F423290

General Info

Members Datasets Scaffolds Average Seq Length
364 204 728 69

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10405248|Ga0114129_104052482
Length 84
Sequence MKVREIEAIRPQGETMKRYAVVIEKADGNYSAYVPDLPGCVATGPTVAAIEAESRDAVRLHIEGLQADGLEVPEPTSIAEYVEA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 17.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10405248 3300009147 Bacteria 1797
2 JGI25406J46586_10111251 3300003203 Bacteria 810
3 JGI25405J52794_10076938 3300003911 Unclassified 732
4 Ga0070658_10455432 3300005327 Bacteria 1103
5 Ga0070683_100114728 3300005329 Bacteria 2543
6 Ga0070683_100825886 3300005329 Bacteria 889
7 Ga0068869_100290630 3300005334 Unclassified 1317
8 Ga0070680_100506992 3300005336 Bacteria 1033
9 Ga0070660_100894393 3300005339 Bacteria 749
10 Ga0070661_101259455 3300005344 Bacteria 620
11 Ga0070661_101522838 3300005344 Unclassified 564
12 Ga0070669_100211743 3300005353 Unclassified 1529
13 Ga0070673_100426723 3300005364 Unclassified 1189
14 Ga0070673_102199304 3300005364 Unclassified 524
15 Ga0070688_100140787 3300005365 Unclassified 1638
16 Ga0070709_10565530 3300005434 Bacteria 872
17 Ga0070714_100017554 3300005435 Bacteria 5800
18 Ga0070714_100834508 3300005435 Unclassified 893
19 Ga0070700_100169887 3300005441 Unclassified 1509
20 Ga0070700_101576467 3300005441 Unclassified 560
21 Ga0070700_101931182 3300005441 Unclassified 511
22 Ga0070694_100159652 3300005444 Unclassified 1653
23 Ga0070708_100119480 3300005445 Bacteria 2430
24 Ga0070662_100775239 3300005457 Bacteria 814
25 Ga0070681_10464930 3300005458 Bacteria 1178
26 Ga0068867_101364671 3300005459 Bacteria 656
27 Ga0074259_10434643 3300005507 Unclassified 505
28 Ga0070679_100196867 3300005530 Bacteria 1982
29 Ga0070679_100581437 3300005530 Bacteria 1063
30 Ga0070684_100242588 3300005535 Bacteria 1647
31 Ga0070684_100573721 3300005535 Bacteria 1048
32 Ga0070697_100362578 3300005536 Bacteria 1253
33 Ga0070697_101783355 3300005536 Bacteria 551
34 Ga0070696_100751336 3300005546 Bacteria 799
35 Ga0070704_100393608 3300005549 Bacteria 1180
36 Ga0068855_100678405 3300005563 Bacteria 1104
37 Ga0068852_100232298 3300005616 Bacteria 1758
38 Ga0068852_101346159 3300005616 Bacteria 736
39 Ga0068859_100149467 3300005617 Unclassified 2412
40 Ga0068859_101931967 3300005617 Unclassified 652
41 Ga0068859_102453245 3300005617 Bacteria 574
42 Ga0068860_101181122 3300005843 Bacteria 785
43 Ga0068862_100212942 3300005844 Unclassified 1746
44 Ga0081455_10002340 3300005937 Bacteria 22617
45 Ga0081455_10004260 3300005937 Bacteria 16121
46 Ga0081540_1026735 3300005983 Bacteria 3286
47 Ga0081539_10145914 3300005985 Bacteria 1144
48 Ga0070717_10037436 3300006028 Bacteria 3939
49 Ga0070717_10974850 3300006028 Bacteria 772
50 Ga0070715_10785536 3300006163 Bacteria 576
51 Ga0070716_100109680 3300006173 Bacteria 1708
52 Ga0070712_100212426 3300006175 Bacteria 1527
53 Ga0070712_100994248 3300006175 Unclassified 726
54 Ga0068871_101191288 3300006358 Unclassified 714
55 Ga0075428_100202549 3300006844 Bacteria 2145
56 Ga0075428_100293254 3300006844 Unclassified 1749
57 Ga0075428_100580724 3300006844 Bacteria 1197
58 Ga0075428_101220186 3300006844 Bacteria 792
59 Ga0075430_100260420 3300006846 Bacteria 1436
60 Ga0075430_100733535 3300006846 Bacteria 814
61 Ga0075431_100020957 3300006847 Bacteria 6680
62 Ga0075431_100348440 3300006847 Bacteria 1489
63 Ga0075431_101097188 3300006847 Bacteria 760
64 Ga0075433_10256306 3300006852 Bacteria 1551
