 203377
276 Ga0496104_0296055 3300048907 Bacteria 1531
277 Ga0496104_0344337 3300048907 Bacteria 1403
278 Ga0496105_0005730 3300048908 Bacteria 9458
279 Ga0496105_0069736 3300048908 Bacteria 2905
280 Ga0496105_0418089 3300048908 Bacteria 1062
281 Ga0496106_0071735 3300048909 Bacteria 2647
282 Ga0496106_0124269 3300048909 Bacteria 2019
283 Ga0496108_0005762 3300048911 Bacteria 10035
284 Ga0496108_0105369 3300048911 Bacteria 2407
285 Ga0496108_0119460 3300048911 Bacteria 2260
286 Ga0496108_0212188 3300048911 Bacteria 1681
287 Ga0496109_0001442 3300048912 Bacteria 19755
288 Ga0496109_0041405 3300048912 Bacteria 4172
289 Ga0496109_0113219 3300048912 Bacteria 2523
290 Ga0496109_0290141 3300048912 Bacteria 1542
291 Ga0496110_0000666 3300048913 Bacteria 23528
292 Ga0496110_0082384 3300048913 Bacteria 2869
293 Ga0496110_0348251 3300048913 Bacteria 1349
294 Ga0496111_0000229 3300048914 Bacteria 26736
295 Ga0496111_0007589 3300048914 Bacteria 7121
296 Ga0496111_0065359 3300048914 Bacteria 2640
297 Ga0496112_0000418 3300048915 Bacteria 28077
298 Ga0496112_0015398 3300048915 Bacteria 7136
299 Ga0496112_0060134 3300048915 Bacteria 3743
300 Ga0496112_0078911 3300048915 Bacteria 3255
301 Ga0496112_0245367 3300048915 Bacteria 1743
302 Ga0496113_0008000 3300048916 Bacteria 6853
303 Ga0496113_0009681 3300048916 Bacteria 6329
304 Ga0496113_0026668 3300048916 Bacteria 4134
305 Ga0496113_0065039 3300048916 Bacteria 2759
306 Ga0496114_0047748 3300048917 Bacteria 3561
307 Ga0496115_0000101 3300048918 Bacteria 80831
308 Ga0496115_0000198 3300048918 Bacteria 56167
309 Ga0496119_0124130 3300048922 Bacteria 1415
310 Ga0501031_0047463 3300049568 Bacteria 2800
311 Ga0501031_0114652 3300049568 Bacteria 1760
312 Ga0501033_0109935 3300049570 Bacteria 2007
313 Ga0501036_0031603 3300049572 Bacteria 4474
314 Ga0501037_0206748 3300049573 Bacteria 1386
315 Ga0501039_0124650 3300049575 Bacteria 2020
316 Ga0501040_0045664 3300049576 Bacteria 2989
317 Ga0501040_0137600 3300049576 Bacteria 1719
318 Ga0501040_0149126 3300049576 Bacteria 1649
319 Ga0501041_0012904 3300049577 Bacteria 4951
320 Ga0501041_0065501 3300049577 Bacteria 2226
321 Ga0501042_0041917 3300049578 Bacteria 3256
322 Ga0501042_0077681 3300049578 Bacteria 2377
323 Ga0501043_0223297 3300049579 Bacteria 1457
324 Ga0501046_0063082 3300049580 Bacteria 2894
325 Ga0501048_0057430 3300049582 Bacteria 2760
326 Ga0501048_0091412 3300049582 Bacteria 2147
327 Ga0501071_0006936 3300049587 Bacteria 7391
328 Ga0501071_0125649 3300049587 Bacteria 1903
329 Ga0501071_0155733 3300049587 Bacteria 1706
330 Ga0501071_0189169 3300049587 Bacteria 1544
331 Ga0501072_0020120 3300049588 Bacteria 5169
332 Ga0501072_0063817 3300049588 Bacteria 2906
333 Ga0501074_0095350 3300049590 Bacteria 2131
334 Ga0501074_0126541 3300049590 Bacteria 1828
335 Ga0501075_0064903 3300049591 Bacteria 2754
