F423111

General Info

Members Datasets Scaffolds Average Seq Length
363 222 726 145

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0019561|Ga0501034_0019561_5571_6041
Length 156
Sequence LSIRDLEEGVDMATFERHVEVDWHGGLMDGKGEAKAGTGAFTLPVTFPSRIQDPAGRTSPEELMAAAHAACYAMALNATLGNKKASAERTVVTATISADLGTGIKIHASHLTVTVYGLKGIEASQFASVAQEAEQACPVSNAYRGSMQITLDAKVG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
151 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
152 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
219 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
220 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
221 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
222 2808606394 Promicromonospora sp. C35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0
Rhizoplane 1.65
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 19.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0019561 3300049571 Bacteria 6924
2 JGI24751J29686_10012463 3300002459 Bacteria 1754
3 JGI24751J29686_10117987 3300002459 Bacteria 557
4 Ga0065704_10031993 3300005289 Unclassified 1330
5 Ga0065704_10488915 3300005289 Bacteria 676
6 Ga0065712_10103506 3300005290 Bacteria 1983
7 Ga0065712_10116816 3300005290 Bacteria 1729
8 Ga0065712_10173014 3300005290 Unclassified 1233
9 Ga0065712_10245245 3300005290 Bacteria 973
10 Ga0065712_10438399 3300005290 Bacteria 687
11 Ga0065715_10000908 3300005293 Bacteria 10564
12 Ga0065715_10213589 3300005293 Bacteria 1288
13 Ga0065715_10282786 3300005293 Bacteria 1082
14 Ga0065707_10026039 3300005295 Bacteria 2200
15 Ga0065707_10405886 3300005295 Bacteria 847
16 Ga0070658_11294572 3300005327 Bacteria 633
17 Ga0070676_11446382 3300005328 Unclassified 528
18 Ga0070683_100083949 3300005329 Unclassified 2984
19 Ga0070690_100078090 3300005330 Bacteria 2162
20 Ga0070677_10042159 3300005333 Bacteria 1806
21 Ga0070677_10065293 3300005333 Bacteria 1514
22 Ga0070677_10210180 3300005333 Bacteria 944
23 Ga0068869_100013488 3300005334 Bacteria 5438
24 Ga0068869_100139040 3300005334 Bacteria 1873
25 Ga0070666_10205214 3300005335 Unclassified 1387
26 Ga0070666_10333357 3300005335 Bacteria 1084
27 Ga0070689_100141812 3300005340 Bacteria 1933
28 Ga0070689_100969730 3300005340 Bacteria 755
29 Ga0070689_101823963 3300005340 Bacteria 555
30 Ga0070691_10190463 3300005341 Bacteria 1073
31 Ga0070687_100033271 3300005343 Bacteria 2543
32 Ga0070661_100700455 3300005344 Unclassified 825
33 Ga0070669_100027493 3300005353 Bacteria 4094
34 Ga0070669_100559659 3300005353 Bacteria 954
35 Ga0070669_100638265 3300005353 Bacteria 895
36 Ga0070669_100761725 3300005353 Bacteria 821
37 Ga0070675_100044860 3300005354 Bacteria 3616
38 Ga0070675_100059958 3300005354 Bacteria 3141
39 Ga0070675_100187538 3300005354 Bacteria 1791
40 Ga0070675_100199096 3300005354 Bacteria 1738
41 Ga0070675_100627390 3300005354 Bacteria 976
42 Ga0070671_100175314 3300005355 Bacteria 1814
43 Ga0070671_100194176 3300005355 Bacteria 1721
44 Ga0070671_100722855 3300005355 Bacteria 865
45 Ga0070674_100074608 3300005356 Unclassified 2407
46 Ga0070674_100176199 3300005356 Bacteria 1634
47 Ga0070674_100281758 3300005356 Bacteria 1318
48 Ga0070674_100571793 3300005356 Bacteria 951
49 Ga0070674_101825332 3300005356 Bacteria 551
50 Ga0070674_102157261 3300005356 Bacteria 508
51 Ga0070673_100061432 3300005364 Bacteria 2981
52 Ga0070673_100388377 3300005364 Unclassified 1246
53 Ga0070673_100489406 3300005364 Unclassified 1111
54 Ga0070673_100516318 3300005364 Bacteria 1082
55 Ga0070673_102355557 3300005364 Unclassified 506