65 Ga0075429_100020654 3300006880 Bacteria 5716
66 Ga0075429_100101378 3300006880 Bacteria 2513
67 Ga0075429_100561130 3300006880 Bacteria 1001
68 Ga0075429_100846907 3300006880 Bacteria 800
69 Ga0075429_101646656 3300006880 Bacteria 558
70 Ga0075429_101646982 3300006880 Unclassified 557
71 Ga0097620_100149469 3300006931 Unclassified 2412
72 Ga0097620_101932082 3300006931 Unclassified 652
73 Ga0097620_102454044 3300006931 Bacteria 574
74 Ga0099795_10497335 3300007788 Bacteria 568
75 Ga0105240_12644758 3300009093 Bacteria 518
76 Ga0111539_10009803 3300009094 Bacteria 12091
77 Ga0111539_11246249 3300009094 Bacteria 863
78 Ga0111539_12119369 3300009094 Bacteria 652
79 Ga0111539_13270691 3300009094 Bacteria 522
80 Ga0114129_10126979 3300009147 Bacteria 3506
81 Ga0114129_12545032 3300009147 Bacteria 611
82 Ga0114129_13499305 3300009147 Unclassified 502
83 Ga0105243_11721789 3300009148 Unclassified 656
84 Ga0105243_12327696 3300009148 Bacteria 573
85 Ga0105243_13109801 3300009148 Unclassified 502
86 Ga0105242_11037008 3300009176 Bacteria 830
87 Ga0105248_11676695 3300009177 Unclassified 720
88 Ga0105248_11712220 3300009177 Bacteria 713
89 Ga0105248_11898961 3300009177 Unclassified 676
90 Ga0105238_12591026 3300009551 Bacteria 543
91 Ga0105238_12644028 3300009551 Bacteria 538
92 Ga0105238_12655361 3300009551 Bacteria 537
93 Ga0157373_11149848 3300013100 Bacteria 584
94 Ga0157371_10102706 3300013102 Bacteria 2028
95 Ga0157371_11533297 3300013102 Bacteria 520
96 Ga0157370_10117837 3300013104 Bacteria 2481
97 Ga0157370_10810212 3300013104 Bacteria 852
98 Ga0157370_11565400 3300013104 Bacteria 592
99 Ga0157369_10260613 3300013105 Bacteria 1808
100 Ga0157378_10566652 3300013297 Bacteria 1143
101 Ga0157372_12330627 3300013307 Bacteria 615
102 Ga0157375_10748493 3300013308 Unclassified 1129
103 Ga0157375_11093050 3300013308 Unclassified 933
104 Ga0157380_12846994 3300014326 Bacteria 550
105 Ga0213873_10003979 3300021358 Bacteria 2714
106 Ga0213873_10111529 3300021358 Bacteria 795
107 Ga0213876_10003910 3300021384 Bacteria 8425
108 Ga0213876_10178033 3300021384 Bacteria 1131
109 Ga0213875_10284398 3300021388 Bacteria 781
110 Ga0213871_10006541 3300021441 Bacteria 2469
111 Ga0213871_10284080 3300021441 Bacteria 531
112 Ga0207699_10213503 3300025906 Bacteria 1313
113 Ga0207705_10153025 3300025909 Bacteria 1729
114 Ga0207705_10647748 3300025909 Bacteria 821
115 Ga0207705_10769873 3300025909 Bacteria 747
116 Ga0207707_10159285 3300025912 Bacteria 1974
117 Ga0207707_10719106 3300025912 Bacteria 837
118 Ga0207693_10352451 3300025915 Bacteria 1152
119 Ga0207693_10770174 3300025915 Unclassified 743
120 Ga0207663_10707634 3300025916 Unclassified 798
121 Ga0207660_10551614 3300025917 Bacteria 937
122 Ga0207649_11227335 3300025920 Bacteria 593
123 Ga0207652_10322586 3300025921 Bacteria 1394
124 Ga0207694_10606350 3300025924 Bacteria 921
125 Ga0207687_11059695 3300025927 Bacteria 696
126 Ga0207664_10017016 3300025929 Bacteria 5318
127 Ga0207664_11587686 3300025929 Bacteria 576
128 Ga0207706_10306438 3300025933 Unclassified 1383
129 Ga0207686_11139507 3300025934 Bacteria 637
130 Ga0207670_11342241 3300025936 Bacteria 607
131 Ga0207665_10132530 3300025939 Bacteria 1771
132 Ga0207689_10261957 3300025942 Unclassified 1430
133 Ga0207661_10747137 3300025944 Bacteria 900
134 Ga0207661_11900950 3300025944 Bacteria 541
135 Ga0207667_10606319 3300025949 Bacteria 1104
136 Ga0207667_10976418 3300025949 Bacteria 835
