F423412

General Info

Members Datasets Scaffolds Average Seq Length
364 211 728 121

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_1438286|Ga0451577_1438286_49_414
Length 121
Sequence MPKFIAKSTVVPAAGTRPKRIEEFVGRVNSGTAVVSIARMQSPPGWVEPGQRPEFEEYTLVLSGRLRVESEHGASLDVRAGQAVIVHAGEWVRYSTPEPEGAEYIAVCLPAFSPDTVHRDV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.85
Rhizosphere 93.13
Stem 0
Stem Tuber 0
Unclassified 21.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_1438286 3300042876 Bacteria 611
2 JGI24746J21847_1027200 3300001977 Bacteria 789
3 Ga0065704_10316197 3300005289 Bacteria 860
4 Ga0065712_10018958 3300005290 Bacteria 3600
5 Ga0065712_10266402 3300005290 Unclassified 925
6 Ga0065715_10002279 3300005293 Bacteria 7440
7 Ga0065715_10035473 3300005293 Bacteria 1093
8 Ga0065707_10011978 3300005295 Unclassified 1926
9 Ga0065707_10803317 3300005295 Unclassified 585
10 Ga0070676_10021828 3300005328 Unclassified 3585
11 Ga0070676_10199983 3300005328 Bacteria 1309
12 Ga0070683_100460763 3300005329 Bacteria 1213
13 Ga0070683_101919126 3300005329 Bacteria 569
14 Ga0070690_100003214 3300005330 Bacteria 8911
15 Ga0070690_100124208 3300005330 Unclassified 1736
16 Ga0070690_100166960 3300005330 Bacteria 1512
17 Ga0070690_100350017 3300005330 Bacteria 1072
18 Ga0070670_100017233 3300005331 Bacteria 6196
19 Ga0070670_100555990 3300005331 Bacteria 1024
20 Ga0070670_100823263 3300005331 Bacteria 839
21 Ga0070677_10006282 3300005333 Bacteria 3941
22 Ga0070677_10008527 3300005333 Bacteria 3453
23 Ga0070677_10027696 3300005333 Unclassified 2136
24 Ga0068869_100023043 3300005334 Bacteria 4295
25 Ga0068869_100125204 3300005334 Unclassified 1970
26 Ga0068869_100356229 3300005334 Unclassified 1194
27 Ga0070666_10003041 3300005335 Bacteria 10181
28 Ga0068868_100023455 3300005338 Bacteria 4670
29 Ga0070660_100404396 3300005339 Bacteria 1129
30 Ga0070689_100239632 3300005340 Bacteria 1493
31 Ga0070689_100507611 3300005340 Bacteria 1034
32 Ga0070687_100016776 3300005343 Bacteria 3350
33 Ga0070687_100201504 3300005343 Bacteria 1206
34 Ga0070661_100016185 3300005344 Bacteria 5267
35 Ga0070668_100455320 3300005347 Bacteria 1101
36 Ga0070668_100666892 3300005347 Bacteria 915
37 Ga0070669_100013284 3300005353 Bacteria 5852
38 Ga0070669_100050539 3300005353 Bacteria 3037
39 Ga0070669_100244532 3300005353 Bacteria 1427
40 Ga0070669_101179231 3300005353 Unclassified 661
41 Ga0070675_100109886 3300005354 Unclassified 2331
42 Ga0070675_100174129 3300005354 Bacteria 1857
43 Ga0070675_100559829 3300005354 Bacteria 1034
44 Ga0070674_100003110 3300005356 Bacteria 9241
45 Ga0070674_100288155 3300005356 Bacteria 1304
46 Ga0070673_100064478 3300005364 Bacteria 2919
47 Ga0070673_100389262 3300005364 Unclassified 1244
48 Ga0070688_100017181 3300005365 Bacteria 4150
49 Ga0070688_100109533 3300005365 Bacteria 1834
50 Ga0070667_100413135 3300005367 Bacteria 1229
51 Ga0070709_10186705 3300005434 Bacteria 1460
52 Ga0070700_100820500 3300005441 Bacteria 751
53 Ga0070694_100073956 3300005444 Bacteria 2355
54 Ga0070663_100540097 3300005455 Unclassified 973
55 Ga0070678_100018863 3300005456 Unclassified 4480
56 Ga0070678_100040232 3300005456 Unclassified 3306
57 Ga0070678_100615462 3300005456 Bacteria 971
58 Ga0070662_100011046 3300005457 Bacteria 5946
59 Ga0070662_100421249 3300005457 Bacteria 1104
60 Ga0068867_100119012 3300005459 Bacteria 2038
61 Ga0068867_100671575 3300005459 Bacteria 911
62 Ga0068867_100767890 3300005459 Bacteria 857
