F423024

General Info

Members Datasets Scaffolds Average Seq Length
363 218 726 110

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0254299|Ga0373957_0254299_48_446
Length 122
Sequence MPKRKSESRRSRTSAIEDFHAHVYYDAPTTRAEALALCEAAGKKFGVKVGRMHDNPIGPHPRGSCQLTVAKSKFAKVIPWLALNRGNLTVFTHAETGDDLKDHSEHVIWLGPSEKLDLSIFD

Samples

Sample ID Description Type Environment
1 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0
Rhizoplane 9.37
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 6.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373957_0254299 3300035120 Bacteria 740
2 JGI24742J22300_10022108 3300002244 Bacteria 1089
3 Ga0070676_10079303 3300005328 Bacteria 1988
4 Ga0070676_10388028 3300005328 Bacteria 969
5 Ga0070690_100288680 3300005330 Bacteria 1173
6 Ga0070690_101060955 3300005330 Bacteria 641
7 Ga0070682_100591580 3300005337 Bacteria 875
8 Ga0068868_100312596 3300005338 Bacteria 1337
9 Ga0070689_100002092 3300005340 Bacteria 12966
10 Ga0070689_100493598 3300005340 Bacteria 1048
11 Ga0070687_100180836 3300005343 Bacteria 1263
12 Ga0070687_100766534 3300005343 Bacteria 680
13 Ga0070668_100003995 3300005347 Bacteria 10919
14 Ga0070669_100146856 3300005353 Bacteria 1823
15 Ga0070669_100443527 3300005353 Bacteria 1069
16 Ga0070669_101251092 3300005353 Bacteria 642
17 Ga0070675_100118566 3300005354 Bacteria 2247
18 Ga0070671_100021172 3300005355 Bacteria 5309
19 Ga0070671_101357007 3300005355 Bacteria 628
20 Ga0070674_100006161 3300005356 Bacteria 6974
21 Ga0070674_102104354 3300005356 Unclassified 515
22 Ga0070673_100026805 3300005364 Bacteria 4262
23 Ga0070673_100601707 3300005364 Bacteria 1003
24 Ga0070688_100077516 3300005365 Bacteria 2141
25 Ga0070688_100125893 3300005365 Bacteria 1722
26 Ga0070688_100313244 3300005365 Bacteria 1138
27 Ga0070667_100247035 3300005367 Bacteria 1595
28 Ga0070667_100407961 3300005367 Bacteria 1237
29 Ga0070667_101719981 3300005367 Bacteria 590
30 Ga0070667_101769018 3300005367 Bacteria 581
31 Ga0070713_102348223 3300005436 Bacteria 516
32 Ga0070701_11008615 3300005438 Unclassified 581
33 Ga0070711_100910010 3300005439 Bacteria 751
34 Ga0070694_101045866 3300005444 Bacteria 679
35 Ga0070678_100062456 3300005456 Bacteria 2751
36 Ga0070681_10729963 3300005458 Bacteria 907
37 Ga0068867_102140577 3300005459 Bacteria 530
38 Ga0070699_100817299 3300005518 Bacteria 853
39 Ga0070684_102142027 3300005535 Bacteria 528
40 Ga0068853_100311227 3300005539 Bacteria 1458
41 Ga0070672_100176051 3300005543 Bacteria 1781
42 Ga0070672_100889097 3300005543 Bacteria 786
43 Ga0070686_100214754 3300005544 Bacteria 1387
44 Ga0070686_101833150 3300005544 Bacteria 517
45 Ga0070693_100048380 3300005547 Bacteria 2421
46 Ga0070664_101152803 3300005564 Bacteria 731
47 Ga0068859_100010261 3300005617 Bacteria 9427
48 Ga0068859_100115417 3300005617 Bacteria 2750
49 Ga0068859_100795247 3300005617 Bacteria 1034
50 Ga0068859_101232944 3300005617 Bacteria 824
51 Ga0068864_100012228 3300005618 Bacteria 7093
52 Ga0068864_101401253 3300005618 Bacteria 701
53 Ga0068866_10568191 3300005718 Bacteria 761
54 Ga0068866_10704359 3300005718 Bacteria 693
55 Ga0068861_100944416 3300005719 Bacteria 820
56 Ga0068861_101103006 3300005719 Bacteria 763
57 Ga0068870_10434463 3300005840 Bacteria 862
58 Ga0068863_100062239 3300005841 Bacteria 3529
59 Ga0068863_100167269 3300005841 Bacteria 2108
60 Ga0068863_100226080 3300005841 Bacteria 1804
61 Ga0068858_100009879 3300005842 Bacteria 9066