137 Ga0207640_10341932 3300025981 Bacteria 1199
138 Ga0207640_11160769 3300025981 Bacteria 685
139 Ga0207708_10151815 3300026075 Bacteria 1824
140 Ga0207698_10807434 3300026142 Bacteria 941
141 Ga0207428_10022070 3300027907 Bacteria 5376
142 Ga0268265_10080352 3300028380 Unclassified 2571
143 Ga0265332_10135875 3300031238 Bacteria 1031
144 Ga0265320_10390985 3300031240 Bacteria 614
145 Ga0265325_10419935 3300031241 Bacteria 584
146 Ga0265340_10165737 3300031247 Bacteria 1002
147 Ga0265340_10256474 3300031247 Unclassified 779
148 Ga0265339_10390590 3300031249 Bacteria 651
149 Ga0265316_10539834 3300031344 Bacteria 831
150 Ga0307408_100616459 3300031548 Bacteria 966
151 Ga0265313_10059718 3300031595 Bacteria 1792
152 Ga0265313_10074001 3300031595 Bacteria 1563
153 Ga0265342_10005903 3300031712 Bacteria 9230
154 Ga0316576_10697105 3300031727 Unclassified 736
155 Ga0316576_11273431 3300031727 Bacteria 518
156 Ga0307412_10376792 3300031911 Bacteria 1148
157 Ga0373958_0070420 3300034819 Bacteria 775
158 Ga0373949_0167350 3300035090 Bacteria 644
159 Ga0373951_0029875 3300035091 Bacteria 1281
160 Ga0373923_0332048 3300035111 Bacteria 723
161 Ga0373939_0407730 3300035114 Bacteria 564
162 Ga0373945_0333664 3300035116 Bacteria 655
163 Ga0373943_0020929 3300035170 Bacteria 3020
164 Ga0373946_0084175 3300035171 Bacteria 1398
165 Ga0373955_0639487 3300035172 Bacteria 652
166 Ga0373961_0081364 3300035241 Bacteria 1019
167 Ga0373931_0040310 3300035691 Bacteria 2450
168 Ga0373935_0018066 3300035692 Bacteria 4287
169 Ga0373927_0014229 3300035695 Bacteria 5274
170 Ga0373927_0108906 3300035695 Bacteria 1805
171 Ga0373927_0170752 3300035695 Bacteria 1425
172 Ga0373933_0673197 3300035724 Bacteria 680
173 Ga0373937_0366257 3300036401 Bacteria 1366
174 Ga0373925_0051767 3300037068 Bacteria 3066
175 Ga0373925_0057715 3300037068 Bacteria 2909
176 Ga0373925_0134448 3300037068 Bacteria 1931
177 Ga0373925_0217554 3300037068 Bacteria 1524
178 Ga0395898_1078849 3300037466 Bacteria 737
179 Ga0436364_1221737 3300037853 Bacteria 1020
180 Ga0436365_0340427 3300039437 Bacteria 11316
181 Ga0436360_0887521 3300039438 Unclassified 2435
182 Ga0436360_1328935 3300039438 Bacteria 3735
183 Ga0436361_0089583 3300039447 Bacteria 661
184 Ga0436362_0446695 3300039453 Bacteria 2268
185 Ga0436362_0812495 3300039453 Bacteria 6220
186 Ga0451577_1906980 3300042876 Unclassified 520
187 Ga0466965_0574752 3300044683 Bacteria 638
188 Ga0466964_0472557 3300044706 Bacteria 669
189 Ga0453684_0001075 3300044712 Bacteria 86968
190 Ga0466971_0508013 3300044719 Bacteria 595
191 Ga0466957_0772564 3300044842 Bacteria 681
192 Ga0466960_0078655 3300044901 Bacteria 1656
193 Ga0466959_0772310 3300045049 Unclassified 643
194 Ga0451576_0000025 3300045051 Bacteria 427980
195 Ga0466967_0402745 3300045976 Bacteria 1332
196 Ga0466967_0403082 3300045976 Unclassified 1331
197 Ga0495592_0223936 3300046454 Bacteria 1256
198 Ga0495603_0015989 3300046455 Bacteria 4537
199 Ga0495651_0036675 3300046462 Bacteria 3816
200 Ga0495580_0770920 3300046472 Bacteria 625
201 Ga0495639_0114787 3300046475 Bacteria 1281
202 Ga0495639_0355894 3300046475 Bacteria 735
203 Ga0495584_0091495 3300046491 Bacteria 1534
204 Ga0495608_0602708 3300046511 Bacteria 659
205 Ga0495618_0132020 3300046514 Bacteria 1598
206 Ga0495628_0536090 3300046516 Bacteria 842
207 Ga0495637_0019880 3300046520 Bacteria 3097
208 Ga0495663_0105438 3300046525 Bacteria 932
209 Ga0495652_0204709 3300046529 Bacteria 1495
210 Ga0495640_0030324 3300046533 Bacteria 3873