63 Ga0068867_101210914 3300005459 Bacteria 694
64 Ga0068867_101580539 3300005459 Unclassified 612
65 Ga0070685_10033362 3300005466 Bacteria 2892
66 Ga0070685_11207636 3300005466 Bacteria 575
67 Ga0070706_101391976 3300005467 Unclassified 642
68 Ga0070698_100915425 3300005471 Bacteria 823
69 Ga0070684_100060779 3300005535 Bacteria 3306
70 Ga0070697_101712855 3300005536 Bacteria 562
71 Ga0068853_102029327 3300005539 Unclassified 558
72 Ga0070672_100169430 3300005543 Unclassified 1815
73 Ga0070672_100373655 3300005543 Bacteria 1218
74 Ga0070686_100065760 3300005544 Bacteria 2357
75 Ga0070686_100439809 3300005544 Bacteria 1000
76 Ga0070686_100920233 3300005544 Bacteria 712
77 Ga0070696_101351302 3300005546 Unclassified 606
78 Ga0070665_100039979 3300005548 Bacteria 4715
79 Ga0070704_100058582 3300005549 Unclassified 2744
80 Ga0070704_100444503 3300005549 Bacteria 1115
81 Ga0070664_100000997 3300005564 Bacteria 22195
82 Ga0070664_100696825 3300005564 Bacteria 946
83 Ga0068857_100060056 3300005577 Bacteria 3378
84 Ga0068857_100190890 3300005577 Bacteria 1866
85 Ga0068857_100241272 3300005577 Bacteria 1655
86 Ga0068854_100202268 3300005578 Bacteria 1562
87 Ga0068852_100051513 3300005616 Bacteria 3533
88 Ga0068859_100116512 3300005617 Unclassified 2736
89 Ga0068859_100164545 3300005617 Bacteria 2298
90 Ga0068859_101318524 3300005617 Bacteria 796
91 Ga0068859_101521210 3300005617 Bacteria 739
92 Ga0068864_100003204 3300005618 Bacteria 13509
93 Ga0068864_100072955 3300005618 Unclassified 2992
94 Ga0068866_10457613 3300005718 Bacteria 836
95 Ga0068866_11056092 3300005718 Bacteria 580
96 Ga0068861_100007780 3300005719 Bacteria 7364
97 Ga0068861_100400322 3300005719 Bacteria 1218
98 Ga0068870_10003675 3300005840 Bacteria 6516
99 Ga0068870_10030062 3300005840 Bacteria 2743
100 Ga0068870_10214578 3300005840 Bacteria 1174
101 Ga0068870_10716089 3300005840 Bacteria 692
102 Ga0068863_100020667 3300005841 Bacteria 6289
103 Ga0068863_100290242 3300005841 Bacteria 1585
104 Ga0068863_100956439 3300005841 Bacteria 858
105 Ga0068858_100079667 3300005842 Unclassified 3043
106 Ga0068860_100067581 3300005843 Bacteria 3395
107 Ga0068860_100168012 3300005843 Bacteria 2118
108 Ga0068862_100260079 3300005844 Bacteria 1584
109 Ga0068862_100388004 3300005844 Unclassified 1304
110 Ga0068862_100999870 3300005844 Unclassified 827
111 Ga0070717_10060079 3300006028 Bacteria 3147
112 Ga0070716_101466458 3300006173 Bacteria 557
113 Ga0097621_100052974 3300006237 Bacteria 3306
114 Ga0097621_100757550 3300006237 Bacteria 897
115 Ga0075370_10177995 3300006353 Unclassified 1251
116 Ga0068871_100246914 3300006358 Unclassified 1554
117 Ga0068871_100964188 3300006358 Bacteria 793
118 Ga0075428_100006656 3300006844 Bacteria 12851
119 Ga0075428_100294867 3300006844 Bacteria 1744
120 Ga0075428_100322371 3300006844 Unclassified 1660
121 Ga0075431_100019251 3300006847 Bacteria 6959
122 Ga0075431_100261005 3300006847 Unclassified 1758
123 Ga0075431_101318315 3300006847 Bacteria 683
124 Ga0075433_10019027 3300006852 Bacteria 5714
125 Ga0075433_10149421 3300006852 Unclassified 2078
126 Ga0075433_10603065 3300006852 Bacteria 964
127 Ga0075434_100194401 3300006871 Unclassified 2049
128 Ga0075429_100012396 3300006880 Bacteria 7396
129 Ga0068865_100144789 3300006881 Bacteria 1796
130 Ga0075436_100182039 3300006914 Unclassified 1485
131 Ga0097620_100116522 3300006931 Unclassified 2736
132 Ga0097620_100164560 3300006931 Bacteria 2298
133 Ga0097620_101318618 3300006931 Bacteria 796