62 Ga0068858_100572874 3300005842 Bacteria 1094
63 Ga0068860_100022751 3300005843 Bacteria 6060
64 Ga0068860_100102841 3300005843 Bacteria 2726
65 Ga0068860_100387836 3300005843 Bacteria 1380
66 Ga0068860_101753381 3300005843 Bacteria 643
67 Ga0068862_100018464 3300005844 Bacteria 5807
68 Ga0068862_100025563 3300005844 Bacteria 4957
69 Ga0068862_100183443 3300005844 Bacteria 1879
70 Ga0068862_100519312 3300005844 Bacteria 1133
71 Ga0068862_100616164 3300005844 Bacteria 1044
72 Ga0068862_100806058 3300005844 Bacteria 917
73 Ga0068862_100872532 3300005844 Unclassified 883
74 Ga0068862_101190149 3300005844 Bacteria 760
75 Ga0068862_101386573 3300005844 Bacteria 706
76 Ga0081539_10064554 3300005985 Bacteria 1991
77 Ga0075362_10292544 3300006177 Bacteria 807
78 Ga0075366_10001418 3300006195 Bacteria 11954
79 Ga0075370_10256951 3300006353 Bacteria 1036
80 Ga0068871_100344792 3300006358 Bacteria 1316
81 Ga0068871_101086303 3300006358 Bacteria 748
82 Ga0075428_100008625 3300006844 Bacteria 11310
83 Ga0075431_100803404 3300006847 Unclassified 914
84 Ga0075429_100624080 3300006880 Bacteria 944
85 Ga0068865_100169162 3300006881 Bacteria 1674
86 Ga0068865_100356203 3300006881 Bacteria 1187
87 Ga0097620_100010261 3300006931 Bacteria 9427
88 Ga0097620_100115414 3300006931 Bacteria 2750
89 Ga0097620_100795296 3300006931 Bacteria 1034
90 Ga0097620_101232370 3300006931 Bacteria 824
91 Ga0105250_10017278 3300009092 Bacteria 2933
92 Ga0105240_11908100 3300009093 Bacteria 618
93 Ga0105245_11918714 3300009098 Unclassified 645
94 Ga0105245_12064385 3300009098 Bacteria 624
95 Ga0105247_10057278 3300009101 Bacteria 2409
96 Ga0105247_10260233 3300009101 Bacteria 1189
97 Ga0114129_10182170 3300009147 Bacteria 2857
98 Ga0105243_10092794 3300009148 Bacteria 2490
99 Ga0105241_10346389 3300009174 Bacteria 1289
100 Ga0105242_10606216 3300009176 Bacteria 1058
101 Ga0105242_10742690 3300009176 Bacteria 965
102 Ga0105242_12095836 3300009176 Unclassified 609
103 Ga0105248_10009989 3300009177 Bacteria 10449
104 Ga0105248_10027863 3300009177 Bacteria 6289
105 Ga0105248_10064674 3300009177 Bacteria 4106
106 Ga0105248_10120090 3300009177 Bacteria 2965
107 Ga0105248_10250419 3300009177 Bacteria 1994
108 Ga0105248_10299498 3300009177 Bacteria 1811
109 Ga0105237_12583599 3300009545 Bacteria 518
110 Ga0105238_10598857 3300009551 Bacteria 1110
111 Ga0105249_10007328 3300009553 Bacteria 9616
112 Ga0105249_10603355 3300009553 Bacteria 1152
113 Ga0105249_13587481 3300009553 Bacteria 500
114 Ga0105246_10276808 3300011119 Bacteria 1344
115 Ga0157373_10113573 3300013100 Bacteria 1904
116 Ga0157378_10240331 3300013297 Bacteria 1730
117 Ga0157378_10818762 3300013297 Bacteria 958
118 Ga0157378_12420084 3300013297 Bacteria 577
119 Ga0157378_12784745 3300013297 Bacteria 541
120 Ga0163162_10016978 3300013306 Bacteria 7121
121 Ga0163162_10254007 3300013306 Bacteria 1890
122 Ga0163162_11331598 3300013306 Bacteria 816
123 Ga0163162_11695118 3300013306 Bacteria 722
124 Ga0163162_11734899 3300013306 Bacteria 713
125 Ga0157375_10430329 3300013308 Bacteria 1486
126 Ga0163163_10007265 3300014325 Bacteria 9767
127 Ga0163163_10207251 3300014325 Bacteria 2009
128 Ga0157380_12112869 3300014326 Bacteria 626
129 Ga0157380_13099763 3300014326 Bacteria 530
130 Ga0182008_10087254 3300014497 Bacteria 1537
131 Ga0157377_10714250 3300014745 Bacteria 729
132 Ga0157377_10750188 3300014745 Bacteria 714
133 Ga0157379_10009950 3300014968 Bacteria 8282