211 Ga0495633_0124790 3300046558 Bacteria 1192
212 Ga0495634_0263444 3300046642 Bacteria 1051
213 Ga0495635_0508345 3300046663 Bacteria 793
214 Ga0495588_0364726 3300046674 Bacteria 759
215 Ga0495599_0300295 3300046678 Bacteria 969
216 Ga0495647_0132690 3300046681 Bacteria 1056
217 Ga0495613_0123832 3300046689 Bacteria 1855
218 Ga0495624_0792767 3300046690 Bacteria 560
219 Ga0495670_0726051 3300046691 Bacteria 542
220 Ga0495581_0052226 3300047315 Bacteria 2361
221 Ga0495581_0812634 3300047315 Bacteria 536
222 Ga0495604_0144857 3300047317 Bacteria 1694
223 Ga0495674_0061707 3300047319 Bacteria 3266
224 Ga0495680_0485472 3300047322 Bacteria 841
225 Ga0495602_0198109 3300048088 Bacteria 1534
226 Ga0495602_0743946 3300048088 Bacteria 662
227 Ga0496100_0053237 3300048903 Bacteria 2635
228 Ga0496100_0152458 3300048903 Unclassified 1650
229 Ga0496101_0047579 3300048904 Bacteria 3080
230 Ga0496104_0583273 3300048907 Bacteria 1028
231 Ga0496105_0342902 3300048908 Unclassified 1194
232 Ga0496110_0952656 3300048913 Unclassified 765
233 Ga0501032_0043444 3300049569 Bacteria 3044
234 Ga0501032_0249357 3300049569 Bacteria 1153
235 Ga0501033_0256009 3300049570 Bacteria 1240
236 Ga0501033_0812891 3300049570 Bacteria 631
237 Ga0501034_1460525 3300049571 Archaea 558
238 Ga0501036_0040247 3300049572 Bacteria 3953
239 Ga0501036_0069775 3300049572 Bacteria 2972
240 Ga0501036_0256589 3300049572 Bacteria 1465
241 Ga0501036_0329477 3300049572 Bacteria 1276
242 Ga0501037_0754501 3300049573 Archaea 645
243 Ga0501038_0097768 3300049574 Bacteria 2449
244 Ga0501038_0167020 3300049574 Bacteria 1784
245 Ga0501039_0164449 3300049575 Bacteria 1744
246 Ga0501039_0261016 3300049575 Bacteria 1361
247 Ga0501040_0084433 3300049576 Bacteria 2203
248 Ga0501040_0113903 3300049576 Bacteria 1893
249 Ga0501040_0137179 3300049576 Bacteria 1722
250 Ga0501040_0268781 3300049576 Bacteria 1217
251 Ga0501040_0915432 3300049576 Unclassified 635
252 Ga0501040_0981292 3300049576 Bacteria 612
253 Ga0501041_0060938 3300049577 Bacteria 2309
254 Ga0501041_0112827 3300049577 Bacteria 1687
255 Ga0501041_0270102 3300049577 Bacteria 1070
256 Ga0501041_0549684 3300049577 Bacteria 736
257 Ga0501042_0062145 3300049578 Bacteria 2668
258 Ga0501042_0067526 3300049578 Bacteria 2556
259 Ga0501042_0096954 3300049578 Bacteria 2119
260 Ga0501042_0889059 3300049578 Bacteria 649
261 Ga0501042_0992971 3300049578 Unclassified 612
262 Ga0501043_0160662 3300049579 Unclassified 1756
263 Ga0501043_0529118 3300049579 Bacteria 878
264 Ga0501046_0029649 3300049580 Bacteria 4447
265 Ga0501046_0125528 3300049580 Bacteria 1950
266 Ga0501046_0369576 3300049580 Bacteria 1039
267 Ga0501046_0557613 3300049580 Bacteria 816
268 Ga0501046_1070011 3300049580 Bacteria 558
269 Ga0501048_0089743 3300049582 Bacteria 2168
270 Ga0501048_0204465 3300049582 Unclassified 1400
271 Ga0501048_0541794 3300049582 Bacteria 835
272 Ga0501068_0036788 3300049584 Bacteria 2929
273 Ga0501071_0066409 3300049587 Bacteria 2621
274 Ga0501071_0321845 3300049587 Bacteria 1174
275 Ga0501072_0040738 3300049588 Bacteria 3647
276 Ga0501072_0125112 3300049588 Bacteria 2048
277 Ga0501072_0215973 3300049588 Bacteria 1528
278 Ga0501072_0333058 3300049588 Bacteria 1206
279 Ga0501072_0844142 3300049588 Unclassified 716
280 Ga0501072_1413950 3300049588 Unclassified 538
281 Ga0501074_0053988 3300049590 Bacteria 2898
282 Ga0501074_0077877 3300049590 Bacteria 2380
283 Ga0501074_0253656 3300049590 Bacteria 1251