336 Ga0501075_0071220 3300049591 Bacteria 2627
337 Ga0501076_0168434 3300049592 Bacteria 1785
338 Ga0501076_0265226 3300049592 Bacteria 1406
339 Ga0501077_0018912 3300049593 Bacteria 4359
340 Ga0501079_0028212 3300049741 Bacteria 4306
341 Ga0501080_0066715 3300049742 Bacteria 3347
342 Ga0501081_0226618 3300049743 Bacteria 1360
343 Ga0501083_0199045 3300049744 Bacteria 1307
344 Ga0501045_0045286 3300049824 Bacteria 3203
345 Ga0501045_0087552 3300049824 Bacteria 2300
346 nmdc:mga03n38_89988_c1 3300050490 Bacteria 1459
347 nmdc:mga09592_18270_c1 3300050508 Bacteria 5749
348 nmdc:mga0qj67_21208_c1 3300050509 Bacteria 4983
349 nmdc:mga06r32_154620_c1 3300050510 Bacteria 2274
350 nmdc:mga08y16_66393_c1 3300050511 Bacteria 3765
351 nmdc:mga08y16_68312_c1 3300050511 Bacteria 3705
352 nmdc:mga0n895_17909_c1 3300050512 Bacteria 6544
353 nmdc:mga0rr50_42542_c1 3300050513 Bacteria 3318
354 nmdc:mga08x19_41462_c1 3300050514 Bacteria 2931
355 nmdc:mga0a205_41021_c2 3300050515 Bacteria 3168
356 Ga0495601_0000577 3300053077 Bacteria 19478
357 Ga0495601_0136211 3300053077 Bacteria 1601
358 Ga0495612_0000176 3300053078 Bacteria 26921
359 Ga0495619_0055384 3300053085 Bacteria 2626
360 Ga0501084_0177974 3300054114 Bacteria 1795
361 Ga0501082_0032945 3300060353 Bacteria 4468
362 Ga0466962_0070654 3300061719 Bacteria 1668
363 Ga0530510_0024480 3300061734 Bacteria 4308
364 Ga0530510_0032492 3300061734 Bacteria 3755
365 Ga0496100_0003365
366 Ga0070658_10205938
367 Ga0070676_10056528
368 Ga0070683_100008908
369 Ga0070683_100073536
370 Ga0070683_100103686
371 Ga0070683_100122342
372 Ga0070683_100164532
373 Ga0068869_100007610
374 Ga0070682_100002310
375 Ga0070682_100172709
376 Ga0068868_100016846
377 Ga0068868_100020122
378 Ga0068868_100097097
379 Ga0070660_100260555
380 Ga0070661_100177578
381 Ga0070692_10210479
382 Ga0070675_100029867
383 Ga0070674_100121592
384 Ga0070674_100153824
385 Ga0070688_100007793
386 Ga0070659_100000039
387 Ga0070659_100193912
388 Ga0070714_100000385
389 Ga0070714_100003010
390 Ga0070714_100258484
391 Ga0070710_10199302
392 Ga0070701_10004203
393 Ga0070711_100079317
394 Ga0070705_100235525
395 Ga0070700_100001751
396 Ga0070700_100020997
397 Ga0070662_100011280
398 Ga0068867_100182525
399 Ga0070685_10011035
400 Ga0070684_100129049
401 Ga0070684_100365033
402 Ga0070684_100460710
403 Ga0070686_100046477
404 Ga0070665_100010286
405 Ga0070664_100005446
406 Ga0070664_100075696
407 Ga0070664_100403060
408 Ga0068857_100015937
409 Ga0068857_100040903
410 Ga0068854_100086578
411 Ga0068854_100170408
412 Ga0068856_100084981
413 Ga0070702_100020595
414 Ga0070702_100041844
415 Ga0068852_100098562
416 Ga0068859_100079291
417 Ga0068859_100447403
418 Ga0068864_100019151
419 Ga0068864_100144612
420 Ga0068861_100207786
421 Ga0068858_100031564
422 Ga0068860_100090822
423 Ga0068862_100267588