134 Ga0163161_10187824 3300017792 Bacteria 1587
135 Ga0163161_10914926 3300017792 Bacteria 744
136 Ga0163161_11664455 3300017792 Bacteria 564
137 Ga0213876_10005015 3300021384 Bacteria 7302
138 Ga0207696_1135429 3300025711 Bacteria 661
139 Ga0207642_10322099 3300025899 Bacteria 903
140 Ga0207710_10214350 3300025900 Bacteria 954
141 Ga0207688_10516717 3300025901 Unclassified 749
142 Ga0207680_11192259 3300025903 Bacteria 543
143 Ga0207645_10022620 3300025907 Bacteria 4087
144 Ga0207645_10510113 3300025907 Bacteria 815
145 Ga0207643_10120995 3300025908 Bacteria 1551
146 Ga0207707_10142792 3300025912 Bacteria 2093
147 Ga0207707_10829741 3300025912 Bacteria 768
148 Ga0207662_10151513 3300025918 Bacteria 1475
149 Ga0207662_10282391 3300025918 Bacteria 1099
150 Ga0207652_11429332 3300025921 Bacteria 595
151 Ga0207681_10013167 3300025923 Bacteria 5114
152 Ga0207681_10056345 3300025923 Bacteria 2681
153 Ga0207681_10135479 3300025923 Bacteria 1827
154 Ga0207681_10178783 3300025923 Bacteria 1614
155 Ga0207694_10399178 3300025924 Bacteria 1143
156 Ga0207694_11057901 3300025924 Bacteria 687
157 Ga0207659_10651283 3300025926 Bacteria 900
158 Ga0207687_11128396 3300025927 Bacteria 674
159 Ga0207644_10115646 3300025931 Bacteria 2034
160 Ga0207706_10837069 3300025933 Unclassified 780
161 Ga0207686_10421616 3300025934 Bacteria 1021
162 Ga0207709_10053436 3300025935 Bacteria 2486
163 Ga0207670_10264854 3300025936 Bacteria 1334
164 Ga0207670_11230794 3300025936 Bacteria 634
165 Ga0207669_10022443 3300025937 Bacteria 3353
166 Ga0207669_11026931 3300025937 Bacteria 694
167 Ga0207669_11779352 3300025937 Bacteria 526
168 Ga0207704_10052135 3300025938 Bacteria 2479
169 Ga0207704_10364636 3300025938 Bacteria 1129
170 Ga0207704_10601745 3300025938 Bacteria 900
171 Ga0207665_11144718 3300025939 Bacteria 620
172 Ga0207711_10004139 3300025941 Bacteria 12424
173 Ga0207711_10008432 3300025941 Bacteria 8618
174 Ga0207711_10083551 3300025941 Bacteria 2793
175 Ga0207711_10269372 3300025941 Bacteria 1567
176 Ga0207711_10323652 3300025941 Bacteria 1425
177 Ga0207711_10786002 3300025941 Bacteria 887
178 Ga0207689_10186128 3300025942 Bacteria 1713
179 Ga0207651_10053031 3300025960 Bacteria 2769
180 Ga0207651_10343134 3300025960 Bacteria 1255
181 Ga0207712_10006119 3300025961 Bacteria 7589
182 Ga0207668_10074910 3300025972 Bacteria 2432
183 Ga0207658_10013965 3300025986 Bacteria 5496
184 Ga0207658_10042001 3300025986 Bacteria 3314
185 Ga0207658_10045106 3300025986 Bacteria 3212
186 Ga0207658_10242889 3300025986 Bacteria 1526
187 Ga0207677_10613853 3300026023 Bacteria 956
188 Ga0207703_10191659 3300026035 Bacteria 1811
189 Ga0207703_10579270 3300026035 Bacteria 1060
190 Ga0207639_12114899 3300026041 Bacteria 524
191 Ga0207678_10387660 3300026067 Bacteria 1208
192 Ga0207678_10636630 3300026067 Bacteria 936
193 Ga0207708_10503181 3300026075 Bacteria 1016
194 Ga0207708_11711485 3300026075 Bacteria 552
195 Ga0207641_10034680 3300026088 Bacteria 4199
196 Ga0207641_10157292 3300026088 Bacteria 2063
197 Ga0207648_10150308 3300026089 Bacteria 2055
198 Ga0207648_10720314 3300026089 Bacteria 925
199 Ga0207676_10019998 3300026095 Bacteria 4892
200 Ga0207676_10123505 3300026095 Bacteria 2187
201 Ga0207674_10298992 3300026116 Bacteria 1558
202 Ga0207675_100358614 3300026118 Bacteria 1430
203 Ga0207683_10202981 3300026121 Bacteria 1802
204 Ga0207683_10254314 3300026121 Bacteria 1603
