F423014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 189 | 361 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100100745|Ga0307408_1001007452 |
| Length | 241 |
| Sequence | MERYKNLHLWMIIPMAIMQIGIFYDYWGDLTENAWSVHIHYWTATLWYVYLIIQPYYATRNKLEKHRTNGIIGFFLAGGVAMTALSALHRDIVNAERSAQMPEVFGPFEPWFFYGIAAVEIVMMSAFIFAIIQSIRYRHSVEDHAWWLISTVFIIMMPALGRGMGVLLIIIFGPTSVVNNASLYLTTGIIIAITLWAAVKYGRVNHPATWLAIGVNLFNLLFEPLGKWEWLQGVLRAMIKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 2 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 149 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 155 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 156 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 157 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 158 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 159 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 160 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 161 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 162 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 163 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 164 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 169 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 171 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 172 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 173 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 174 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 175 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 176 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 177 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 178 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 181 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 182 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 183 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 184 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 185 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 186 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 97.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1027736 | 3300001915 | Unclassified | 857 |
| 2 | JGI24740J21852_10003511 | 3300001979 | Bacteria | 6872 |
| 3 | JGI24739J22299_10001448 | 3300001989 | Bacteria | 8950 |
| 4 | JGI24737J22298_10000410 | 3300001990 | Bacteria | 14666 |
| 5 | JGI24738J21930_10001309 | 3300002075 | Bacteria | 6961 |
| 6 | JGI24034J26672_10002635 | 3300002239 | Bacteria | 2471 |
| 7 | JGI24751J29686_10000732 | 3300002459 | Bacteria | 7929 |
| 8 | Ga0065714_10118312 | 3300005288 | Bacteria | 1380 |
| 9 | Ga0065712_10284537 | 3300005290 | Bacteria | 883 |
| 10 | Ga0065712_10338364 | 3300005290 | Bacteria | 793 |
| 11 | Ga0065715_10103373 | 3300005293 | Bacteria | 3039 |
| 12 | Ga0065715_10293209 | 3300005293 | Bacteria | 1050 |
| 13 | Ga0070658_10001117 | 3300005327 | Bacteria | 22909 |
| 14 | Ga0070658_10098318 | 3300005327 | Unclassified | 2417 |
| 15 | Ga0070676_10000162 | 3300005328 | Bacteria | 26894 |
| 16 | Ga0070676_10002241 | 3300005328 | Bacteria | 9869 |