424 Ga0081455_10003242
425 Ga0081538_10001913
426 Ga0081540_1001320
427 Ga0081539_10003509
428 Ga0081539_10012577
429 Ga0075363_100002097
430 Ga0070712_100000170
431 Ga0070712_100041232
432 Ga0070712_100257285
433 Ga0075430_100185537
434 Ga0075430_100342200
435 Ga0075431_100033015
436 Ga0075431_100270249
437 Ga0075433_10173316
438 Ga0075429_100055926
439 Ga0068865_100016668
440 Ga0068865_100037943
441 Ga0075436_100174578
442 Ga0097620_100079292
443 Ga0097620_100447349
444 Ga0075435_100120317
445 Ga0105240_10005188
446 Ga0111539_10098770
447 Ga0111539_10296282
448 Ga0105245_10008025
449 Ga0105245_10041285
450 Ga0105245_10206966
451 Ga0105245_10288000
452 Ga0105247_10091504
453 Ga0105247_10219711
454 Ga0105243_10036994
455 Ga0105243_10077674
456 Ga0105243_10155547
457 Ga0105242_10164311
458 Ga0105242_10238623
459 Ga0105248_10089489
460 Ga0105237_10002133
461 Ga0105249_10025775
462 Ga0105249_10304981
463 Ga0105239_10130878
464 Ga0105239_10754109
465 Ga0157374_10135368
466 Ga0157374_10504158
467 Ga0163162_10211519
468 Ga0157372_10008417
469 Ga0157375_10075707
470 Ga0157375_10310672
471 Ga0163163_10110751
472 Ga0163163_10652434
473 Ga0157380_10373542
474 Ga0157377_10207567
475 Ga0157379_10180982
476 Ga0157376_10232273
477 Ga0213875_10000092
478 Ga0213875_10020649
479 Ga0207692_10039922
480 Ga0207688_10001685
481 Ga0207688_10015748
482 Ga0207688_10018270
483 Ga0207705_10170047
484 Ga0207705_10271378
485 Ga0207695_10003738
486 Ga0207671_10005068
487 Ga0207693_10000028
488 Ga0207693_10009589
489 Ga0207693_10011577
490 Ga0207693_10080260
491 Ga0207693_10234087
492 Ga0207662_10008747
493 Ga0207650_10230489
494 Ga0207687_10013748
495 Ga0207687_10137557
496 Ga0207664_10000046
497 Ga0207664_10003020
498 Ga0207664_10152178
499 Ga0207644_10143212
500 Ga0207690_10000798
501 Ga0207706_10031240
502 Ga0207686_10277572
503 Ga0207686_10363174
504 Ga0207709_10001671
505 Ga0207709_10013607
506 Ga0207670_10027600
507 Ga0207669_10127643
508 Ga0207669_10148847
509 Ga0207704_10104214
510 Ga0207665_10125235
511 Ga0207711_10028754
512 Ga0207689_10052270
513 Ga0207689_10075452
514 Ga0207661_10021114
515 Ga0207661_10055739
516 Ga0207661_10170684
517 Ga0207661_10188163
518 Ga0207679_10053766
519 Ga0207679_10140608
520 Ga0207679_10143769
521 Ga0207712_10008365
522 Ga0207640_10026964
523 Ga0207640_10097173
524 Ga0207677_10026769
525 Ga0207703_10234666
526 Ga0207678_10221082
527 Ga0207708_10000612
528 Ga0207708_10005793
529 Ga0207708_10018497
530 Ga0207648_10035760
531 Ga0207648_10236569
532 Ga0207676_10045237
533 Ga0207676_10052163
534 Ga0207676_10319840
535 Ga0207674_10022945
536 Ga0207674_10141232
537 Ga0207683_10037991
538 Ga0207683_10095910
539 Ga0207683_10156244
540 Ga0207698_10106537
541 Ga0207698_10213233
542 Ga0207428_10037191
543 Ga0207428_10222744
544 Ga0268266_10202825
545 Ga0268265_10201579
546 Ga0268264_10072667