205 Ga0268265_10010153 3300028380 Bacteria 6355
206 Ga0268265_10034691 3300028380 Bacteria 3679
207 Ga0268265_10055068 3300028380 Bacteria 3021
208 Ga0268265_10138634 3300028380 Bacteria 2033
209 Ga0268265_10424556 3300028380 Unclassified 1235
210 Ga0268265_10675842 3300028380 Bacteria 995
211 Ga0268265_11019293 3300028380 Unclassified 818
212 Ga0268264_10082765 3300028381 Bacteria 2747
213 Ga0268264_10219318 3300028381 Bacteria 1750
214 Ga0268264_10251260 3300028381 Bacteria 1643
215 Ga0268264_10783056 3300028381 Bacteria 952
216 Ga0268264_11089229 3300028381 Bacteria 807
217 Ga0316182_1428650 3300030745 Unclassified 567
218 Ga0265325_10000999 3300031241 Bacteria 20325
219 Ga0307405_10527828 3300031731 Bacteria 951
220 Ga0307413_10269195 3300031824 Bacteria 1274
221 Ga0307413_10289034 3300031824 Bacteria 1237
222 Ga0307410_10069619 3300031852 Bacteria 2434
223 Ga0307407_10054226 3300031903 Bacteria 2311
224 Ga0307407_10175300 3300031903 Bacteria 1416
225 Ga0307409_100789152 3300031995 Bacteria 956
226 Ga0307409_100896980 3300031995 Unclassified 900
227 Ga0307416_101622460 3300032002 Unclassified 752
228 Ga0307414_10851860 3300032004 Bacteria 833
229 Ga0307411_10048747 3300032005 Bacteria 2747
230 Ga0373958_0025274 3300034819 Bacteria 1129
231 Ga0373929_0208903 3300035085 Bacteria 550
232 Ga0373929_0231305 3300035085 Bacteria 529
233 Ga0373934_0373367 3300035086 Bacteria 595
234 Ga0373949_0046835 3300035090 Bacteria 1079
235 Ga0373952_0083846 3300035092 Bacteria 818
236 Ga0373932_0074686 3300035112 Bacteria 1059
237 Ga0373936_0462841 3300035113 Bacteria 587
238 Ga0373939_0195190 3300035114 Bacteria 763
239 Ga0373939_0215835 3300035114 Bacteria 732
240 Ga0373945_0265904 3300035116 Bacteria 728
241 Ga0373960_0035011 3300035121 Bacteria 1423
242 Ga0373943_0062786 3300035170 Bacteria 1861
243 Ga0373946_0391537 3300035171 Bacteria 700
244 Ga0373942_0073244 3300035207 Bacteria 1004
245 Ga0373942_0075913 3300035207 Unclassified 990
246 Ga0373961_0035595 3300035241 Bacteria 1414
247 Ga0373961_0064816 3300035241 Bacteria 1117
248 Ga0373961_0150402 3300035241 Bacteria 793
249 Ga0373931_0001902 3300035691 Bacteria 9137
250 Ga0373935_0525824 3300035692 Bacteria 861
251 Ga0373927_0082633 3300035695 Bacteria 2083
252 Ga0373947_0046841 3300035725 Bacteria 2590
253 Ga0373947_0218002 3300035725 Bacteria 1254
254 Ga0373937_0200521 3300036401 Unclassified 1876
255 Ga0395899_0576034 3300037312 Unclassified 720
256 Ga0395900_0033586 3300037418 Bacteria 5280
257 Ga0395905_0016386 3300037471 Bacteria 7042
258 Ga0395905_0466785 3300037471 Bacteria 1161
259 Ga0395901_0678395 3300038443 Unclassified 1030
260 Ga0436365_0749558 3300039437 Bacteria 9729
261 Ga0451802_1144521 3300041460 Unclassified 500
262 Ga0439441_112462 3300042001 Bacteria 619
263 Ga0439464_0004299 3300042439 Bacteria 3640
264 Ga0466966_0000040 3300044684 Bacteria 97159
265 Ga0495592_0305960 3300046454 Bacteria 1032
266 Ga0495584_0433034 3300046491 Bacteria 669
267 Ga0495585_0081823 3300046492 Bacteria 1749
268 Ga0495628_0104750 3300046516 Bacteria 2180
269 Ga0495663_0000947 3300046525 Bacteria 9686
270 Ga0495663_0161883 3300046525 Unclassified 768
271 Ga0495654_0000194 3300046530 Bacteria 59637
272 Ga0495598_0058867 3300046537 Bacteria 1179
273 Ga0495621_0001426 3300046539 Bacteria 6188
274 Ga0495633_0014849 3300046558 Bacteria 4054
275 Ga0495656_0278557 3300046615 Bacteria 852
276 Ga0495668_0003497 3300046616 Bacteria 11713