284 Ga0501074_0369984 3300049590 Bacteria 1017
285 Ga0501075_0040152 3300049591 Bacteria 3504
286 Ga0501075_0261979 3300049591 Bacteria 1318
287 Ga0501075_0294011 3300049591 Unclassified 1237
288 Ga0501075_0351507 3300049591 Bacteria 1123
289 Ga0501075_0604964 3300049591 Bacteria 836
290 Ga0501075_0707479 3300049591 Bacteria 767
291 Ga0501075_0788332 3300049591 Bacteria 723
292 Ga0501075_1103401 3300049591 Archaea 602
293 Ga0501076_0107479 3300049592 Bacteria 2253
294 Ga0501076_0179478 3300049592 Bacteria 1726
295 Ga0501076_0249082 3300049592 Bacteria 1453
296 Ga0501076_0341607 3300049592 Bacteria 1229
297 Ga0501076_0477373 3300049592 Bacteria 1027
298 Ga0501076_1185784 3300049592 Archaea 628
299 Ga0501076_1335308 3300049592 Unclassified 589
300 Ga0501077_0005416 3300049593 Bacteria 7760
301 Ga0501077_0007005 3300049593 Bacteria 6949
302 Ga0501077_0165470 3300049593 Unclassified 1405
303 Ga0501077_0301095 3300049593 Bacteria 1021
304 Ga0501079_0106229 3300049741 Bacteria 2178
305 Ga0501079_0208774 3300049741 Bacteria 1525
306 Ga0501079_0296796 3300049741 Bacteria 1264
307 Ga0501079_0553456 3300049741 Bacteria 905
308 Ga0501079_1013182 3300049741 Bacteria 654
309 Ga0501080_0124448 3300049742 Bacteria 2388
310 Ga0501081_0095879 3300049743 Bacteria 2092
311 Ga0501081_0126455 3300049743 Bacteria 1824
312 Ga0501081_0164756 3300049743 Unclassified 1598
313 Ga0501081_0345168 3300049743 Unclassified 1097
314 Ga0501081_0457511 3300049743 Bacteria 948
315 Ga0501081_1383836 3300049743 Unclassified 534
316 Ga0501035_0310126 3300049822 Unclassified 1328
317 Ga0501044_0742880 3300049823 Bacteria 864
318 Ga0501044_1192222 3300049823 Bacteria 629
319 Ga0501045_0157576 3300049824 Bacteria 1689
320 Ga0501045_0219083 3300049824 Unclassified 1417
321 Ga0501045_0361509 3300049824 Bacteria 1080
322 Ga0501045_1078616 3300049824 Unclassified 588
323 nmdc:mga05p37_1323839_c1 3300050507 Bacteria 732
324 nmdc:mga05p37_156824_c1 3300050507 Bacteria 2781
325 nmdc:mga05p37_452831_c1 3300050507 Bacteria 1485
326 nmdc:mga09592_104297_c1 3300050508 Bacteria 2430
327 nmdc:mga09592_177200_c1 3300050508 Bacteria 1844
328 nmdc:mga09592_218421_c1 3300050508 Bacteria 1652
329 nmdc:mga09592_385530_c1 3300050508 Bacteria 1212
330 nmdc:mga09592_445009_c1 3300050508 Bacteria 1118
331 nmdc:mga0qj67_108223_c1 3300050509 Bacteria 2243
332 nmdc:mga0qj67_6475_c1 3300050509 Bacteria 8607
333 nmdc:mga0qj67_922901_c1 3300050509 Bacteria 687
334 nmdc:mga06r32_11558_c1 3300050510 Bacteria 7952
335 nmdc:mga06r32_14583_c1 3300050510 Bacteria 7135
336 nmdc:mga06r32_87526_c1 3300050510 Bacteria 3040
337 nmdc:mga06r32_91557_c1 3300050510 Bacteria 2972
338 nmdc:mga08y16_2123686_c1 3300050511 Bacteria 509
339 nmdc:mga08y16_716958_c1 3300050511 Bacteria 999
340 nmdc:mga0a205_577394_c1 3300050515 Unclassified 978
341 Ga0495601_0043935 3300053077 Bacteria 2807
342 Ga0495601_0793567 3300053077 Unclassified 601
343 Ga0495612_0091782 3300053078 Bacteria 1287
344 Ga0495655_0124149 3300053083 Bacteria 789
345 Ga0495595_0206144 3300053084 Bacteria 979
346 Ga0495619_0326590 3300053085 Bacteria 1062
347 Ga0500641_0339383 3300053096 Unclassified 607
348 Ga0501084_0075008 3300054114 Bacteria 2833
349 Ga0501084_0120537 3300054114 Bacteria 2206
350 Ga0501084_0131778 3300054114 Bacteria 2104
351 Ga0501084_0308711 3300054114 Bacteria 1336
352 Ga0501084_0346622 3300054114 Bacteria 1255
353 Ga0501084_0692578 3300054114 Bacteria 859
354 Ga0501084_1871989 3300054114 Unclassified 501