56 Ga0070688_100286676 3300005365 Bacteria 1185
57 Ga0070688_100339243 3300005365 Bacteria 1097
58 Ga0070659_100593442 3300005366 Unclassified 951
59 Ga0070667_100182019 3300005367 Unclassified 1859
60 Ga0070667_101301420 3300005367 Bacteria 681
61 Ga0070713_100018957 3300005436 Bacteria 5240
62 Ga0070705_100022525 3300005440 Bacteria 3367
63 Ga0070700_100265631 3300005441 Bacteria 1237
64 Ga0070700_100401494 3300005441 Bacteria 1031
65 Ga0070663_100762319 3300005455 Bacteria 827
66 Ga0070663_101005117 3300005455 Bacteria 725
67 Ga0070678_100202965 3300005456 Bacteria 1637
68 Ga0070678_100295533 3300005456 Bacteria 1375
69 Ga0070678_100719142 3300005456 Bacteria 901
70 Ga0070678_101361036 3300005456 Bacteria 662
71 Ga0070662_100320821 3300005457 Bacteria 1263
72 Ga0068867_100713346 3300005459 Unclassified 886
73 Ga0070685_10100389 3300005466 Bacteria 1766
74 Ga0070707_100130680 3300005468 Bacteria 2442
75 Ga0070707_101298057 3300005468 Unclassified 694
76 Ga0070707_102152680 3300005468 Bacteria 525
77 Ga0070699_100484878 3300005518 Unclassified 1122
78 Ga0070684_100163204 3300005535 Unclassified 2022
79 Ga0070672_100052858 3300005543 Bacteria 3174
80 Ga0070672_100341349 3300005543 Bacteria 1275
81 Ga0070672_101390470 3300005543 Bacteria 628
82 Ga0070686_100074338 3300005544 Bacteria 2233
83 Ga0070686_101251406 3300005544 Unclassified 618
84 Ga0070695_100031220 3300005545 Unclassified 3321
85 Ga0070696_100461928 3300005546 Bacteria 1004
86 Ga0070696_100896970 3300005546 Bacteria 735
87 Ga0070693_100048930 3300005547 Bacteria 2410
88 Ga0070665_101068880 3300005548 Bacteria 819
89 Ga0070704_100072994 3300005549 Bacteria 2498
90 Ga0070704_100164974 3300005549 Bacteria 1755
91 Ga0070704_101771991 3300005549 Bacteria 571
92 Ga0068855_100153952 3300005563 Bacteria 2613
93 Ga0068855_100905856 3300005563 Bacteria 931
94 Ga0068854_100171517 3300005578 Bacteria 1688
95 Ga0068854_101763071 3300005578 Bacteria 567
96 Ga0070702_100191414 3300005615 Bacteria 1346
97 Ga0068852_100166825 3300005616 Bacteria 2061
98 Ga0068852_100694718 3300005616 Bacteria 1027
99 Ga0068852_101091030 3300005616 Unclassified 818
100 Ga0068859_100100963 3300005617 Bacteria 2941
101 Ga0068859_101632672 3300005617 Bacteria 712
102 Ga0068866_10233865 3300005718 Bacteria 1116
103 Ga0068861_100075316 3300005719 Bacteria 2627
104 Ga0068861_100103319 3300005719 Unclassified 2271
105 Ga0068858_101051340 3300005842 Bacteria 799
106 Ga0068860_100132636 3300005843 Bacteria 2392
107 Ga0068860_100291139 3300005843 Bacteria 1598
108 Ga0068862_100023246 3300005844 Bacteria 5192
109 Ga0068862_100239916 3300005844 Bacteria 1648
110 Ga0068862_101406851 3300005844 Unclassified 701
111 Ga0075368_10013648 3300006042 Bacteria 2986
112 Ga0075363_100151308 3300006048 Bacteria 1310
113 Ga0075364_10053128 3300006051 Bacteria 2648
114 Ga0075364_10199732 3300006051 Bacteria 1355
115 Ga0075364_10321606 3300006051 Bacteria 1053
116 Ga0075362_10211590 3300006177 Unclassified 946
117 Ga0075367_10056278 3300006178 Bacteria 2336
118 Ga0075367_10091332 3300006178 Bacteria 1852
119 Ga0075366_10284546 3300006195 Bacteria 1011
120 Ga0097621_100078483 3300006237 Bacteria 2743
121 Ga0097621_100750083 3300006237 Bacteria 901
122 Ga0097621_100983111 3300006237 Bacteria 789
123 Ga0075370_10019183 3300006353 Bacteria 3721
124 Ga0075370_10102107 3300006353 Archaea 1661
125 Ga0075370_10528797 3300006353 Bacteria 713
126 Ga0068871_100197816 3300006358 Bacteria 1734
127 Ga0068871_100442463 3300006358 Bacteria 1164
128 Ga0068871_100624909 3300006358 Unclassified 981