| 17 | Ga0070676_10027630 | 3300005328 | Bacteria | 3219 |
| 18 | Ga0070670_100010999 | 3300005331 | Bacteria | 7730 |
| 19 | Ga0070670_100215482 | 3300005331 | Bacteria | 1670 |
| 20 | Ga0070670_100256497 | 3300005331 | Bacteria | 1524 |
| 21 | Ga0070670_100425760 | 3300005331 | Bacteria | 1174 |
| 22 | Ga0070677_10141328 | 3300005333 | Unclassified | 1111 |
| 23 | Ga0070677_10301603 | 3300005333 | Unclassified | 814 |
| 24 | Ga0068869_100000198 | 3300005334 | Bacteria | 31224 |
| 25 | Ga0068869_100075695 | 3300005334 | Bacteria | 2501 |
| 26 | Ga0068869_100118686 | 3300005334 | Unclassified | 2020 |
| 27 | Ga0068869_100170784 | 3300005334 | Bacteria | 1698 |
| 28 | Ga0068869_100204952 | 3300005334 | Bacteria | 1557 |
| 29 | Ga0070682_100289501 | 3300005337 | Unclassified | 1197 |
| 30 | Ga0068868_100005453 | 3300005338 | Bacteria | 8940 |
| 31 | Ga0068868_100396454 | 3300005338 | Bacteria | 1190 |
| 32 | Ga0068868_100752178 | 3300005338 | Unclassified | 876 |
| 33 | Ga0070660_100007976 | 3300005339 | Bacteria | 7398 |
| 34 | Ga0070660_100035692 | 3300005339 | Unclassified | 3764 |
| 35 | Ga0070661_100225674 | 3300005344 | Unclassified | 1438 |
| 36 | Ga0070692_10254987 | 3300005345 | Unclassified | 1052 |
| 37 | Ga0070668_100003957 | 3300005347 | Bacteria | 10951 |
| 38 | Ga0070668_100629430 | 3300005347 | Bacteria | 941 |
| 39 | Ga0070669_100005945 | 3300005353 | Bacteria | 8804 |
| 40 | Ga0070675_100085037 | 3300005354 | Bacteria | 2642 |
| 41 | Ga0070675_100377555 | 3300005354 | Bacteria | 1261 |
| 42 | Ga0070671_100310692 | 3300005355 | Bacteria | 1343 |
| 43 | Ga0070674_100074092 | 3300005356 | Bacteria | 2415 |
| 44 | Ga0070674_100592365 | 3300005356 | Unclassified | 936 |
| 45 | Ga0070673_100003953 | 3300005364 | Bacteria | 9315 |
| 46 | Ga0070673_100039657 | 3300005364 | Bacteria | 3606 |
| 47 | Ga0070688_100017650 | 3300005365 | Bacteria | 4099 |
| 48 | Ga0070659_100159430 | 3300005366 | Bacteria | 1844 |
| 49 | Ga0070667_100108662 | 3300005367 | Bacteria | 2403 |
| 50 | Ga0070667_100247665 | 3300005367 | Bacteria | 1592 |
| 51 | Ga0070701_10098507 | 3300005438 | Bacteria | 1615 |
| 52 | Ga0070663_100002083 | 3300005455 | Bacteria | 11184 |
| 53 | Ga0070663_100132143 | 3300005455 | Bacteria | 1897 |
| 54 | Ga0070678_100028880 | 3300005456 | Bacteria | 3789 |
| 55 | Ga0070662_100136783 | 3300005457 | Bacteria | 1895 |
| 56 | Ga0068867_100028807 | 3300005459 | Bacteria | 3998 |
| 57 | Ga0068867_100046729 | 3300005459 | Bacteria | 3180 |
| 58 | Ga0070685_10011933 | 3300005466 | Bacteria | 4555 |
| 59 | Ga0070698_100119180 | 3300005471 | Bacteria | 2600 |
| 60 | Ga0068853_100011123 | 3300005539 | Bacteria | 7300 |
| 61 | Ga0068853_100215595 | 3300005539 | Unclassified | 1751 |
| 62 | Ga0070672_100009126 | 3300005543 | Bacteria | 6823 |
| 63 | Ga0070672_100133357 | 3300005543 | Bacteria | 2043 |
| 64 | Ga0070686_100152260 | 3300005544 | Unclassified | 1621 |
| 65 | Ga0070693_100076725 | 3300005547 | Unclassified | 1981 |
| 66 | Ga0070665_100560837 | 3300005548 | Bacteria | 1155 |