355 Ga0501082_0020360 3300060353 Bacteria 5720
356 Ga0501082_0057986 3300060353 Bacteria 3335
357 Ga0501082_0058538 3300060353 Bacteria 3320
358 Ga0501082_0211886 3300060353 Bacteria 1685
359 Ga0501082_0285954 3300060353 Bacteria 1435
360 Ga0501082_1070478 3300060353 Bacteria 705
361 Ga0466962_0099400 3300061719 Bacteria 1397
362 Ga0530510_0123094 3300061734 Unclassified 1905
363 Ga0530510_0322359 3300061734 Bacteria 1158
364 Ga0530510_1032309 3300061734 Unclassified 629
365 Ga0114129_10405248
366 JGI25406J46586_10111251
367 JGI25405J52794_10076938
368 Ga0070658_10455432
369 Ga0070683_100114728
370 Ga0070683_100825886
371 Ga0068869_100290630
372 Ga0070680_100506992
373 Ga0070660_100894393
374 Ga0070661_101259455
375 Ga0070661_101522838
376 Ga0070669_100211743
377 Ga0070673_100426723
378 Ga0070673_102199304
379 Ga0070688_100140787
380 Ga0070709_10565530
381 Ga0070714_100017554
382 Ga0070714_100834508
383 Ga0070700_100169887
384 Ga0070700_101576467
385 Ga0070700_101931182
386 Ga0070694_100159652
387 Ga0070708_100119480
388 Ga0070662_100775239
389 Ga0070681_10464930
390 Ga0068867_101364671
391 Ga0074259_10434643
392 Ga0070679_100196867
393 Ga0070679_100581437
394 Ga0070684_100242588
395 Ga0070684_100573721
396 Ga0070697_100362578
397 Ga0070697_101783355
398 Ga0070696_100751336
399 Ga0070704_100393608
400 Ga0068855_100678405
401 Ga0068852_100232298
402 Ga0068852_101346159
403 Ga0068859_100149467
404 Ga0068859_101931967
405 Ga0068859_102453245
406 Ga0068860_101181122
407 Ga0068862_100212942
408 Ga0081455_10002340
409 Ga0081455_10004260
410 Ga0081540_1026735
411 Ga0081539_10145914
412 Ga0070717_10037436
413 Ga0070717_10974850
414 Ga0070715_10785536
415 Ga0070716_100109680
416 Ga0070712_100212426
417 Ga0070712_100994248
418 Ga0068871_101191288
419 Ga0075428_100202549
420 Ga0075428_100293254
421 Ga0075428_100580724
422 Ga0075428_101220186
423 Ga0075430_100260420
424 Ga0075430_100733535
425 Ga0075431_100020957
426 Ga0075431_100348440
427 Ga0075431_101097188
428 Ga0075433_10256306
429 Ga0075429_100020654
430 Ga0075429_100101378
431 Ga0075429_100561130
432 Ga0075429_100846907
433 Ga0075429_101646656
434 Ga0075429_101646982
435 Ga0097620_100149469
436 Ga0097620_101932082
437 Ga0097620_102454044
438 Ga0099795_10497335
439 Ga0105240_12644758
440 Ga0111539_10009803
441 Ga0111539_11246249
442 Ga0111539_12119369
443 Ga0111539_13270691
444 Ga0114129_10126979
445 Ga0114129_12545032
446 Ga0114129_13499305
447 Ga0105243_11721789
448 Ga0105243_12327696
449 Ga0105243_13109801
450 Ga0105242_11037008
451 Ga0105248_11676695
452 Ga0105248_11712220
453 Ga0105248_11898961
454 Ga0105238_12591026
455 Ga0105238_12644028
456 Ga0105238_12655361
457 Ga0157373_11149848
458 Ga0157371_10102706
459 Ga0157371_11533297
460 Ga0157370_10117837
461 Ga0157370_10810212
462 Ga0157370_11565400
463 Ga0157369_10260613
464 Ga0157378_10566652
465 Ga0157372_12330627
466 Ga0157375_10748493
467 Ga0157375_11093050
468 Ga0157380_12846994
469 Ga0213873_10003979
470 Ga0213873_10111529
471 Ga0213876_10003910
472 Ga0213876_10178033
473 Ga0213875_10284398
474 Ga0213871_10006541
475 Ga0213871_10284080
476 Ga0207699_10213503
477 Ga0207705_10153025
478 Ga0207705_10647748
479 Ga0207705_10769873
480 Ga0207707_10159285
481 Ga0207707_10719106
482 Ga0207693_10352451
483 Ga0207693_10770174
484 Ga0207663_10707634
485 Ga0207660_10551614
486 Ga0207649_11227335
487 Ga0207652_10322586
488 Ga0207694_10606350
489 Ga0207687_11059695
490 Ga0207664_10017016
491 Ga0207664_11587686