129 Ga0075428_100000015 3300006844 Bacteria 164556
130 Ga0075428_100022048 3300006844 Bacteria 7050
131 Ga0075430_100117668 3300006846 Bacteria 2215
132 Ga0075430_100178391 3300006846 Bacteria 1767
133 Ga0075431_100223546 3300006847 Bacteria 1920
134 Ga0075434_100022262 3300006871 Bacteria 6173
135 Ga0075434_100246310 3300006871 Unclassified 1807
136 Ga0068865_100303256 3300006881 Bacteria 1279
137 Ga0068865_100352122 3300006881 Unclassified 1193
138 Ga0068865_101637600 3300006881 Bacteria 579
139 Ga0097620_100100961 3300006931 Bacteria 2941
140 Ga0097620_101632735 3300006931 Bacteria 712
141 Ga0075435_100022617 3300007076 Bacteria 4850
142 Ga0105250_10433868 3300009092 Unclassified 587
143 Ga0111539_10000002 3300009094 Bacteria 983359
144 Ga0111539_10261360 3300009094 Bacteria 2015
145 Ga0111539_10940367 3300009094 Bacteria 1005
146 Ga0105245_10032445 3300009098 Bacteria 4624
147 Ga0105247_10464089 3300009101 Bacteria 915
148 Ga0105243_10065207 3300009148 Bacteria 2925
149 Ga0105243_10277724 3300009148 Bacteria 1507
150 Ga0105243_11372439 3300009148 Bacteria 726
151 Ga0105241_10062572 3300009174 Bacteria 2869
152 Ga0105242_10024932 3300009176 Bacteria 4727
153 Ga0105248_10158947 3300009177 Unclassified 2549
154 Ga0105248_11208275 3300009177 Bacteria 855
155 Ga0105248_11551420 3300009177 Bacteria 750
156 Ga0105248_12444454 3300009177 Bacteria 595
157 Ga0105237_11881099 3300009545 Bacteria 606
158 Ga0105238_10534950 3300009551 Bacteria 1175
159 Ga0105238_11204085 3300009551 Unclassified 782
160 Ga0105238_11783087 3300009551 Bacteria 647
161 Ga0105249_10119100 3300009553 Bacteria 2507
162 Ga0105239_10147428 3300010375 Bacteria 2626
163 Ga0105246_10590666 3300011119 Bacteria 958
164 Ga0157374_10981138 3300013296 Unclassified 864
165 Ga0157378_10121508 3300013297 Bacteria 2408
166 Ga0163162_10977328 3300013306 Unclassified 957
167 Ga0157375_12163356 3300013308 Unclassified 662
168 Ga0163163_10236280 3300014325 Bacteria 1877
169 Ga0163163_10466279 3300014325 Unclassified 1324
170 Ga0163163_10655971 3300014325 Bacteria 1113
171 Ga0157380_10435354 3300014326 Bacteria 1255
172 Ga0157380_10521956 3300014326 Bacteria 1158
173 Ga0157380_10527400 3300014326 Unclassified 1153
174 Ga0157380_10660557 3300014326 Bacteria 1044
175 Ga0157380_12115656 3300014326 Unclassified 626
176 Ga0163161_10894303 3300017792 Unclassified 752
177 Ga0207697_10081267 3300025315 Bacteria 1365
178 Ga0207697_10351777 3300025315 Unclassified 654
179 Ga0207682_10100384 3300025893 Bacteria 1265
180 Ga0207682_10137678 3300025893 Bacteria 1094
181 Ga0207680_10563668 3300025903 Bacteria 814
182 Ga0207680_11238314 3300025903 Bacteria 532
183 Ga0207705_11399746 3300025909 Unclassified 532
184 Ga0207684_10355392 3300025910 Bacteria 1261
185 Ga0207654_10136512 3300025911 Unclassified 1559
186 Ga0207662_10004919 3300025918 Bacteria 7062
187 Ga0207657_10585796 3300025919 Unclassified 871
188 Ga0207646_10478103 3300025922 Bacteria 1123
189 Ga0207646_10676819 3300025922 Bacteria 923
190 Ga0207681_10101659 3300025923 Bacteria 2074
191 Ga0207694_10102756 3300025924 Bacteria 2266
192 Ga0207694_10768045 3300025924 Bacteria 814
193 Ga0207659_10021323 3300025926 Bacteria 4299
194 Ga0207659_10030590 3300025926 Bacteria 3680
195 Ga0207659_10122742 3300025926 Bacteria 1993
196 Ga0207687_10050202 3300025927 Bacteria 2903
197 Ga0207644_10021801 3300025931 Bacteria 4368
198 Ga0207644_10593810 3300025931 Bacteria 919
199 Ga0207706_10270359 3300025933 Bacteria 1483
200 Ga0207706_10287863 3300025933 Bacteria 1432