277 Ga0495668_0685267 3300046616 Unclassified 567
278 Ga0495625_0154459 3300046660 Bacteria 1541
279 Ga0495661_0171443 3300046665 Bacteria 1157
280 Ga0495658_1017066 3300046683 Bacteria 529
281 Ga0495669_0004849 3300046684 Bacteria 5584
282 Ga0495669_0006784 3300046684 Bacteria 4791
283 Ga0495669_0176290 3300046684 Bacteria 1018
284 Ga0495670_0012920 3300046691 Bacteria 4104
285 Ga0495677_0001591 3300047445 Bacteria 9146
286 Ga0495677_0012201 3300047445 Bacteria 3136
287 Ga0496100_0207820 3300048903 Bacteria 1430
288 Ga0496100_0236596 3300048903 Bacteria 1346
289 Ga0496100_0439071 3300048903 Bacteria 999
290 Ga0496101_0011931 3300048904 Bacteria 5787
291 Ga0496101_1596629 3300048904 Bacteria 507
292 Ga0496102_0104792 3300048905 Bacteria 2631
293 Ga0496102_0460900 3300048905 Bacteria 1192
294 Ga0496102_0833243 3300048905 Bacteria 845
295 Ga0496103_0243057 3300048906 Bacteria 1158
296 Ga0496103_0397129 3300048906 Bacteria 886
297 Ga0496103_0633741 3300048906 Bacteria 680
298 Ga0496104_0112613 3300048907 Bacteria 2609
299 Ga0496105_0109347 3300048908 Bacteria 2282
300 Ga0496106_0442573 3300048909 Bacteria 1044
301 Ga0496108_0259488 3300048911 Bacteria 1512
302 Ga0496108_0363354 3300048911 Bacteria 1264
303 Ga0496109_0090591 3300048912 Bacteria 2828
304 Ga0496109_0458967 3300048912 Bacteria 1203
305 Ga0496109_1809252 3300048912 Bacteria 544
306 Ga0496110_0199437 3300048913 Bacteria 1818
307 Ga0496110_0292962 3300048913 Bacteria 1482
308 Ga0496110_0500260 3300048913 Bacteria 1107
309 Ga0496110_0628290 3300048913 Bacteria 973
310 Ga0496111_0197102 3300048914 Bacteria 1497
311 Ga0496111_0550982 3300048914 Bacteria 847
312 Ga0496112_0029227 3300048915 Bacteria 5329
313 Ga0496112_0235095 3300048915 Bacteria 1786
314 Ga0496112_0348312 3300048915 Bacteria 1424
315 Ga0496112_0676239 3300048915 Bacteria 961
316 Ga0496113_0199346 3300048916 Bacteria 1591
317 Ga0496114_0015638 3300048917 Bacteria 6103
318 Ga0496114_0809706 3300048917 Bacteria 816
319 Ga0496114_1603927 3300048917 Bacteria 539
320 Ga0501033_0232554 3300049570 Bacteria 1309
321 Ga0501034_0552466 3300049571 Unclassified 1061
322 Ga0501038_1243652 3300049574 Unclassified 539
323 Ga0501040_0206759 3300049576 Bacteria 1395
324 Ga0501043_1181396 3300049579 Bacteria 538
325 Ga0501046_0102642 3300049580 Bacteria 2192
326 Ga0501046_0486391 3300049580 Bacteria 885
327 Ga0501072_0174892 3300049588 Bacteria 1713
328 Ga0501072_0434338 3300049588 Unclassified 1040
329 Ga0501073_0925101 3300049589 Bacteria 600
330 Ga0501075_0173601 3300049591 Bacteria 1645
331 Ga0501077_0191691 3300049593 Bacteria 1299
332 Ga0501077_1079311 3300049593 Bacteria 517
333 Ga0501079_0010058 3300049741 Bacteria 7182
334 Ga0501079_0180296 3300049741 Bacteria 1648
335 Ga0501080_0207328 3300049742 Bacteria 1797
336 Ga0501081_0003392 3300049743 Bacteria 10145
337 Ga0501083_0607376 3300049744 Bacteria 712
338 Ga0501279_111020 3300049775 Bacteria 503
339 Ga0501035_1022265 3300049822 Unclassified 649
340 Ga0501045_0026014 3300049824 Bacteria 4208
341 nmdc:mga03683_379007_c1 3300050489 Bacteria 673
342 nmdc:mga03683_44674_c2 3300050489 Bacteria 836
343 nmdc:mga03n38_118695_c1 3300050490 Bacteria 1297
344 nmdc:mga0k408_3055_c1 3300050493 Bacteria 8879
345 nmdc:mga07m45_155299_c1 3300050496 Bacteria 1327
346 nmdc:mga09592_608182_c1 3300050508 Bacteria 936
347 Ga0495601_0447639 3300053077 Bacteria 835
348 Ga0495612_0024007 3300053078 Bacteria 2449
349 Ga0495655_0067512 3300053083 Bacteria 992