492 Ga0207706_10306438
493 Ga0207686_11139507
494 Ga0207670_11342241
495 Ga0207665_10132530
496 Ga0207689_10261957
497 Ga0207661_10747137
498 Ga0207661_11900950
499 Ga0207667_10606319
500 Ga0207667_10976418
501 Ga0207640_10341932
502 Ga0207640_11160769
503 Ga0207708_10151815
504 Ga0207698_10807434
505 Ga0207428_10022070
506 Ga0268265_10080352
507 Ga0265332_10135875
508 Ga0265320_10390985
509 Ga0265325_10419935
510 Ga0265340_10165737
511 Ga0265340_10256474
512 Ga0265339_10390590
513 Ga0265316_10539834
514 Ga0307408_100616459
515 Ga0265313_10059718
516 Ga0265313_10074001
517 Ga0265342_10005903
518 Ga0316576_10697105
519 Ga0316576_11273431
520 Ga0307412_10376792
521 Ga0373958_0070420
522 Ga0373949_0167350
523 Ga0373951_0029875
524 Ga0373923_0332048
525 Ga0373939_0407730
526 Ga0373945_0333664
527 Ga0373943_0020929
528 Ga0373946_0084175
529 Ga0373955_0639487
530 Ga0373961_0081364
531 Ga0373931_0040310
532 Ga0373935_0018066
533 Ga0373927_0014229
534 Ga0373927_0108906
535 Ga0373927_0170752
536 Ga0373933_0673197
537 Ga0373937_0366257
538 Ga0373925_0051767
539 Ga0373925_0057715
540 Ga0373925_0134448
541 Ga0373925_0217554
542 Ga0395898_1078849
543 Ga0436364_1221737
544 Ga0436365_0340427
545 Ga0436360_0887521
546 Ga0436360_1328935
547 Ga0436361_0089583
548 Ga0436362_0446695
549 Ga0436362_0812495
550 Ga0451577_1906980
551 Ga0466965_0574752
552 Ga0466964_0472557
553 Ga0453684_0001075
554 Ga0466971_0508013
555 Ga0466957_0772564
556 Ga0466960_0078655
557 Ga0466959_0772310
558 Ga0451576_0000025
559 Ga0466967_0402745
560 Ga0466967_0403082
561 Ga0495592_0223936
562 Ga0495603_0015989
563 Ga0495651_0036675
564 Ga0495580_0770920
565 Ga0495639_0114787
566 Ga0495639_0355894
567 Ga0495584_0091495
568 Ga0495608_0602708
569 Ga0495618_0132020
570 Ga0495628_0536090
571 Ga0495637_0019880
572 Ga0495663_0105438
573 Ga0495652_0204709
574 Ga0495640_0030324
575 Ga0495633_0124790
576 Ga0495634_0263444
577 Ga0495635_0508345
578 Ga0495588_0364726
579 Ga0495599_0300295
580 Ga0495647_0132690
581 Ga0495613_0123832
582 Ga0495624_0792767
583 Ga0495670_0726051
584 Ga0495581_0052226
585 Ga0495581_0812634
586 Ga0495604_0144857
587 Ga0495674_0061707
588 Ga0495680_0485472
589 Ga0495602_0198109
590 Ga0495602_0743946
591 Ga0496100_0053237
592 Ga0496100_0152458
593 Ga0496101_0047579
594 Ga0496104_0583273
595 Ga0496105_0342902
596 Ga0496110_0952656
597 Ga0501032_0043444
598 Ga0501032_0249357
599 Ga0501033_0256009
600 Ga0501033_0812891
601 Ga0501034_1460525
602 Ga0501036_0040247
603 Ga0501036_0069775
604 Ga0501036_0256589
605 Ga0501036_0329477
606 Ga0501037_0754501
607 Ga0501038_0097768
608 Ga0501038_0167020
609 Ga0501039_0164449
610 Ga0501039_0261016
611 Ga0501040_0084433
612 Ga0501040_0113903
613 Ga0501040_0137179
614 Ga0501040_0268781
615 Ga0501040_0915432
616 Ga0501040_0981292
617 Ga0501041_0060938
618 Ga0501041_0112827
619 Ga0501041_0270102
620 Ga0501041_0549684
621 Ga0501042_0062145
622 Ga0501042_0067526
623 Ga0501042_0096954
624 Ga0501042_0889059
625 Ga0501042_0992971
626 Ga0501043_0160662
627 Ga0501043_0529118
628 Ga0501046_0029649
629 Ga0501046_0125528
630 Ga0501046_0369576
631 Ga0501046_0557613
632 Ga0501046_1070011
633 Ga0501048_0089743
634 Ga0501048_0204465
635 Ga0501048_0541794
636 Ga0501068_0036788
637 Ga0501071_0066409
638 Ga0501071_0321845
639 Ga0501072_0040738
640 Ga0501072_0125112
641 Ga0501072_0215973
642 Ga0501072_0333058
643 Ga0501072_0844142
644 Ga0501072_1413950
645 Ga0501074_0053988
646 Ga0501074_0077877
647 Ga0501074_0253656