201 Ga0207709_10026796 3300025935 Bacteria 3314
202 Ga0207669_10058147 3300025937 Bacteria 2358
203 Ga0207669_10942460 3300025937 Bacteria 723
204 Ga0207669_11327258 3300025937 Bacteria 611
205 Ga0207704_11113963 3300025938 Bacteria 671
206 Ga0207704_11991289 3300025938 Bacteria 500
207 Ga0207691_10033029 3300025940 Bacteria 4820
208 Ga0207691_10115450 3300025940 Bacteria 2384
209 Ga0207691_10248654 3300025940 Bacteria 1535
210 Ga0207711_10145761 3300025941 Bacteria 2133
211 Ga0207711_10541017 3300025941 Bacteria 1086
212 Ga0207679_10250671 3300025945 Bacteria 1505
213 Ga0207667_10794516 3300025949 Bacteria 943
214 Ga0207651_10031225 3300025960 Bacteria 3402
215 Ga0207651_10233436 3300025960 Bacteria 1495
216 Ga0207651_10497335 3300025960 Bacteria 1053
217 Ga0207712_10068071 3300025961 Bacteria 2549
218 Ga0207712_10155961 3300025961 Unclassified 1769
219 Ga0207668_11374388 3300025972 Unclassified 636
220 Ga0207640_10049883 3300025981 Unclassified 2712
221 Ga0207640_10834377 3300025981 Unclassified 801
222 Ga0207658_10498047 3300025986 Unclassified 1085
223 Ga0207658_11321753 3300025986 Bacteria 659
224 Ga0207677_11499930 3300026023 Unclassified 623
225 Ga0207703_12256019 3300026035 Bacteria 520
226 Ga0207708_10101733 3300026075 Bacteria 2224
227 Ga0207708_10109374 3300026075 Bacteria 2144
228 Ga0207708_10114716 3300026075 Bacteria 2094
229 Ga0207648_10003273 3300026089 Bacteria 17032
230 Ga0207648_10298856 3300026089 Bacteria 1443
231 Ga0207674_10259016 3300026116 Bacteria 1687
232 Ga0207675_100179560 3300026118 Bacteria 2027
233 Ga0207675_100210688 3300026118 Bacteria 1869
234 Ga0207675_100566442 3300026118 Bacteria 1136
235 Ga0207683_10112726 3300026121 Bacteria 2436
236 Ga0207683_10236971 3300026121 Bacteria 1664
237 Ga0207683_10830005 3300026121 Unclassified 858
238 Ga0207683_10841883 3300026121 Bacteria 852
239 Ga0207698_11180322 3300026142 Bacteria 779
240 Ga0207698_11210690 3300026142 Bacteria 769
241 Ga0207698_12688671 3300026142 Bacteria 506
242 Ga0207428_10000004 3300027907 Bacteria 727800
243 Ga0268266_11767645 3300028379 Unclassified 593
244 Ga0268265_10223308 3300028380 Bacteria 1650
245 Ga0268265_10637623 3300028380 Bacteria 1023
246 Ga0268265_11556715 3300028380 Bacteria 665
247 Ga0268264_10572520 3300028381 Bacteria 1110
248 Ga0307515_10434721 3300028794 Bacteria 930
249 Ga0307408_100259675 3300031548 Bacteria 1437
250 Ga0307413_10201490 3300031824 Bacteria 1438
251 Ga0307410_11247764 3300031852 Bacteria 649
252 Ga0307406_10572630 3300031901 Bacteria 927
253 Ga0307407_10955205 3300031903 Bacteria 660
254 Ga0307412_11868340 3300031911 Bacteria 554
255 Ga0307409_100474939 3300031995 Bacteria 1212
256 Ga0307416_100518752 3300032002 Bacteria 1259
257 Ga0307416_100765378 3300032002 Bacteria 1059
258 Ga0307416_100869798 3300032002 Unclassified 1000
259 Ga0307411_10728755 3300032005 Bacteria 866
260 Ga0307415_100277720 3300032126 Unclassified 1376
261 Ga0307415_100363341 3300032126 Bacteria 1223
262 Ga0373938_0148567 3300034957 Bacteria 622
263 Ga0373942_0024648 3300035207 Bacteria 1545
264 Ga0373961_0266135 3300035241 Unclassified 625
265 Ga0373937_1223914 3300036401 Bacteria 699
266 Ga0395901_1059589 3300038443 Bacteria 783
267 Ga0439453_0137797 3300041408 Bacteria 571
268 Ga0439461_0006546 3300041410 Bacteria 2034
269 Ga0451851_0595806 3300041507 Bacteria 607
270 Ga0439431_0244799 3300041997 Unclassified 531
271 Ga0439457_164039 3300042014 Bacteria 538
272 Ga0450920_044184 3300042122 Unclassified 890
273 Ga0450920_078793 3300042122 Unclassified 674