134 Ga0097620_101520942 3300006931 Bacteria 739
135 Ga0075435_100360282 3300007076 Bacteria 1247
136 Ga0111539_10012174 3300009094 Bacteria 10792
137 Ga0111539_10040886 3300009094 Bacteria 5579
138 Ga0111539_10365483 3300009094 Unclassified 1679
139 Ga0111539_10812754 3300009094 Bacteria 1088
140 Ga0105245_11172714 3300009098 Bacteria 816
141 Ga0105245_11180771 3300009098 Unclassified 813
142 Ga0105245_12606916 3300009098 Bacteria 559
143 Ga0105247_10288152 3300009101 Bacteria 1135
144 Ga0114129_10049764 3300009147 Bacteria 5888
145 Ga0105242_10107146 3300009176 Bacteria 2377
146 Ga0105242_10321394 3300009176 Unclassified 1419
147 Ga0105248_10100125 3300009177 Bacteria 3265
148 Ga0105248_10243348 3300009177 Bacteria 2025
149 Ga0105248_10269735 3300009177 Bacteria 1916
150 Ga0105248_10531113 3300009177 Bacteria 1327
151 Ga0105248_12288642 3300009177 Unclassified 615
152 Ga0105237_10559475 3300009545 Bacteria 1150
153 Ga0105238_10016437 3300009551 Bacteria 7490
154 Ga0105249_10016819 3300009553 Bacteria 6490
155 Ga0105249_10020289 3300009553 Bacteria 5942
156 Ga0105249_10105092 3300009553 Bacteria 2662
157 Ga0105249_13439800 3300009553 Unclassified 510
158 Ga0105246_10753991 3300011119 Unclassified 859
159 Ga0105246_10891667 3300011119 Bacteria 797
160 Ga0105246_11018514 3300011119 Bacteria 751
161 Ga0105246_11401376 3300011119 Bacteria 652
162 Ga0157371_10044901 3300013102 Bacteria 3145
163 Ga0157374_10104401 3300013296 Bacteria 2720
164 Ga0157378_10020751 3300013297 Bacteria 5778
165 Ga0163162_10131580 3300013306 Bacteria 2610
166 Ga0163162_10353728 3300013306 Bacteria 1601
167 Ga0157372_12063906 3300013307 Bacteria 655
168 Ga0157375_10324045 3300013308 Bacteria 1705
169 Ga0157375_10719489 3300013308 Bacteria 1151
170 Ga0157375_10812977 3300013308 Bacteria 1083
171 Ga0157375_11726124 3300013308 Bacteria 741
172 Ga0163163_10002507 3300014325 Bacteria 15541
173 Ga0163163_10068408 3300014325 Bacteria 3534
174 Ga0163163_10339147 3300014325 Unclassified 1558
175 Ga0163163_10448765 3300014325 Bacteria 1350
176 Ga0157380_10152415 3300014326 Bacteria 2000
177 Ga0157380_10693022 3300014326 Bacteria 1023
178 Ga0157380_10965015 3300014326 Bacteria 883
179 Ga0157380_11815274 3300014326 Unclassified 669
180 Ga0157380_12186644 3300014326 Bacteria 617
181 Ga0157377_10019199 3300014745 Bacteria 3569
182 Ga0157379_10094629 3300014968 Unclassified 2681
183 Ga0157379_10677283 3300014968 Bacteria 967
184 Ga0157379_12415670 3300014968 Unclassified 525
185 Ga0157376_10072033 3300014969 Unclassified 2938
186 Ga0157376_12016823 3300014969 Bacteria 615
187 Ga0157376_12109831 3300014969 Bacteria 602
188 Ga0163161_10010749 3300017792 Bacteria 6342
189 Ga0163161_10166787 3300017792 Bacteria 1682
190 Ga0213876_10375615 3300021384 Unclassified 756
191 Ga0213875_10015901 3300021388 Bacteria 3656
192 Ga0228598_1018964 3300024227 Bacteria 1356
193 Ga0207666_1030189 3300025271 Bacteria 828
194 Ga0207673_1048311 3300025290 Bacteria 602
195 Ga0207697_10002931 3300025315 Bacteria 8627
196 Ga0207682_10026969 3300025893 Bacteria 2286
197 Ga0207642_10056064 3300025899 Bacteria 1806
198 Ga0207688_10020378 3300025901 Bacteria 3620
199 Ga0207688_10025000 3300025901 Bacteria 3277
200 Ga0207680_10089606 3300025903 Bacteria 1953
201 Ga0207685_10254266 3300025905 Bacteria 851
202 Ga0207699_10075985 3300025906 Bacteria 2068
203 Ga0207645_10000065 3300025907 Bacteria 76331
204 Ga0207645_10028006 3300025907 Bacteria 3637
205 Ga0207643_10001402 3300025908 Bacteria 13819