| 67 | Ga0070704_100067615 | 3300005549 | Bacteria | 2581 |
| 68 | Ga0068855_100047224 | 3300005563 | Bacteria | 5087 |
| 69 | Ga0068857_100013740 | 3300005577 | Bacteria | 7055 |
| 70 | Ga0068854_100000599 | 3300005578 | Bacteria | 21420 |
| 71 | Ga0070702_100029342 | 3300005615 | Bacteria | 2990 |
| 72 | Ga0068852_100079115 | 3300005616 | Bacteria | 2911 |
| 73 | Ga0068852_100382621 | 3300005616 | Unclassified | 1381 |
| 74 | Ga0068859_100001069 | 3300005617 | Bacteria | 28045 |
| 75 | Ga0068859_100027955 | 3300005617 | Bacteria | 5655 |
| 76 | Ga0068859_100041431 | 3300005617 | Bacteria | 4625 |
| 77 | Ga0068859_100057579 | 3300005617 | Bacteria | 3915 |
| 78 | Ga0068859_100175498 | 3300005617 | Bacteria | 2225 |
| 79 | Ga0068859_100243299 | 3300005617 | Bacteria | 1889 |
| 80 | Ga0068859_100583462 | 3300005617 | Bacteria | 1211 |
| 81 | Ga0068864_100007601 | 3300005618 | Bacteria | 8927 |
| 82 | Ga0068864_100038363 | 3300005618 | Bacteria | 4091 |
| 83 | Ga0068864_100251039 | 3300005618 | Bacteria | 1643 |
| 84 | Ga0068866_10028343 | 3300005718 | Bacteria | 2667 |
| 85 | Ga0068861_100177225 | 3300005719 | Bacteria | 1771 |
| 86 | Ga0068851_10087516 | 3300005834 | Bacteria | 1636 |
| 87 | Ga0068851_10155049 | 3300005834 | Unclassified | 1254 |
| 88 | Ga0068851_10407926 | 3300005834 | Unclassified | 800 |
| 89 | Ga0068870_10180928 | 3300005840 | Bacteria | 1265 |
| 90 | Ga0068863_100004142 | 3300005841 | Bacteria | 14326 |
| 91 | Ga0068863_100021780 | 3300005841 | Bacteria | 6116 |
| 92 | Ga0068863_100034558 | 3300005841 | Bacteria | 4815 |
| 93 | Ga0068863_100043383 | 3300005841 | Bacteria | 4270 |
| 94 | Ga0068863_100061185 | 3300005841 | Bacteria | 3559 |
| 95 | Ga0068863_100639974 | 3300005841 | Unclassified | 1054 |
| 96 | Ga0068858_100004047 | 3300005842 | Bacteria | 14457 |
| 97 | Ga0068860_100084177 | 3300005843 | Bacteria | 3025 |
| 98 | Ga0068860_100099851 | 3300005843 | Bacteria | 2768 |
| 99 | Ga0068860_100260989 | 3300005843 | Bacteria | 1689 |
| 100 | Ga0068860_100554794 | 3300005843 | Bacteria | 1151 |
| 101 | Ga0068862_100003966 | 3300005844 | Bacteria | 12575 |
| 102 | Ga0068862_100026268 | 3300005844 | Bacteria | 4894 |
| 103 | Ga0068862_100134655 | 3300005844 | Unclassified | 2189 |
| 104 | Ga0068862_100198667 | 3300005844 | Unclassified | 1807 |
| 105 | Ga0068862_100347048 | 3300005844 | Unclassified | 1376 |
| 106 | Ga0068862_100421659 | 3300005844 | Bacteria | 1252 |
| 107 | Ga0068862_100523615 | 3300005844 | Unclassified | 1128 |
| 108 | Ga0097621_100283047 | 3300006237 | Bacteria | 1460 |
| 109 | Ga0097621_100551445 | 3300006237 | Unclassified | 1049 |
| 110 | Ga0068871_100007484 | 3300006358 | Bacteria | 7811 |
| 111 | Ga0068871_100076822 | 3300006358 | Bacteria | 2758 |
| 112 | Ga0075428_100114387 | 3300006844 | Bacteria | 2940 |
| 113 | Ga0075428_100478032 | 3300006844 | Bacteria | 1333 |
| 114 | Ga0068865_100007392 | 3300006881 | Bacteria | 6760 |
| 115 | Ga0068865_100420646 | 3300006881 | Unclassified | 1098 |
| 116 | Ga0097620_100001069 | 3300006931 | Bacteria | 28045 |
| 117 | Ga0097620_100027955 | 3300006931 | Bacteria | 5655 |