350 Ga0495655_0144159 3300053083 Bacteria 744
351 Ga0495619_0754223 3300053085 Bacteria 660
352 Ga0495619_1190378 3300053085 Bacteria 505
353 Ga0500562_001665 3300053108 Bacteria 5528
354 Ga0500592_057528 3300053116 Unclassified 635
355 Ga0500658_0068397 3300053134 Bacteria 1493
356 Ga0500568_0005194 3300053139 Bacteria 6788
357 Ga0500604_0014990 3300053151 Bacteria 2116
358 Ga0500627_0000386 3300053158 Bacteria 11906
359 Ga0501084_1681579 3300054114 Bacteria 530
360 Ga0501082_0223612 3300060353 Bacteria 1638
361 Ga0501082_0509138 3300060353 Bacteria 1052
362 Ga0530510_0066809 3300061734 Bacteria 2608
363 Ga0530510_0388695 3300061734 Bacteria 1051
364 Ga0373957_0254299
365 JGI24742J22300_10022108
366 Ga0070676_10079303
367 Ga0070676_10388028
368 Ga0070690_100288680
369 Ga0070690_101060955
370 Ga0070682_100591580
371 Ga0068868_100312596
372 Ga0070689_100002092
373 Ga0070689_100493598
374 Ga0070687_100180836
375 Ga0070687_100766534
376 Ga0070668_100003995
377 Ga0070669_100146856
378 Ga0070669_100443527
379 Ga0070669_101251092
380 Ga0070675_100118566
381 Ga0070671_100021172
382 Ga0070671_101357007
383 Ga0070674_100006161
384 Ga0070674_102104354
385 Ga0070673_100026805
386 Ga0070673_100601707
387 Ga0070688_100077516
388 Ga0070688_100125893
389 Ga0070688_100313244
390 Ga0070667_100247035
391 Ga0070667_100407961
392 Ga0070667_101719981
393 Ga0070667_101769018
394 Ga0070713_102348223
395 Ga0070701_11008615
396 Ga0070711_100910010
397 Ga0070694_101045866
398 Ga0070678_100062456
399 Ga0070681_10729963
400 Ga0068867_102140577
401 Ga0070699_100817299
402 Ga0070684_102142027
403 Ga0068853_100311227
404 Ga0070672_100176051
405 Ga0070672_100889097
406 Ga0070686_100214754
407 Ga0070686_101833150
408 Ga0070693_100048380
409 Ga0070664_101152803
410 Ga0068859_100010261
411 Ga0068859_100115417
412 Ga0068859_100795247
413 Ga0068859_101232944
414 Ga0068864_100012228
415 Ga0068864_101401253
416 Ga0068866_10568191
417 Ga0068866_10704359
418 Ga0068861_100944416
419 Ga0068861_101103006
420 Ga0068870_10434463
421 Ga0068863_100062239
422 Ga0068863_100167269
423 Ga0068863_100226080
424 Ga0068858_100009879
425 Ga0068858_100572874
426 Ga0068860_100022751
427 Ga0068860_100102841
428 Ga0068860_100387836
429 Ga0068860_101753381
430 Ga0068862_100018464
431 Ga0068862_100025563
432 Ga0068862_100183443
433 Ga0068862_100519312
434 Ga0068862_100616164
435 Ga0068862_100806058
436 Ga0068862_100872532
437 Ga0068862_101190149
438 Ga0068862_101386573
439 Ga0081539_10064554
440 Ga0075362_10292544
441 Ga0075366_10001418
442 Ga0075370_10256951
443 Ga0068871_100344792
444 Ga0068871_101086303
445 Ga0075428_100008625
446 Ga0075431_100803404
447 Ga0075429_100624080
448 Ga0068865_100169162
449 Ga0068865_100356203
450 Ga0097620_100010261
451 Ga0097620_100115414
452 Ga0097620_100795296
453 Ga0097620_101232370
454 Ga0105250_10017278
455 Ga0105240_11908100
456 Ga0105245_11918714
457 Ga0105245_12064385
458 Ga0105247_10057278
459 Ga0105247_10260233
460 Ga0114129_10182170
461 Ga0105243_10092794
462 Ga0105241_10346389
463 Ga0105242_10606216
464 Ga0105242_10742690
465 Ga0105242_12095836
466 Ga0105248_10009989
467 Ga0105248_10027863
468 Ga0105248_10064674
469 Ga0105248_10120090
470 Ga0105248_10250419
471 Ga0105248_10299498
472 Ga0105237_12583599
473 Ga0105238_10598857
474 Ga0105249_10007328
475 Ga0105249_10603355
476 Ga0105249_13587481
477 Ga0105246_10276808
478 Ga0157373_10113573
479 Ga0157378_10240331