206 Ga0207643_10055581 3300025908 Bacteria 2251
207 Ga0207643_10123226 3300025908 Bacteria 1537
208 Ga0207705_10183551 3300025909 Unclassified 1580
209 Ga0207707_10023943 3300025912 Bacteria 5338
210 Ga0207663_10178604 3300025916 Bacteria 1514
211 Ga0207662_10003411 3300025918 Bacteria 8177
212 Ga0207649_10029659 3300025920 Bacteria 3232
213 Ga0207681_10109160 3300025923 Bacteria 2010
214 Ga0207681_10195948 3300025923 Bacteria 1548
215 Ga0207681_10742736 3300025923 Unclassified 818
216 Ga0207694_10006257 3300025924 Bacteria 9091
217 Ga0207650_10082759 3300025925 Unclassified 2437
218 Ga0207650_10311323 3300025925 Bacteria 1288
219 Ga0207659_10013944 3300025926 Bacteria 5170
220 Ga0207659_10022180 3300025926 Unclassified 4225
221 Ga0207706_10010467 3300025933 Bacteria 8475
222 Ga0207706_10508088 3300025933 Bacteria 1040
223 Ga0207686_10185007 3300025934 Bacteria 1480
224 Ga0207709_10614333 3300025935 Bacteria 862
225 Ga0207669_10001475 3300025937 Bacteria 10046
226 Ga0207669_10843047 3300025937 Bacteria 762
227 Ga0207704_10143770 3300025938 Unclassified 1673
228 Ga0207665_10176603 3300025939 Bacteria 1545
229 Ga0207691_10006683 3300025940 Bacteria 11128
230 Ga0207691_10061690 3300025940 Bacteria 3405
231 Ga0207691_10236050 3300025940 Bacteria 1582
232 Ga0207711_10055238 3300025941 Bacteria 3410
233 Ga0207711_10291769 3300025941 Unclassified 1503
234 Ga0207689_10023635 3300025942 Bacteria 5154
235 Ga0207689_10084903 3300025942 Bacteria 2602
236 Ga0207689_10279070 3300025942 Bacteria 1384
237 Ga0207689_10355697 3300025942 Bacteria 1218
238 Ga0207679_10327546 3300025945 Bacteria 1328
239 Ga0207679_10502805 3300025945 Bacteria 1082
240 Ga0207667_10352874 3300025949 Bacteria 1500
241 Ga0207651_10059346 3300025960 Unclassified 2650
242 Ga0207712_10474560 3300025961 Bacteria 1065
243 Ga0207668_10135601 3300025972 Bacteria 1886
244 Ga0207668_10303086 3300025972 Bacteria 1319
245 Ga0207640_10950354 3300025981 Bacteria 753
246 Ga0207658_10297656 3300025986 Bacteria 1389
247 Ga0207677_10014774 3300026023 Bacteria 4571
248 Ga0207703_10089980 3300026035 Unclassified 2578
249 Ga0207703_10114027 3300026035 Bacteria 2311
250 Ga0207703_10648687 3300026035 Bacteria 1001
251 Ga0207703_11519927 3300026035 Bacteria 644
252 Ga0207708_10316406 3300026075 Bacteria 1273
253 Ga0207702_10150482 3300026078 Bacteria 2116
254 Ga0207702_12106180 3300026078 Bacteria 554
255 Ga0207641_10056279 3300026088 Bacteria 3341
256 Ga0207641_10263041 3300026088 Bacteria 1616
257 Ga0207641_11309631 3300026088 Bacteria 725
258 Ga0207648_10014525 3300026089 Bacteria 7271
259 Ga0207648_10056759 3300026089 Bacteria 3416
260 Ga0207648_11706056 3300026089 Bacteria 591
261 Ga0207676_10108614 3300026095 Bacteria 2316
262 Ga0207676_10745235 3300026095 Bacteria 952
263 Ga0207674_10039936 3300026116 Bacteria 4862
264 Ga0207674_10134093 3300026116 Bacteria 2439
265 Ga0207674_10497370 3300026116 Bacteria 1178
266 Ga0207674_10732392 3300026116 Bacteria 954
267 Ga0207675_100011795 3300026118 Bacteria 8169
268 Ga0207675_100082385 3300026118 Bacteria 3017
269 Ga0207675_100344841 3300026118 Unclassified 1458
270 Ga0207675_100674980 3300026118 Bacteria 1041
271 Ga0207683_10063130 3300026121 Bacteria 3263
272 Ga0207683_10351758 3300026121 Bacteria 1352
273 Ga0209983_1089880 3300027665 Bacteria 691
274 Ga0209813_10217798 3300027866 Unclassified 713
275 Ga0209974_10084900 3300027876 Unclassified 1093
276 Ga0207428_10000929 3300027907 Bacteria 32620