274 Ga0450894_025344 3300042131 Unclassified 812
275 Ga0450908_003699 3300042184 Bacteria 2966
276 Ga0439435_0001337 3300042436 Bacteria 4500
277 Ga0439435_0120654 3300042436 Unclassified 821
278 Ga0466972_0377768 3300044658 Bacteria 663
279 Ga0466965_0009258 3300044683 Bacteria 4577
280 Ga0466961_0067118 3300044693 Bacteria 2278
281 Ga0466963_0043300 3300044694 Bacteria 2959
282 Ga0466964_0035563 3300044706 Bacteria 1992
283 Ga0466971_0004513 3300044719 Bacteria 6018
284 Ga0466968_0019857 3300044735 Bacteria 2709
285 Ga0466970_0008045 3300044765 Bacteria 5295
286 Ga0466957_0010886 3300044842 Bacteria 5231
287 Ga0466957_0556530 3300044842 Bacteria 800
288 Ga0466960_0009304 3300044901 Bacteria 4046
289 Ga0466959_0080605 3300045049 Bacteria 2346
290 Ga0466958_0025226 3300045836 Bacteria 3503
291 Ga0466967_0117412 3300045976 Bacteria 2452
292 Ga0495594_0535956 3300046499 Bacteria 664
293 Ga0495628_0870561 3300046516 Unclassified 627
294 Ga0495640_0705777 3300046533 Bacteria 605
295 Ga0495586_0539174 3300046535 Bacteria 674
296 Ga0495633_0278718 3300046558 Unclassified 761
297 Ga0495635_0742201 3300046663 Bacteria 635
298 Ga0495647_0505265 3300046681 Bacteria 563
299 Ga0495614_0408052 3300048089 Bacteria 639
300 Ga0496103_0374117 3300048906 Bacteria 915
301 Ga0496106_0909628 3300048909 Unclassified 694
302 Ga0496108_0513552 3300048911 Bacteria 1046
303 Ga0496109_1337583 3300048912 Bacteria 652
304 Ga0496110_1399440 3300048913 Bacteria 609
305 Ga0496114_0550112 3300048917 Bacteria 1020
306 Ga0501034_0711727 3300049571 Bacteria 902
307 Ga0501034_0716718 3300049571 Bacteria 898
308 Ga0501036_0063363 3300049572 Bacteria 3131
309 Ga0501036_1436327 3300049572 Bacteria 559
310 Ga0501037_0479242 3300049573 Bacteria 846
311 Ga0501043_0110346 3300049579 Bacteria 2160
312 Ga0501048_0118885 3300049582 Bacteria 1867
313 Ga0501067_0071017 3300049583 Bacteria 1928
314 Ga0501069_0382952 3300049585 Unclassified 831
315 Ga0501070_1174788 3300049586 Unclassified 590
316 Ga0501071_0253651 3300049587 Bacteria 1328
317 Ga0501072_0059991 3300049588 Bacteria 3000
318 Ga0501073_0282228 3300049589 Bacteria 1146
319 Ga0501074_1337190 3300049590 Bacteria 502
320 Ga0501075_0036905 3300049591 Bacteria 3648
321 Ga0501075_1250886 3300049591 Bacteria 563
322 Ga0501076_0020674 3300049592 Bacteria 5041
323 Ga0501076_1397742 3300049592 Bacteria 575
324 Ga0501077_0769756 3300049593 Unclassified 619
325 Ga0501079_1106527 3300049741 Bacteria 624
326 Ga0501079_1196140 3300049741 Bacteria 599
327 Ga0501080_0089171 3300049742 Bacteria 2865
328 Ga0501035_0453866 3300049822 Unclassified 1060
329 Ga0501044_0200254 3300049823 Bacteria 1955
330 Ga0501045_0030487 3300049824 Bacteria 3904
331 Ga0501045_0902127 3300049824 Bacteria 649
332 nmdc:mga00v17_358731_c1 3300050491 Bacteria 948
333 nmdc:mga0k408_57370_c1 3300050493 Unclassified 2260
334 nmdc:mga06z11_171315_c1 3300050494 Bacteria 1247
335 nmdc:mga06z11_17892_c1 3300050494 Bacteria 3227
336 nmdc:mga06z11_439325_c1 3300050494 Bacteria 788
337 nmdc:mga04h51_128130_c1 3300050495 Bacteria 952
338 nmdc:mga07m45_482879_c1 3300050496 Bacteria 718
339 nmdc:mga07m45_514652_c1 3300050496 Unclassified 693
340 nmdc:mga05p37_1291523_c1 3300050507 Unclassified 745
341 nmdc:mga05p37_187022_c1 3300050507 Bacteria 2518
342 nmdc:mga09592_1728062_c1 3300050508 Bacteria 504
343 nmdc:mga09592_80753_c1 3300050508 Bacteria 2769
344 nmdc:mga0qj67_228715_c1 3300050509 Bacteria 1509
345 nmdc:mga0qj67_23200_c1 3300050509 Unclassified 4771
346 nmdc:mga06r32_215892_c1 3300050510 Bacteria 1906