| 118 | Ga0097620_100041431 | 3300006931 | Bacteria | 4625 |
| 119 | Ga0097620_100057576 | 3300006931 | Bacteria | 3915 |
| 120 | Ga0097620_100175492 | 3300006931 | Bacteria | 2225 |
| 121 | Ga0097620_100243305 | 3300006931 | Bacteria | 1889 |
| 122 | Ga0097620_100583439 | 3300006931 | Bacteria | 1211 |
| 123 | Ga0111539_10021370 | 3300009094 | Bacteria | 7967 |
| 124 | Ga0111539_10359661 | 3300009094 | Bacteria | 1694 |
| 125 | Ga0111539_11224056 | 3300009094 | Bacteria | 872 |
| 126 | Ga0105245_10002561 | 3300009098 | Bacteria | 16366 |
| 127 | Ga0105245_10040666 | 3300009098 | Bacteria | 4143 |
| 128 | Ga0105243_10029828 | 3300009148 | Bacteria | 4197 |
| 129 | Ga0105243_10188750 | 3300009148 | Bacteria | 1798 |
| 130 | Ga0105241_10073112 | 3300009174 | Unclassified | 2666 |
| 131 | Ga0105242_10171652 | 3300009176 | Bacteria | 1906 |
| 132 | Ga0105242_10371820 | 3300009176 | Bacteria | 1326 |
| 133 | Ga0105242_10658402 | 3300009176 | Bacteria | 1019 |
| 134 | Ga0105248_10005697 | 3300009177 | Bacteria | 13685 |
| 135 | Ga0105248_10036110 | 3300009177 | Bacteria | 5527 |
| 136 | Ga0105249_10011702 | 3300009553 | Bacteria | 7717 |
| 137 | Ga0105249_10422426 | 3300009553 | Bacteria | 1367 |
| 138 | Ga0105239_10045011 | 3300010375 | Bacteria | 4837 |
| 139 | Ga0105246_10019359 | 3300011119 | Bacteria | 4348 |
| 140 | Ga0157373_10030026 | 3300013100 | Bacteria | 3912 |
| 141 | Ga0157371_10006813 | 3300013102 | Bacteria | 9338 |
| 142 | Ga0157370_10027055 | 3300013104 | Bacteria | 5655 |
| 143 | Ga0157378_10020341 | 3300013297 | Bacteria | 5838 |
| 144 | Ga0163162_10135395 | 3300013306 | Bacteria | 2574 |
| 145 | Ga0163162_10391674 | 3300013306 | Bacteria | 1522 |
| 146 | Ga0157375_10039115 | 3300013308 | Bacteria | 4561 |
| 147 | Ga0157375_10072756 | 3300013308 | Bacteria | 3455 |
| 148 | Ga0157375_10197512 | 3300013308 | Bacteria | 2167 |
| 149 | Ga0157375_10726629 | 3300013308 | Unclassified | 1145 |
| 150 | Ga0163163_10186772 | 3300014325 | Bacteria | 2120 |
| 151 | Ga0163163_10496597 | 3300014325 | Bacteria | 1282 |
| 152 | Ga0157380_10005499 | 3300014326 | Bacteria | 8855 |
| 153 | Ga0157380_10057517 | 3300014326 | Bacteria | 3097 |
| 154 | Ga0157380_10416836 | 3300014326 | Bacteria | 1279 |
| 155 | Ga0157380_10492709 | 3300014326 | Bacteria | 1188 |
| 156 | Ga0157380_10816172 | 3300014326 | Unclassified | 951 |
| 157 | Ga0157380_11219409 | 3300014326 | Unclassified | 797 |
| 158 | Ga0157377_10020406 | 3300014745 | Bacteria | 3471 |
| 159 | Ga0157377_10038683 | 3300014745 | Bacteria | 2635 |
| 160 | Ga0157379_10243009 | 3300014968 | Bacteria | 1633 |
| 161 | Ga0157376_10133822 | 3300014969 | Bacteria | 2216 |
| 162 | Ga0207697_10000285 | 3300025315 | Bacteria | 28077 |
| 163 | Ga0207642_10158151 | 3300025899 | Unclassified | 1214 |
| 164 | Ga0207688_10005358 | 3300025901 | Bacteria | 6964 |
| 165 | Ga0207688_10007761 | 3300025901 | Bacteria | 5842 |
| 166 | Ga0207647_10000475 | 3300025904 | Bacteria | 32451 |
| 167 | Ga0207645_10008285 | 3300025907 | Bacteria | 7264 |