277 Ga0207428_10016906 3300027907 Bacteria 6269
278 Ga0268266_12078739 3300028379 Bacteria 541
279 Ga0268265_10089035 3300028380 Unclassified 2461
280 Ga0268265_10107214 3300028380 Bacteria 2271
281 Ga0268265_10146509 3300028380 Unclassified 1985
282 Ga0268265_10259853 3300028380 Bacteria 1543
283 Ga0268264_10393065 3300028381 Bacteria 1331
284 Ga0268264_11121553 3300028381 Bacteria 795
285 Ga0265332_10197818 3300031238 Unclassified 836
286 Ga0265339_10424690 3300031249 Unclassified 619
287 Ga0265327_10008223 3300031251 Bacteria 7822
288 Ga0265314_10035593 3300031711 Unclassified 3628
289 Ga0265314_10106470 3300031711 Bacteria 1791
290 Ga0307406_11991717 3300031901 Unclassified 519
291 Ga0307411_11651936 3300032005 Bacteria 592
292 Ga0373949_0066806 3300035090 Unclassified 935
293 Ga0373932_0444817 3300035112 Bacteria 508
294 Ga0373931_0214223 3300035691 Bacteria 1157
295 Ga0373947_0495218 3300035725 Bacteria 830
296 Ga0373937_0065692 3300036401 Unclassified 3340
297 Ga0373925_0743109 3300037068 Bacteria 809
298 Ga0395905_0152430 3300037471 Bacteria 2174
299 Ga0436364_0335500 3300037853 Bacteria 13452
300 Ga0436364_1200220 3300037853 Bacteria 2254
301 Ga0242420_128080 3300038996 Unclassified 558
302 Ga0436365_0019377 3300039437 Unclassified 767
303 Ga0436365_0574474 3300039437 Unclassified 717
304 Ga0436365_1921183 3300039437 Unclassified 1489
305 Ga0436363_1101485 3300039450 Unclassified 1123
306 Ga0436363_1119033 3300039450 Bacteria 1155
307 Ga0439462_0176819 3300042015 Bacteria 604
308 Ga0439434_0042414 3300042435 Bacteria 1399
309 Ga0451577_0008519 3300042876 Bacteria 9974
310 Ga0439440_0032308 3300042993 Unclassified 1242
311 Ga0453683_0516905 3300044673 Bacteria 775
312 Ga0453683_0867439 3300044673 Bacteria 596
313 Ga0466965_0419829 3300044683 Bacteria 741
314 Ga0466961_0288243 3300044693 Bacteria 1004
315 Ga0453684_1623322 3300044712 Bacteria 663
316 Ga0466957_0197837 3300044842 Bacteria 1319
317 Ga0466959_0064329 3300045049 Bacteria 2663
318 Ga0451576_0596834 3300045051 Unclassified 1160
319 Ga0466958_0385531 3300045836 Bacteria 904
320 Ga0466967_0951815 3300045976 Bacteria 855
321 Ga0495663_0348546 3300046525 Bacteria 539
322 Ga0495621_0382039 3300046539 Unclassified 595
323 Ga0495621_0474937 3300046539 Bacteria 537
324 Ga0495656_0436797 3300046615 Bacteria 688
325 Ga0495647_0032571 3300046681 Bacteria 1943
326 Ga0496103_0110082 3300048906 Bacteria 1749
327 Ga0496104_0002905 3300048907 Bacteria 14762
328 Ga0496105_0003476 3300048908 Bacteria 11656
329 Ga0496106_0598616 3300048909 Bacteria 883
330 Ga0496108_0003620 3300048911 Bacteria 12378
331 Ga0496109_0006217 3300048912 Bacteria 10037
332 Ga0496109_0042718 3300048912 Bacteria 4108
333 Ga0496110_0008858 3300048913 Bacteria 8109
334 Ga0496110_1229912 3300048913 Bacteria 658
335 Ga0496111_0002960 3300048914 Bacteria 10399
336 Ga0496112_0022386 3300048915 Bacteria 6023
337 Ga0496113_0001404 3300048916 Bacteria 13405
338 Ga0496113_0875486 3300048916 Bacteria 711
339 Ga0496115_1387547 3300048918 Bacteria 519
340 Ga0501034_1437448 3300049571 Bacteria 564
341 Ga0501040_0049133 3300049576 Bacteria 2884
342 Ga0501042_0412969 3300049578 Bacteria 978
343 Ga0501047_0946307 3300049581 Bacteria 675
344 Ga0501071_0786144 3300049587 Unclassified 734
345 Ga0501075_0409823 3300049591 Bacteria 1033
346 Ga0501076_1107930 3300049592 Bacteria 652
347 Ga0501080_0002997 3300049742 Bacteria 14889
348 Ga0501081_0705018 3300049743 Bacteria 758
349 Ga0501083_0023058 3300049744 Unclassified 4320