480 Ga0157378_10818762
481 Ga0157378_12420084
482 Ga0157378_12784745
483 Ga0163162_10016978
484 Ga0163162_10254007
485 Ga0163162_11331598
486 Ga0163162_11695118
487 Ga0163162_11734899
488 Ga0157375_10430329
489 Ga0163163_10007265
490 Ga0163163_10207251
491 Ga0157380_12112869
492 Ga0157380_13099763
493 Ga0182008_10087254
494 Ga0157377_10714250
495 Ga0157377_10750188
496 Ga0157379_10009950
497 Ga0163161_10187824
498 Ga0163161_10914926
499 Ga0163161_11664455
500 Ga0213876_10005015
501 Ga0207696_1135429
502 Ga0207642_10322099
503 Ga0207710_10214350
504 Ga0207688_10516717
505 Ga0207680_11192259
506 Ga0207645_10022620
507 Ga0207645_10510113
508 Ga0207643_10120995
509 Ga0207707_10142792
510 Ga0207707_10829741
511 Ga0207662_10151513
512 Ga0207662_10282391
513 Ga0207652_11429332
514 Ga0207681_10013167
515 Ga0207681_10056345
516 Ga0207681_10135479
517 Ga0207681_10178783
518 Ga0207694_10399178
519 Ga0207694_11057901
520 Ga0207659_10651283
521 Ga0207687_11128396
522 Ga0207644_10115646
523 Ga0207706_10837069
524 Ga0207686_10421616
525 Ga0207709_10053436
526 Ga0207670_10264854
527 Ga0207670_11230794
528 Ga0207669_10022443
529 Ga0207669_11026931
530 Ga0207669_11779352
531 Ga0207704_10052135
532 Ga0207704_10364636
533 Ga0207704_10601745
534 Ga0207665_11144718
535 Ga0207711_10004139
536 Ga0207711_10008432
537 Ga0207711_10083551
538 Ga0207711_10269372
539 Ga0207711_10323652
540 Ga0207711_10786002
541 Ga0207689_10186128
542 Ga0207651_10053031
543 Ga0207651_10343134
544 Ga0207712_10006119
545 Ga0207668_10074910
546 Ga0207658_10013965
547 Ga0207658_10042001
548 Ga0207658_10045106
549 Ga0207658_10242889
550 Ga0207677_10613853
551 Ga0207703_10191659
552 Ga0207703_10579270
553 Ga0207639_12114899
554 Ga0207678_10387660
555 Ga0207678_10636630
556 Ga0207708_10503181
557 Ga0207708_11711485
558 Ga0207641_10034680
559 Ga0207641_10157292
560 Ga0207648_10150308
561 Ga0207648_10720314
562 Ga0207676_10019998
563 Ga0207676_10123505
564 Ga0207674_10298992
565 Ga0207675_100358614
566 Ga0207683_10202981
567 Ga0207683_10254314
568 Ga0268265_10010153
569 Ga0268265_10034691
570 Ga0268265_10055068
571 Ga0268265_10138634
572 Ga0268265_10424556
573 Ga0268265_10675842
574 Ga0268265_11019293
575 Ga0268264_10082765
576 Ga0268264_10219318
577 Ga0268264_10251260
578 Ga0268264_10783056
579 Ga0268264_11089229
580 Ga0316182_1428650
581 Ga0265325_10000999
582 Ga0307405_10527828
583 Ga0307413_10269195
584 Ga0307413_10289034
585 Ga0307410_10069619
586 Ga0307407_10054226
587 Ga0307407_10175300
588 Ga0307409_100789152
589 Ga0307409_100896980
590 Ga0307416_101622460
591 Ga0307414_10851860
592 Ga0307411_10048747
593 Ga0373958_0025274
594 Ga0373929_0208903
595 Ga0373929_0231305
596 Ga0373934_0373367
597 Ga0373949_0046835
598 Ga0373952_0083846
599 Ga0373932_0074686
600 Ga0373936_0462841
601 Ga0373939_0195190
602 Ga0373939_0215835
603 Ga0373945_0265904
604 Ga0373960_0035011
605 Ga0373943_0062786
606 Ga0373946_0391537
607 Ga0373942_0073244
608 Ga0373942_0075913
609 Ga0373961_0035595
610 Ga0373961_0064816
611 Ga0373961_0150402
612 Ga0373931_0001902
613 Ga0373935_0525824
614 Ga0373927_0082633
615 Ga0373947_0046841
616 Ga0373947_0218002
617 Ga0373937_0200521
618 Ga0395899_0576034
619 Ga0395900_0033586
620 Ga0395905_0016386
621 Ga0395905_0466785
622 Ga0395901_0678395
623 Ga0436365_0749558
624 Ga0451802_1144521
625 Ga0439441_112462
626 Ga0439464_0004299
627 Ga0466966_0000040
628 Ga0495592_0305960
629 Ga0495584_0433034
630 Ga0495585_0081823