| 168 | Ga0207645_10011547 | 3300025907 | Bacteria | 6025 |
| 169 | Ga0207645_10126761 | 3300025907 | Bacteria | 1659 |
| 170 | Ga0207643_10013142 | 3300025908 | Bacteria | 4479 |
| 171 | Ga0207643_10013980 | 3300025908 | Bacteria | 4354 |
| 172 | Ga0207705_10012309 | 3300025909 | Bacteria | 6180 |
| 173 | Ga0207705_10042274 | 3300025909 | Unclassified | 3272 |
| 174 | Ga0207662_10063389 | 3300025918 | Bacteria | 2223 |
| 175 | Ga0207657_10011550 | 3300025919 | Bacteria | 8767 |
| 176 | Ga0207657_10027437 | 3300025919 | Bacteria | 5215 |
| 177 | Ga0207646_10337292 | 3300025922 | Bacteria | 1362 |
| 178 | Ga0207681_10002863 | 3300025923 | Bacteria | 10904 |
| 179 | Ga0207650_10008344 | 3300025925 | Bacteria | 7073 |
| 180 | Ga0207650_10234216 | 3300025925 | Bacteria | 1482 |
| 181 | Ga0207659_10076189 | 3300025926 | Unclassified | 2464 |
| 182 | Ga0207687_10054431 | 3300025927 | Bacteria | 2799 |
| 183 | Ga0207644_10181142 | 3300025931 | Unclassified | 1651 |
| 184 | Ga0207644_10334537 | 3300025931 | Bacteria | 1227 |
| 185 | Ga0207690_10008460 | 3300025932 | Bacteria | 6110 |
| 186 | Ga0207690_10342769 | 3300025932 | Unclassified | 1180 |
| 187 | Ga0207706_10010466 | 3300025933 | Bacteria | 8475 |
| 188 | Ga0207706_10168685 | 3300025933 | Bacteria | 1924 |
| 189 | Ga0207706_10356533 | 3300025933 | Bacteria | 1271 |
| 190 | Ga0207709_10025312 | 3300025935 | Bacteria | 3397 |
| 191 | Ga0207709_10213595 | 3300025935 | Bacteria | 1386 |
| 192 | Ga0207670_10061768 | 3300025936 | Bacteria | 2558 |
| 193 | Ga0207669_10034142 | 3300025937 | Bacteria | 2879 |
| 194 | Ga0207704_10091049 | 3300025938 | Bacteria | 2003 |
| 195 | Ga0207691_10010451 | 3300025940 | Bacteria | 8904 |
| 196 | Ga0207691_10025895 | 3300025940 | Bacteria | 5505 |
| 197 | Ga0207691_10052804 | 3300025940 | Bacteria | 3711 |
| 198 | Ga0207691_10671800 | 3300025940 | Bacteria | 874 |
| 199 | Ga0207711_10009528 | 3300025941 | Bacteria | 8100 |
| 200 | Ga0207711_10068690 | 3300025941 | Bacteria | 3070 |
| 201 | Ga0207689_10008607 | 3300025942 | Bacteria | 8886 |
| 202 | Ga0207689_10013340 | 3300025942 | Bacteria | 7011 |
| 203 | Ga0207689_10110061 | 3300025942 | Unclassified | 2264 |
| 204 | Ga0207689_10262575 | 3300025942 | Bacteria | 1429 |
| 205 | Ga0207689_10351186 | 3300025942 | Bacteria | 1226 |
| 206 | Ga0207679_10116399 | 3300025945 | Unclassified | 2119 |
| 207 | Ga0207651_10012739 | 3300025960 | Bacteria | 4775 |
| 208 | Ga0207651_10077911 | 3300025960 | Bacteria | 2375 |
| 209 | Ga0207651_10213047 | 3300025960 | Unclassified | 1556 |
| 210 | Ga0207712_10005300 | 3300025961 | Bacteria | 8143 |
| 211 | Ga0207712_10185132 | 3300025961 | Bacteria | 1639 |
| 212 | Ga0207668_10000129 | 3300025972 | Bacteria | 53619 |
| 213 | Ga0207668_10100001 | 3300025972 | Unclassified | 2152 |
| 214 | Ga0207640_10003726 | 3300025981 | Bacteria | 8223 |
| 215 | Ga0207640_10098034 | 3300025981 | Bacteria | 2048 |
| 216 | Ga0207640_10335894 | 3300025981 | Unclassified | 1208 |
| 217 | Ga0207658_10011763 | 3300025986 | Bacteria | 5960 |
| 218 | Ga0207658_10066160 | 3300025986 | Bacteria | 2717 |