547 Ga0265326_10000030
548 Ga0265334_10000026
549 Ga0265338_10000536
550 Ga0265327_10011196
551 Ga0307413_10125873
552 Ga0307413_10162178
553 Ga0307407_10257832
554 Ga0307409_100464108
555 Ga0307409_100631315
556 Ga0307416_100043418
557 Ga0307414_10473669
558 Ga0307415_100241408
559 Ga0307415_100315346
560 Ga0307415_100447648
561 Ga0373953_0020804
562 Ga0373943_0087275
563 Ga0373931_0197035
564 Ga0373947_0206025
565 Ga0395899_0203076
566 Ga0395898_0001439
567 Ga0436364_0091249
568 Ga0436364_0527355
569 Ga0436364_1096798
570 Ga0395901_0157904
571 Ga0436365_0031167
572 Ga0436365_0307913
573 Ga0436365_0639034
574 Ga0436365_1570308
575 Ga0436363_0779769
576 Ga0436363_1564477
577 Ga0436362_0707868
578 Ga0451791_0997164
579 Ga0466969_0026125
580 Ga0466966_0040983
581 Ga0466966_0097009
582 Ga0466961_0002526
583 Ga0466961_0046520
584 Ga0466963_0003616
585 Ga0466963_0017937
586 Ga0466963_0105070
587 Ga0466963_0106442
588 Ga0466963_0184816
589 Ga0466963_0185925
590 Ga0466957_0130788
591 Ga0466959_0005555
592 Ga0466959_0052220
593 Ga0466959_0200828
594 Ga0466958_0018761
595 Ga0466958_0026255
596 Ga0466958_0037581
597 Ga0466967_0001673
598 Ga0466967_0034830
599 Ga0466967_0048986
600 Ga0466967_0072721
601 Ga0466967_0225122
602 Ga0466967_0505742
603 Ga0495603_0118287
604 Ga0495641_0132882
605 Ga0495651_0076794
606 Ga0495653_0132742
607 Ga0495582_0215576
608 Ga0495664_0028182
609 Ga0495608_0013343
610 Ga0495618_0000054
611 Ga0495618_0026466
612 Ga0495620_0104779
613 Ga0495628_0171809
614 Ga0495630_0000548
615 Ga0495587_0051729
616 Ga0495645_0000354
617 Ga0495645_0007378
618 Ga0495667_0041334
619 Ga0495634_0027425
620 Ga0495635_0022679
621 Ga0495588_0155299
622 Ga0495657_0000006
623 Ga0495657_0012221
624 Ga0495600_0053163
625 Ga0495604_0001012
626 Ga0495604_0252898
627 Ga0495679_037124
628 Ga0495684_0010650
629 Ga0495602_0031326
630 Ga0495602_0176085
631 Ga0496100_0075031
632 Ga0496101_0037333
633 Ga0496102_0000096
634 Ga0496102_0031581
635 Ga0496102_0186294
636 Ga0496102_0304904
637 Ga0496103_0000035
638 Ga0496103_0032531
639 Ga0496104_0000028
640 Ga0496104_0296055
641 Ga0496104_0344337
642 Ga0496105_0005730
643 Ga0496105_0069736
644 Ga0496105_0418089
645 Ga0496106_0071735
646 Ga0496106_0124269
647 Ga0496108_0005762
648 Ga0496108_0105369
649 Ga0496108_0119460
650 Ga0496108_0212188
651 Ga0496109_0001442
652 Ga0496109_0041405
653 Ga0496109_0113219
654 Ga0496109_0290141
655 Ga0496110_0000666
656 Ga0496110_0082384
657 Ga0496110_0348251
658 Ga0496111_0000229
659 Ga0496111_0007589
660 Ga0496111_0065359
661 Ga0496112_0000418
662 Ga0496112_0015398
663 Ga0496112_0060134
664 Ga0496112_0078911
665 Ga0496112_0245367
666 Ga0496113_0008000
667 Ga0496113_0009681
668 Ga0496113_0026668
669 Ga0496113_0065039
670 Ga0496114_0047748
671 Ga0496115_0000101
672 Ga0496115_0000198
673 Ga0496119_0124130
674 Ga0501031_0047463