347 nmdc:mga06r32_222846_c1 3300050510 Unclassified 1874
348 nmdc:mga06r32_494411_c1 3300050510 Unclassified 1201
349 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
350 nmdc:mga0n895_1117911_c1 3300050512 Unclassified 765
351 nmdc:mga0rr50_365160_c1 3300050513 Bacteria 1216
352 nmdc:mga0a205_1083325_c1 3300050515 Bacteria 649
353 Ga0501084_0370398 3300054114 Bacteria 1210
354 Ga0590071_044557 3300059421 Bacteria 1070
355 Ga0590075_027277 3300059424 Bacteria 1440
356 Ga0466962_0042649 3300061719 Bacteria 2171
357 Ga0530510_0115436 3300061734 Bacteria 1968
358 Ga0530510_1102705 3300061734 Unclassified 608
359 2587752962 2585428061 Bacteria 3939663
360 2588212638 2585428183 Bacteria 5166119
361 2739608447 2739367654 Bacteria 6049412
362 2760305798 2758568522 Bacteria 5953541
363 2809030721 2808606394 Bacteria 6248540
364 Ga0501034_0019561
365 JGI24751J29686_10012463
366 JGI24751J29686_10117987
367 Ga0065704_10031993
368 Ga0065704_10488915
369 Ga0065712_10103506
370 Ga0065712_10116816
371 Ga0065712_10173014
372 Ga0065712_10245245
373 Ga0065712_10438399
374 Ga0065715_10000908
375 Ga0065715_10213589
376 Ga0065715_10282786
377 Ga0065707_10026039
378 Ga0065707_10405886
379 Ga0070658_11294572
380 Ga0070676_11446382
381 Ga0070683_100083949
382 Ga0070690_100078090
383 Ga0070677_10042159
384 Ga0070677_10065293
385 Ga0070677_10210180
386 Ga0068869_100013488
387 Ga0068869_100139040
388 Ga0070666_10205214
389 Ga0070666_10333357
390 Ga0070689_100141812
391 Ga0070689_100969730
392 Ga0070689_101823963
393 Ga0070691_10190463
394 Ga0070687_100033271
395 Ga0070661_100700455
396 Ga0070669_100027493
397 Ga0070669_100559659
398 Ga0070669_100638265
399 Ga0070669_100761725
400 Ga0070675_100044860
401 Ga0070675_100059958
402 Ga0070675_100187538
403 Ga0070675_100199096
404 Ga0070675_100627390
405 Ga0070671_100175314
406 Ga0070671_100194176
407 Ga0070671_100722855
408 Ga0070674_100074608
409 Ga0070674_100176199
410 Ga0070674_100281758
411 Ga0070674_100571793
412 Ga0070674_101825332
413 Ga0070674_102157261
414 Ga0070673_100061432
415 Ga0070673_100388377
416 Ga0070673_100489406
417 Ga0070673_100516318
418 Ga0070673_102355557
419 Ga0070688_100286676
420 Ga0070688_100339243
421 Ga0070659_100593442
422 Ga0070667_100182019
423 Ga0070667_101301420
424 Ga0070713_100018957
425 Ga0070705_100022525
426 Ga0070700_100265631
427 Ga0070700_100401494
428 Ga0070663_100762319
429 Ga0070663_101005117
430 Ga0070678_100202965
431 Ga0070678_100295533
432 Ga0070678_100719142
433 Ga0070678_101361036
434 Ga0070662_100320821
435 Ga0068867_100713346
436 Ga0070685_10100389
437 Ga0070707_100130680
438 Ga0070707_101298057
439 Ga0070707_102152680
440 Ga0070699_100484878
441 Ga0070684_100163204
442 Ga0070672_100052858
443 Ga0070672_100341349
444 Ga0070672_101390470
445 Ga0070686_100074338
446 Ga0070686_101251406
447 Ga0070695_100031220
448 Ga0070696_100461928
449 Ga0070696_100896970
450 Ga0070693_100048930
451 Ga0070665_101068880
452 Ga0070704_100072994
453 Ga0070704_100164974
454 Ga0070704_101771991
455 Ga0068855_100153952
456 Ga0068855_100905856
457 Ga0068854_100171517
458 Ga0068854_101763071
459 Ga0070702_100191414
460 Ga0068852_100166825
461 Ga0068852_100694718
462 Ga0068852_101091030
463 Ga0068859_100100963
464 Ga0068859_101632672
465 Ga0068866_10233865
466 Ga0068861_100075316
467 Ga0068861_100103319
468 Ga0068858_101051340
469 Ga0068860_100132636
470 Ga0068860_100291139
471 Ga0068862_100023246
472 Ga0068862_100239916
473 Ga0068862_101406851
474 Ga0075368_10013648
475 Ga0075363_100151308
476 Ga0075364_10053128
477 Ga0075364_10199732
478 Ga0075364_10321606