648 Ga0501074_0369984
649 Ga0501075_0040152
650 Ga0501075_0261979
651 Ga0501075_0294011
652 Ga0501075_0351507
653 Ga0501075_0604964
654 Ga0501075_0707479
655 Ga0501075_0788332
656 Ga0501075_1103401
657 Ga0501076_0107479
658 Ga0501076_0179478
659 Ga0501076_0249082
660 Ga0501076_0341607
661 Ga0501076_0477373
662 Ga0501076_1185784
663 Ga0501076_1335308
664 Ga0501077_0005416
665 Ga0501077_0007005
666 Ga0501077_0165470
667 Ga0501077_0301095
668 Ga0501079_0106229
669 Ga0501079_0208774
670 Ga0501079_0296796
671 Ga0501079_0553456
672 Ga0501079_1013182
673 Ga0501080_0124448
674 Ga0501081_0095879
675 Ga0501081_0126455
676 Ga0501081_0164756
677 Ga0501081_0345168
678 Ga0501081_0457511
679 Ga0501081_1383836
680 Ga0501035_0310126
681 Ga0501044_0742880
682 Ga0501044_1192222
683 Ga0501045_0157576
684 Ga0501045_0219083
685 Ga0501045_0361509
686 Ga0501045_1078616
687 nmdc:mga05p37_1323839_c1
688 nmdc:mga05p37_156824_c1
689 nmdc:mga05p37_452831_c1
690 nmdc:mga09592_104297_c1
691 nmdc:mga09592_177200_c1
692 nmdc:mga09592_218421_c1
693 nmdc:mga09592_385530_c1
694 nmdc:mga09592_445009_c1
695 nmdc:mga0qj67_108223_c1
696 nmdc:mga0qj67_6475_c1
697 nmdc:mga0qj67_922901_c1
698 nmdc:mga06r32_11558_c1
699 nmdc:mga06r32_14583_c1
700 nmdc:mga06r32_87526_c1
701 nmdc:mga06r32_91557_c1
702 nmdc:mga08y16_2123686_c1
703 nmdc:mga08y16_716958_c1
704 nmdc:mga0a205_577394_c1
705 Ga0495601_0043935
706 Ga0495601_0793567
707 Ga0495612_0091782
708 Ga0495655_0124149
709 Ga0495595_0206144
710 Ga0495619_0326590
711 Ga0500641_0339383
712 Ga0501084_0075008
713 Ga0501084_0120537
714 Ga0501084_0131778
715 Ga0501084_0308711
716 Ga0501084_0346622
717 Ga0501084_0692578
718 Ga0501084_1871989
719 Ga0501082_0020360
720 Ga0501082_0057986
721 Ga0501082_0058538
722 Ga0501082_0211886
723 Ga0501082_0285954
724 Ga0501082_1070478
725 Ga0466962_0099400
726 Ga0530510_0123094
727 Ga0530510_0322359
728 Ga0530510_1032309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15919

HicB_lk_antitox

HicB_like antitoxin of bacterial toxin-antitoxin system

19

84

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1c-assembly1.cif.gz_V crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.9013 5 62
6g1n-assembly1.cif.gz_D crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8997 5 62
2dsy-assembly1.cif.gz_C crystal structure of ttha0281 from thermus thermophilus hb8 0.891 5 57
6g1n-assembly1.cif.gz_B crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8844 1 62
3kwr-assembly1.cif.gz_B crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution 0.8788 5 61
ID Description Score Start End Superfamily
af_Q54G57_1723_1817_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8924 28 53 1.10.10.10
3kwrB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8792 5 61 3.30.160.250
af_P53327_1539_1634_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8568 28 53 1.10.10.10
af_P67697_1_89_3.30.160.250 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8447 1 68 3.30.160.250
3k6qA02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8384 1 54 3.30.160.620
ID Description Score Start End GO Terms
AF-A0A1W9R4W4-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.009 1 50
AF-A0A256W9Y4-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.008 1 51
AF-Q3M555-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.005 1 53
AF-A0A523E9N2-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 1.004 1 55
AF-A0A368T6M0-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.9972 2 58

Map