| 219 | Ga0207658_10069110 | 3300025986 | Bacteria | 2667 |
| 220 | Ga0207677_10001108 | 3300026023 | Bacteria | 14712 |
| 221 | Ga0207703_10014103 | 3300026035 | Bacteria | 6229 |
| 222 | Ga0207639_10218623 | 3300026041 | Unclassified | 1644 |
| 223 | Ga0207678_10030719 | 3300026067 | Bacteria | 4691 |
| 224 | Ga0207678_10181644 | 3300026067 | Unclassified | 1796 |
| 225 | Ga0207708_10115763 | 3300026075 | Bacteria | 2085 |
| 226 | Ga0207641_10010041 | 3300026088 | Bacteria | 7786 |
| 227 | Ga0207641_10013300 | 3300026088 | Bacteria | 6751 |
| 228 | Ga0207641_10036841 | 3300026088 | Bacteria | 4083 |
| 229 | Ga0207641_10039545 | 3300026088 | Bacteria | 3945 |
| 230 | Ga0207641_10063028 | 3300026088 | Bacteria | 3166 |
| 231 | Ga0207641_10472842 | 3300026088 | Unclassified | 1214 |
| 232 | Ga0207648_10000838 | 3300026089 | Bacteria | 34648 |
| 233 | Ga0207648_10000950 | 3300026089 | Bacteria | 32798 |
| 234 | Ga0207648_10174476 | 3300026089 | Bacteria | 1901 |
| 235 | Ga0207676_10003957 | 3300026095 | Bacteria | 10458 |
| 236 | Ga0207676_10223320 | 3300026095 | Bacteria | 1679 |
| 237 | Ga0207674_10013842 | 3300026116 | Bacteria | 8925 |
| 238 | Ga0207674_10128588 | 3300026116 | Bacteria | 2497 |
| 239 | Ga0207674_10396513 | 3300026116 | Bacteria | 1334 |
| 240 | Ga0207683_10034323 | 3300026121 | Bacteria | 4408 |
| 241 | Ga0207698_10001868 | 3300026142 | Bacteria | 12306 |
| 242 | Ga0207698_10138833 | 3300026142 | Bacteria | 2090 |
| 243 | Ga0268266_10357550 | 3300028379 | Bacteria | 1373 |
| 244 | Ga0268266_10394235 | 3300028379 | Bacteria | 1308 |
| 245 | Ga0268265_10002738 | 3300028380 | Bacteria | 13007 |
| 246 | Ga0268265_10032151 | 3300028380 | Bacteria | 3798 |
| 247 | Ga0268265_10117955 | 3300028380 | Bacteria | 2181 |
| 248 | Ga0268265_10377385 | 3300028380 | Bacteria | 1303 |
| 249 | Ga0268264_10011941 | 3300028381 | Bacteria | 7152 |
| 250 | Ga0268264_10017410 | 3300028381 | Bacteria | 5885 |
| 251 | Ga0268264_10149038 | 3300028381 | Bacteria | 2096 |
| 252 | Ga0268264_10151196 | 3300028381 | Unclassified | 2081 |
| 253 | Ga0268264_10473820 | 3300028381 | Bacteria | 1217 |
| 254 | Ga0316182_1003818 | 3300030745 | Unclassified | 1824 |
| 255 | Ga0307513_10319592 | 3300031456 | Bacteria | 1311 |
| 256 | Ga0307408_100100745 | 3300031548 | Bacteria | 2201 |
| 257 | Ga0307408_100110327 | 3300031548 | Bacteria | 2112 |
| 258 | Ga0307408_100123078 | 3300031548 | Unclassified | 2012 |
| 259 | Ga0307405_10017776 | 3300031731 | Bacteria | 3909 |
| 260 | Ga0307405_10047269 | 3300031731 | Unclassified | 2649 |
| 261 | Ga0307405_10075069 | 3300031731 | Bacteria | 2189 |
| 262 | Ga0307413_10000642 | 3300031824 | Bacteria | 11821 |
| 263 | Ga0307413_10009187 | 3300031824 | Bacteria | 4718 |
| 264 | Ga0307413_10034031 | 3300031824 | Bacteria | 2908 |
| 265 | Ga0307413_10088360 | 3300031824 | Unclassified | 2010 |
| 266 | Ga0307413_10491827 | 3300031824 | Bacteria | 983 |
| 267 | Ga0307410_10003301 | 3300031852 | Bacteria | 8063 |
| 268 | Ga0307410_10006482 | 3300031852 | Bacteria | 6320 |