479 Ga0075362_10211590
480 Ga0075367_10056278
481 Ga0075367_10091332
482 Ga0075366_10284546
483 Ga0097621_100078483
484 Ga0097621_100750083
485 Ga0097621_100983111
486 Ga0075370_10019183
487 Ga0075370_10102107
488 Ga0075370_10528797
489 Ga0068871_100197816
490 Ga0068871_100442463
491 Ga0068871_100624909
492 Ga0075428_100000015
493 Ga0075428_100022048
494 Ga0075430_100117668
495 Ga0075430_100178391
496 Ga0075431_100223546
497 Ga0075434_100022262
498 Ga0075434_100246310
499 Ga0068865_100303256
500 Ga0068865_100352122
501 Ga0068865_101637600
502 Ga0097620_100100961
503 Ga0097620_101632735
504 Ga0075435_100022617
505 Ga0105250_10433868
506 Ga0111539_10000002
507 Ga0111539_10261360
508 Ga0111539_10940367
509 Ga0105245_10032445
510 Ga0105247_10464089
511 Ga0105243_10065207
512 Ga0105243_10277724
513 Ga0105243_11372439
514 Ga0105241_10062572
515 Ga0105242_10024932
516 Ga0105248_10158947
517 Ga0105248_11208275
518 Ga0105248_11551420
519 Ga0105248_12444454
520 Ga0105237_11881099
521 Ga0105238_10534950
522 Ga0105238_11204085
523 Ga0105238_11783087
524 Ga0105249_10119100
525 Ga0105239_10147428
526 Ga0105246_10590666
527 Ga0157374_10981138
528 Ga0157378_10121508
529 Ga0163162_10977328
530 Ga0157375_12163356
531 Ga0163163_10236280
532 Ga0163163_10466279
533 Ga0163163_10655971
534 Ga0157380_10435354
535 Ga0157380_10521956
536 Ga0157380_10527400
537 Ga0157380_10660557
538 Ga0157380_12115656
539 Ga0163161_10894303
540 Ga0207697_10081267
541 Ga0207697_10351777
542 Ga0207682_10100384
543 Ga0207682_10137678
544 Ga0207680_10563668
545 Ga0207680_11238314
546 Ga0207705_11399746
547 Ga0207684_10355392
548 Ga0207654_10136512
549 Ga0207662_10004919
550 Ga0207657_10585796
551 Ga0207646_10478103
552 Ga0207646_10676819
553 Ga0207681_10101659
554 Ga0207694_10102756
555 Ga0207694_10768045
556 Ga0207659_10021323
557 Ga0207659_10030590
558 Ga0207659_10122742
559 Ga0207687_10050202
560 Ga0207644_10021801
561 Ga0207644_10593810
562 Ga0207706_10270359
563 Ga0207706_10287863
564 Ga0207709_10026796
565 Ga0207669_10058147
566 Ga0207669_10942460
567 Ga0207669_11327258
568 Ga0207704_11113963
569 Ga0207704_11991289
570 Ga0207691_10033029
571 Ga0207691_10115450
572 Ga0207691_10248654
573 Ga0207711_10145761
574 Ga0207711_10541017
575 Ga0207679_10250671
576 Ga0207667_10794516
577 Ga0207651_10031225
578 Ga0207651_10233436
579 Ga0207651_10497335
580 Ga0207712_10068071
581 Ga0207712_10155961
582 Ga0207668_11374388
583 Ga0207640_10049883
584 Ga0207640_10834377
585 Ga0207658_10498047
586 Ga0207658_11321753
587 Ga0207677_11499930
588 Ga0207703_12256019
589 Ga0207708_10101733
590 Ga0207708_10109374
591 Ga0207708_10114716
592 Ga0207648_10003273
593 Ga0207648_10298856
594 Ga0207674_10259016
595 Ga0207675_100179560
596 Ga0207675_100210688
597 Ga0207675_100566442
598 Ga0207683_10112726
599 Ga0207683_10236971
600 Ga0207683_10830005
601 Ga0207683_10841883
602 Ga0207698_11180322
603 Ga0207698_11210690
604 Ga0207698_12688671
605 Ga0207428_10000004
606 Ga0268266_11767645
607 Ga0268265_10223308
608 Ga0268265_10637623
609 Ga0268265_11556715
610 Ga0268264_10572520
611 Ga0307515_10434721
612 Ga0307408_100259675
613 Ga0307413_10201490
614 Ga0307410_11247764
615 Ga0307406_10572630
616 Ga0307407_10955205
617 Ga0307412_11868340
618 Ga0307409_100474939
619 Ga0307416_100518752
620 Ga0307416_100765378
621 Ga0307416_100869798
622 Ga0307411_10728755
623 Ga0307415_100277720
624 Ga0307415_100363341
625 Ga0373938_0148567
626 Ga0373942_0024648
627 Ga0373961_0266135
628 Ga0373937_1223914
629 Ga0395901_1059589
630 Ga0439453_0137797