675 Ga0501031_0114652
676 Ga0501033_0109935
677 Ga0501036_0031603
678 Ga0501037_0206748
679 Ga0501039_0124650
680 Ga0501040_0045664
681 Ga0501040_0137600
682 Ga0501040_0149126
683 Ga0501041_0012904
684 Ga0501041_0065501
685 Ga0501042_0041917
686 Ga0501042_0077681
687 Ga0501043_0223297
688 Ga0501046_0063082
689 Ga0501048_0057430
690 Ga0501048_0091412
691 Ga0501071_0006936
692 Ga0501071_0125649
693 Ga0501071_0155733
694 Ga0501071_0189169
695 Ga0501072_0020120
696 Ga0501072_0063817
697 Ga0501074_0095350
698 Ga0501074_0126541
699 Ga0501075_0064903
700 Ga0501075_0071220
701 Ga0501076_0168434
702 Ga0501076_0265226
703 Ga0501077_0018912
704 Ga0501079_0028212
705 Ga0501080_0066715
706 Ga0501081_0226618
707 Ga0501083_0199045
708 Ga0501045_0045286
709 Ga0501045_0087552
710 nmdc:mga03n38_89988_c1
711 nmdc:mga09592_18270_c1
712 nmdc:mga0qj67_21208_c1
713 nmdc:mga06r32_154620_c1
714 nmdc:mga08y16_66393_c1
715 nmdc:mga08y16_68312_c1
716 nmdc:mga0n895_17909_c1
717 nmdc:mga0rr50_42542_c1
718 nmdc:mga08x19_41462_c1
719 nmdc:mga0a205_41021_c2
720 Ga0495601_0000577
721 Ga0495601_0136211
722 Ga0495612_0000176
723 Ga0495619_0055384
724 Ga0501084_0177974
725 Ga0501082_0032945
726 Ga0466962_0070654
727 Ga0530510_0024480
728 Ga0530510_0032492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

10

266

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l46-assembly1.cif.gz_A crystal structure of human dimethylglycine-dehydrogenase 0.8925 6 313
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.8871 4 312
4paa-assembly2.cif.gz_B crystal structure of the mature form of rat dmgdh complexed with tetrahydrofolate 0.8861 6 313
1yx2-assembly1.cif.gz_A crystal structure of the probable aminomethyltransferase from bacillus subtilis 0.8856 6 312
4pab-assembly2.cif.gz_B crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate 0.8831 6 315
ID Description Score Start End Superfamily
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9391 25 112 3.30.70.1400
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9187 25 112 3.30.70.1400
4paaA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9125 26 112 3.30.70.1400
3girA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9113 27 110 3.30.70.1400
af_P9WN51_56_141_3.30.1360.120 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 0.9062 25 112 3.30.1360.120
ID Description Score Start End GO Terms
AF-A0A0K2RGR9-F1-model_v4 Aminomethyltransferase 0.9583 6 131 GO:0005829
GO:0008168
GO:0032259
AF-A0A6J4S0H5-F1-model_v4 tRNA-modifying protein YgfZ 0.9546 8 313 GO:0016226
AF-A0A6B3FCQ5-F1-model_v4 Glycine cleavage system protein T 0.9508 23 112 GO:0005829
AF-A0A2V7HRR6-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9455 6 132 GO:0005829
GO:0008168
GO:0032259
AF-A0A847HZ31-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9427 7 127 GO:0016226

Map