350 nmdc:mga09592_31311_c1 3300050508 Bacteria 4432
351 nmdc:mga09592_455441_c1 3300050508 Bacteria 1103
352 nmdc:mga0qj67_39164_c1 3300050509 Bacteria 3721
353 nmdc:mga06r32_290791_c1 3300050510 Bacteria 1621
354 nmdc:mga06r32_919854_c1 3300050510 Bacteria 830
355 nmdc:mga08y16_153106_c1 3300050511 Unclassified 2397
356 nmdc:mga08y16_164661_c1 3300050511 Bacteria 2304
357 nmdc:mga08y16_328484_c1 3300050511 Unclassified 1574
358 nmdc:mga08y16_685282_c1 3300050511 Unclassified 1026
359 nmdc:mga0n895_248981_c1 3300050512 Unclassified 1803
360 nmdc:mga0rr50_107613_c1 3300050513 Bacteria 2201
361 nmdc:mga08x19_260601_c1 3300050514 Unclassified 1198
362 nmdc:mga0a205_25676_c1 3300050515 Bacteria 5615
363 nmdc:mga0a205_287511_c2 3300050515 Bacteria 1179
364 Ga0501082_1225045 3300060353 Bacteria 656
365 Ga0451577_1438286
366 JGI24746J21847_1027200
367 Ga0065704_10316197
368 Ga0065712_10018958
369 Ga0065712_10266402
370 Ga0065715_10002279
371 Ga0065715_10035473
372 Ga0065707_10011978
373 Ga0065707_10803317
374 Ga0070676_10021828
375 Ga0070676_10199983
376 Ga0070683_100460763
377 Ga0070683_101919126
378 Ga0070690_100003214
379 Ga0070690_100124208
380 Ga0070690_100166960
381 Ga0070690_100350017
382 Ga0070670_100017233
383 Ga0070670_100555990
384 Ga0070670_100823263
385 Ga0070677_10006282
386 Ga0070677_10008527
387 Ga0070677_10027696
388 Ga0068869_100023043
389 Ga0068869_100125204
390 Ga0068869_100356229
391 Ga0070666_10003041
392 Ga0068868_100023455
393 Ga0070660_100404396
394 Ga0070689_100239632
395 Ga0070689_100507611
396 Ga0070687_100016776
397 Ga0070687_100201504
398 Ga0070661_100016185
399 Ga0070668_100455320
400 Ga0070668_100666892
401 Ga0070669_100013284
402 Ga0070669_100050539
403 Ga0070669_100244532
404 Ga0070669_101179231
405 Ga0070675_100109886
406 Ga0070675_100174129
407 Ga0070675_100559829
408 Ga0070674_100003110
409 Ga0070674_100288155
410 Ga0070673_100064478
411 Ga0070673_100389262
412 Ga0070688_100017181
413 Ga0070688_100109533
414 Ga0070667_100413135
415 Ga0070709_10186705
416 Ga0070700_100820500
417 Ga0070694_100073956
418 Ga0070663_100540097
419 Ga0070678_100018863
420 Ga0070678_100040232
421 Ga0070678_100615462
422 Ga0070662_100011046
423 Ga0070662_100421249
424 Ga0068867_100119012
425 Ga0068867_100671575
426 Ga0068867_100767890
427 Ga0068867_101210914
428 Ga0068867_101580539
429 Ga0070685_10033362
430 Ga0070685_11207636
431 Ga0070706_101391976
432 Ga0070698_100915425
433 Ga0070684_100060779
434 Ga0070697_101712855
435 Ga0068853_102029327
436 Ga0070672_100169430
437 Ga0070672_100373655
438 Ga0070686_100065760
439 Ga0070686_100439809
440 Ga0070686_100920233
441 Ga0070696_101351302
442 Ga0070665_100039979
443 Ga0070704_100058582
444 Ga0070704_100444503
445 Ga0070664_100000997
446 Ga0070664_100696825
447 Ga0068857_100060056
448 Ga0068857_100190890
449 Ga0068857_100241272
450 Ga0068854_100202268
451 Ga0068852_100051513
452 Ga0068859_100116512
453 Ga0068859_100164545
454 Ga0068859_101318524
455 Ga0068859_101521210
456 Ga0068864_100003204
457 Ga0068864_100072955
458 Ga0068866_10457613
459 Ga0068866_11056092
460 Ga0068861_100007780
461 Ga0068861_100400322
462 Ga0068870_10003675
463 Ga0068870_10030062
464 Ga0068870_10214578
465 Ga0068870_10716089
466 Ga0068863_100020667
467 Ga0068863_100290242
468 Ga0068863_100956439
469 Ga0068858_100079667
470 Ga0068860_100067581
471 Ga0068860_100168012
472 Ga0068862_100260079
473 Ga0068862_100388004
474 Ga0068862_100999870
475 Ga0070717_10060079