631 Ga0439461_0006546
632 Ga0451851_0595806
633 Ga0439431_0244799
634 Ga0439457_164039
635 Ga0450920_044184
636 Ga0450920_078793
637 Ga0450894_025344
638 Ga0450908_003699
639 Ga0439435_0001337
640 Ga0439435_0120654
641 Ga0466972_0377768
642 Ga0466965_0009258
643 Ga0466961_0067118
644 Ga0466963_0043300
645 Ga0466964_0035563
646 Ga0466971_0004513
647 Ga0466968_0019857
648 Ga0466970_0008045
649 Ga0466957_0010886
650 Ga0466957_0556530
651 Ga0466960_0009304
652 Ga0466959_0080605
653 Ga0466958_0025226
654 Ga0466967_0117412
655 Ga0495594_0535956
656 Ga0495628_0870561
657 Ga0495640_0705777
658 Ga0495586_0539174
659 Ga0495633_0278718
660 Ga0495635_0742201
661 Ga0495647_0505265
662 Ga0495614_0408052
663 Ga0496103_0374117
664 Ga0496106_0909628
665 Ga0496108_0513552
666 Ga0496109_1337583
667 Ga0496110_1399440
668 Ga0496114_0550112
669 Ga0501034_0711727
670 Ga0501034_0716718
671 Ga0501036_0063363
672 Ga0501036_1436327
673 Ga0501037_0479242
674 Ga0501043_0110346
675 Ga0501048_0118885
676 Ga0501067_0071017
677 Ga0501069_0382952
678 Ga0501070_1174788
679 Ga0501071_0253651
680 Ga0501072_0059991
681 Ga0501073_0282228
682 Ga0501074_1337190
683 Ga0501075_0036905
684 Ga0501075_1250886
685 Ga0501076_0020674
686 Ga0501076_1397742
687 Ga0501077_0769756
688 Ga0501079_1106527
689 Ga0501079_1196140
690 Ga0501080_0089171
691 Ga0501035_0453866
692 Ga0501044_0200254
693 Ga0501045_0030487
694 Ga0501045_0902127
695 nmdc:mga00v17_358731_c1
696 nmdc:mga0k408_57370_c1
697 nmdc:mga06z11_171315_c1
698 nmdc:mga06z11_17892_c1
699 nmdc:mga06z11_439325_c1
700 nmdc:mga04h51_128130_c1
701 nmdc:mga07m45_482879_c1
702 nmdc:mga07m45_514652_c1
703 nmdc:mga05p37_1291523_c1
704 nmdc:mga05p37_187022_c1
705 nmdc:mga09592_1728062_c1
706 nmdc:mga09592_80753_c1
707 nmdc:mga0qj67_228715_c1
708 nmdc:mga0qj67_23200_c1
709 nmdc:mga06r32_215892_c1
710 nmdc:mga06r32_222846_c1
711 nmdc:mga06r32_494411_c1
712 nmdc:mga08y16_2_c1
713 nmdc:mga0n895_1117911_c1
714 nmdc:mga0rr50_365160_c1
715 nmdc:mga0a205_1083325_c1
716 Ga0501084_0370398
717 Ga0590071_044557
718 Ga0590075_027277
719 Ga0466962_0042649
720 Ga0530510_0115436
721 Ga0530510_1102705
722 2587752962
723 2588212638
724 2739608447
725 2760305798
726 2809030721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

53

152

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8255 48 146
2ql8-assembly1.cif.gz_B crystal structure of a putative redox protein (lsei_0423) from lactobacillus casei atcc 334 at 1.50 a resolution 0.8079 47 144
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8046 20 146
3lus-assembly1.cif.gz_A crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from vibrio cholerae o1 biovar eltor str. n16961 0.7807 23 143
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.773 4 146
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8841 48 146 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8757 48 146 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8513 48 146 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8453 48 146 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8377 48 146 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A522GH03-F1-model_v4 OsmC family peroxiredoxin 0.9401 47 146 GO:0004601
GO:0006979
AF-A0A6L5G3Q2-F1-model_v4 OsmC family peroxiredoxin 0.9355 50 146 GO:0004601
GO:0006979
AF-A0A7W1HEM7-F1-model_v4 OsmC family peroxiredoxin 0.9353 35 146 GO:0004601
GO:0006979
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9339 49 146 GO:0004601
GO:0006979
AF-A0A2V6HEK9-F1-model_v4 Peroxiredoxin 0.9304 33 146 GO:0004601
GO:0006979

Map