631 Ga0495628_0104750
632 Ga0495663_0000947
633 Ga0495663_0161883
634 Ga0495654_0000194
635 Ga0495598_0058867
636 Ga0495621_0001426
637 Ga0495633_0014849
638 Ga0495656_0278557
639 Ga0495668_0003497
640 Ga0495668_0685267
641 Ga0495625_0154459
642 Ga0495661_0171443
643 Ga0495658_1017066
644 Ga0495669_0004849
645 Ga0495669_0006784
646 Ga0495669_0176290
647 Ga0495670_0012920
648 Ga0495677_0001591
649 Ga0495677_0012201
650 Ga0496100_0207820
651 Ga0496100_0236596
652 Ga0496100_0439071
653 Ga0496101_0011931
654 Ga0496101_1596629
655 Ga0496102_0104792
656 Ga0496102_0460900
657 Ga0496102_0833243
658 Ga0496103_0243057
659 Ga0496103_0397129
660 Ga0496103_0633741
661 Ga0496104_0112613
662 Ga0496105_0109347
663 Ga0496106_0442573
664 Ga0496108_0259488
665 Ga0496108_0363354
666 Ga0496109_0090591
667 Ga0496109_0458967
668 Ga0496109_1809252
669 Ga0496110_0199437
670 Ga0496110_0292962
671 Ga0496110_0500260
672 Ga0496110_0628290
673 Ga0496111_0197102
674 Ga0496111_0550982
675 Ga0496112_0029227
676 Ga0496112_0235095
677 Ga0496112_0348312
678 Ga0496112_0676239
679 Ga0496113_0199346
680 Ga0496114_0015638
681 Ga0496114_0809706
682 Ga0496114_1603927
683 Ga0501033_0232554
684 Ga0501034_0552466
685 Ga0501038_1243652
686 Ga0501040_0206759
687 Ga0501043_1181396
688 Ga0501046_0102642
689 Ga0501046_0486391
690 Ga0501072_0174892
691 Ga0501072_0434338
692 Ga0501073_0925101
693 Ga0501075_0173601
694 Ga0501077_0191691
695 Ga0501077_1079311
696 Ga0501079_0010058
697 Ga0501079_0180296
698 Ga0501080_0207328
699 Ga0501081_0003392
700 Ga0501083_0607376
701 Ga0501279_111020
702 Ga0501035_1022265
703 Ga0501045_0026014
704 nmdc:mga03683_379007_c1
705 nmdc:mga03683_44674_c2
706 nmdc:mga03n38_118695_c1
707 nmdc:mga0k408_3055_c1
708 nmdc:mga07m45_155299_c1
709 nmdc:mga09592_608182_c1
710 Ga0495601_0447639
711 Ga0495612_0024007
712 Ga0495655_0067512
713 Ga0495655_0144159
714 Ga0495619_0754223
715 Ga0495619_1190378
716 Ga0500562_001665
717 Ga0500592_057528
718 Ga0500658_0068397
719 Ga0500568_0005194
720 Ga0500604_0014990
721 Ga0500627_0000386
722 Ga0501084_1681579
723 Ga0501082_0223612
724 Ga0501082_0509138
725 Ga0530510_0066809
726 Ga0530510_0388695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08883

DOPA_dioxygen

Dopa 4,5-dioxygenase family

19

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9747 4 106
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.9466 4 109
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9139 4 106
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.9136 4 109
8cav-assembly1.cif.gz_A discovery of the lanthipeptide curvocidin and structural insights into its trifunctional synthetase cuvl 0.756 1 81
ID Description Score Start End Superfamily
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9737 4 106 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.934 4 109 3.30.70.1240
af_Q59TT2_5_125_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9101 4 107 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9016 4 109 3.30.70.1240
af_A0A1D8PEW7_24_150_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9 4 106 3.30.70.1240
ID Description Score Start End GO Terms
AF-A0A2S6V8L9-F1-model_v4 4,5-dioxygenase 0.9968 4 107 GO:0051213
AF-K9XKE6-F1-model_v4 Dopa 45-dioxygenase 0.9965 4 107 GO:0051213
AF-A0A2U1CHG1-F1-model_v4 DOPA 4,5-dioxygenase 0.9945 2 107 GO:0051213
AF-A0A7H0G3F5-F1-model_v4 deleted 0.9941 1 108
AF-A0A3M5YZ34-F1-model_v4 deleted 0.9931 4 109

Map