476 Ga0070716_101466458
477 Ga0097621_100052974
478 Ga0097621_100757550
479 Ga0075370_10177995
480 Ga0068871_100246914
481 Ga0068871_100964188
482 Ga0075428_100006656
483 Ga0075428_100294867
484 Ga0075428_100322371
485 Ga0075431_100019251
486 Ga0075431_100261005
487 Ga0075431_101318315
488 Ga0075433_10019027
489 Ga0075433_10149421
490 Ga0075433_10603065
491 Ga0075434_100194401
492 Ga0075429_100012396
493 Ga0068865_100144789
494 Ga0075436_100182039
495 Ga0097620_100116522
496 Ga0097620_100164560
497 Ga0097620_101318618
498 Ga0097620_101520942
499 Ga0075435_100360282
500 Ga0111539_10012174
501 Ga0111539_10040886
502 Ga0111539_10365483
503 Ga0111539_10812754
504 Ga0105245_11172714
505 Ga0105245_11180771
506 Ga0105245_12606916
507 Ga0105247_10288152
508 Ga0114129_10049764
509 Ga0105242_10107146
510 Ga0105242_10321394
511 Ga0105248_10100125
512 Ga0105248_10243348
513 Ga0105248_10269735
514 Ga0105248_10531113
515 Ga0105248_12288642
516 Ga0105237_10559475
517 Ga0105238_10016437
518 Ga0105249_10016819
519 Ga0105249_10020289
520 Ga0105249_10105092
521 Ga0105249_13439800
522 Ga0105246_10753991
523 Ga0105246_10891667
524 Ga0105246_11018514
525 Ga0105246_11401376
526 Ga0157371_10044901
527 Ga0157374_10104401
528 Ga0157378_10020751
529 Ga0163162_10131580
530 Ga0163162_10353728
531 Ga0157372_12063906
532 Ga0157375_10324045
533 Ga0157375_10719489
534 Ga0157375_10812977
535 Ga0157375_11726124
536 Ga0163163_10002507
537 Ga0163163_10068408
538 Ga0163163_10339147
539 Ga0163163_10448765
540 Ga0157380_10152415
541 Ga0157380_10693022
542 Ga0157380_10965015
543 Ga0157380_11815274
544 Ga0157380_12186644
545 Ga0157377_10019199
546 Ga0157379_10094629
547 Ga0157379_10677283
548 Ga0157379_12415670
549 Ga0157376_10072033
550 Ga0157376_12016823
551 Ga0157376_12109831
552 Ga0163161_10010749
553 Ga0163161_10166787
554 Ga0213876_10375615
555 Ga0213875_10015901
556 Ga0228598_1018964
557 Ga0207666_1030189
558 Ga0207673_1048311
559 Ga0207697_10002931
560 Ga0207682_10026969
561 Ga0207642_10056064
562 Ga0207688_10020378
563 Ga0207688_10025000
564 Ga0207680_10089606
565 Ga0207685_10254266
566 Ga0207699_10075985
567 Ga0207645_10000065
568 Ga0207645_10028006
569 Ga0207643_10001402
570 Ga0207643_10055581
571 Ga0207643_10123226
572 Ga0207705_10183551
573 Ga0207707_10023943
574 Ga0207663_10178604
575 Ga0207662_10003411
576 Ga0207649_10029659
577 Ga0207681_10109160
578 Ga0207681_10195948
579 Ga0207681_10742736
580 Ga0207694_10006257
581 Ga0207650_10082759
582 Ga0207650_10311323
583 Ga0207659_10013944
584 Ga0207659_10022180
585 Ga0207706_10010467
586 Ga0207706_10508088
587 Ga0207686_10185007
588 Ga0207709_10614333
589 Ga0207669_10001475
590 Ga0207669_10843047
591 Ga0207704_10143770
592 Ga0207665_10176603
593 Ga0207691_10006683
594 Ga0207691_10061690
595 Ga0207691_10236050
596 Ga0207711_10055238
597 Ga0207711_10291769
598 Ga0207689_10023635
599 Ga0207689_10084903
600 Ga0207689_10279070
601 Ga0207689_10355697
602 Ga0207679_10327546
603 Ga0207679_10502805
604 Ga0207667_10352874
605 Ga0207651_10059346
606 Ga0207712_10474560
607 Ga0207668_10135601
608 Ga0207668_10303086
609 Ga0207640_10950354
610 Ga0207658_10297656
611 Ga0207677_10014774
612 Ga0207703_10089980
613 Ga0207703_10114027
614 Ga0207703_10648687
615 Ga0207703_11519927
616 Ga0207708_10316406
617 Ga0207702_10150482
618 Ga0207702_12106180
619 Ga0207641_10056279
620 Ga0207641_10263041
621 Ga0207641_11309631
622 Ga0207648_10014525
623 Ga0207648_10056759
624 Ga0207648_11706056
625 Ga0207676_10108614
626 Ga0207676_10745235
627 Ga0207674_10039936
628 Ga0207674_10134093
629 Ga0207674_10497370
630 Ga0207674_10732392
631 Ga0207675_100011795
632 Ga0207675_100082385
633 Ga0207675_100344841
634 Ga0207675_100674980
635 Ga0207683_10063130
636 Ga0207683_10351758
637 Ga0209983_1089880
638 Ga0209813_10217798
639 Ga0209974_10084900
640 Ga0207428_10000929
641 Ga0207428_10016906
642 Ga0268266_12078739
643 Ga0268265_10089035
644 Ga0268265_10107214
645 Ga0268265_10146509
646 Ga0268265_10259853
647 Ga0268264_10393065
648 Ga0268264_11121553
649 Ga0265332_10197818
650 Ga0265339_10424690
651 Ga0265327_10008223
652 Ga0265314_10035593
653 Ga0265314_10106470
654 Ga0307406_11991717
655 Ga0307411_11651936
656 Ga0373949_0066806
657 Ga0373932_0444817
658 Ga0373931_0214223
659 Ga0373947_0495218
660 Ga0373937_0065692
661 Ga0373925_0743109
662 Ga0395905_0152430
663 Ga0436364_0335500
664 Ga0436364_1200220
665 Ga0242420_128080
666 Ga0436365_0019377
667 Ga0436365_0574474
668 Ga0436365_1921183
669 Ga0436363_1101485
670 Ga0436363_1119033
671 Ga0439462_0176819
672 Ga0439434_0042414
673 Ga0451577_0008519
674 Ga0439440_0032308
675 Ga0453683_0516905
676 Ga0453683_0867439
677 Ga0466965_0419829
678 Ga0466961_0288243
679 Ga0453684_1623322
680 Ga0466957_0197837
681 Ga0466959_0064329
682 Ga0451576_0596834
683 Ga0466958_0385531
684 Ga0466967_0951815
685 Ga0495663_0348546
686 Ga0495621_0382039
687 Ga0495621_0474937
688 Ga0495656_0436797
689 Ga0495647_0032571
690 Ga0496103_0110082
691 Ga0496104_0002905
692 Ga0496105_0003476
693 Ga0496106_0598616
694 Ga0496108_0003620
695 Ga0496109_0006217
696 Ga0496109_0042718
697 Ga0496110_0008858
698 Ga0496110_1229912
699 Ga0496111_0002960
700 Ga0496112_0022386
701 Ga0496113_0001404
702 Ga0496113_0875486
703 Ga0496115_1387547
704 Ga0501034_1437448
705 Ga0501040_0049133
706 Ga0501042_0412969
707 Ga0501047_0946307
708 Ga0501071_0786144
709 Ga0501075_0409823
710 Ga0501076_1107930
711 Ga0501080_0002997
712 Ga0501081_0705018
713 Ga0501083_0023058
714 nmdc:mga09592_31311_c1
715 nmdc:mga09592_455441_c1
716 nmdc:mga0qj67_39164_c1
717 nmdc:mga06r32_290791_c1
718 nmdc:mga06r32_919854_c1
719 nmdc:mga08y16_153106_c1
720 nmdc:mga08y16_164661_c1
721 nmdc:mga08y16_328484_c1
722 nmdc:mga08y16_685282_c1
723 nmdc:mga0n895_248981_c1
724 nmdc:mga0rr50_107613_c1
725 nmdc:mga08x19_260601_c1
726 nmdc:mga0a205_25676_c1
727 nmdc:mga0a205_287511_c2
728 Ga0501082_1225045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

38

108

0.93

PF05899

Cupin_3

EutQ-like cupin domain

30

100

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9192 19 108
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9071 32 108
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8999 19 109
6a55-assembly1.cif.gz_B crystal structure of dddk mutant y122a 0.8971 19 111
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.8965 19 112
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9378 34 108 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9279 33 120 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9239 19 108 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9 19 108 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8996 19 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B8YZF2-F1-model_v4 Cupin 1.002 1 121
AF-A0A812XGP2-F1-model_v4 deleted 1.002 1 118
AF-Q2IDL1-F1-model_v4 Cupin domain protein 1.001 1 120
AF-A0A6P0P3D4-F1-model_v4 Cupin domain-containing protein 0.9997 1 121
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9992 1 120

Map