| 269 | Ga0307410_10042854 | 3300031852 | Bacteria | 2994 |
| 270 | Ga0307410_10152087 | 3300031852 | Bacteria | 1724 |
| 271 | Ga0307410_10171559 | 3300031852 | Unclassified | 1635 |
| 272 | Ga0307406_10080490 | 3300031901 | Viruses | 2163 |
| 273 | Ga0307407_10001792 | 3300031903 | Bacteria | 8028 |
| 274 | Ga0307407_10026403 | 3300031903 | Bacteria | 3074 |
| 275 | Ga0307407_10032243 | 3300031903 | Bacteria | 2846 |
| 276 | Ga0307409_100008332 | 3300031995 | Bacteria | 6283 |
| 277 | Ga0307409_100056095 | 3300031995 | Bacteria | 3045 |
| 278 | Ga0307409_100148977 | 3300031995 | Bacteria | 2028 |
| 279 | Ga0307409_100174371 | 3300031995 | Bacteria | 1896 |
| 280 | Ga0307409_100298001 | 3300031995 | Bacteria | 1498 |
| 281 | Ga0307409_100340469 | 3300031995 | Bacteria | 1411 |
| 282 | Ga0307409_100697220 | 3300031995 | Unclassified | 1014 |
| 283 | Ga0307416_100008231 | 3300032002 | Bacteria | 6708 |
| 284 | Ga0307416_100093230 | 3300032002 | Bacteria | 2593 |
| 285 | Ga0307416_100247579 | 3300032002 | Bacteria | 1732 |
| 286 | Ga0307416_100630982 | 3300032002 | Unclassified | 1154 |
| 287 | Ga0307414_10028886 | 3300032004 | Bacteria | 3602 |
| 288 | Ga0307414_10327043 | 3300032004 | Bacteria | 1307 |
| 289 | Ga0307414_10330423 | 3300032004 | Unclassified | 1301 |
| 290 | Ga0307414_10445588 | 3300032004 | Unclassified | 1134 |
| 291 | Ga0307411_10001578 | 3300032005 | Bacteria | 9448 |
| 292 | Ga0307411_10015379 | 3300032005 | Bacteria | 4295 |
| 293 | Ga0307411_10015728 | 3300032005 | Bacteria | 4260 |
| 294 | Ga0307411_10056894 | 3300032005 | Bacteria | 2580 |
| 295 | Ga0307411_10069337 | 3300032005 | Bacteria | 2381 |
| 296 | Ga0307411_10316843 | 3300032005 | Bacteria | 1258 |
| 297 | Ga0307415_100001788 | 3300032126 | Bacteria | 10525 |
| 298 | Ga0307415_100002957 | 3300032126 | Bacteria | 8535 |
| 299 | Ga0307415_100097123 | 3300032126 | Unclassified | 2149 |
| 300 | Ga0316574_0338833 | 3300035398 | Bacteria | 953 |
| 301 | Ga0395899_0162296 | 3300037312 | Bacteria | 1578 |
| 302 | Ga0395898_0303933 | 3300037466 | Unclassified | 1522 |
| 303 | Ga0395905_0440815 | 3300037471 | Bacteria | 1200 |
| 304 | Ga0451800_0847870 | 3300041459 | Bacteria | 1737 |
| 305 | Ga0451804_0473041 | 3300041463 | Bacteria | 1428 |
| 306 | Ga0451853_1416695 | 3300041512 | Bacteria | 1315 |
| 307 | Ga0439464_0000505 | 3300042439 | Bacteria | 7960 |
| 308 | Ga0453684_0269983 | 3300044712 | Bacteria | 1944 |
| 309 | Ga0495650_0048054 | 3300046471 | Bacteria | 1781 |
| 310 | Ga0495598_0025119 | 3300046537 | Bacteria | 1622 |
| 311 | Ga0495668_0010198 | 3300046616 | Bacteria | 5709 |
| 312 | Ga0501292_033167 | 3300049515 | Bacteria | 874 |
| 313 | Ga0501296_002374 | 3300049519 | Unclassified | 1964 |
| 314 | Ga0501201_002078 | 3300049651 | Bacteria | 1843 |
| 315 | Ga0501201_003017 | 3300049651 | Bacteria | 1545 |
| 316 | Ga0501202_000334 | 3300049652 | Bacteria | 6563 |
| 317 | Ga0501202_008600 | 3300049652 | Bacteria | 1862 |
| 318 | Ga0501202_029515 | 3300049652 | Bacteria | 1137 |
| 319 | Ga0501206_002743 | 3300049653 | Unclassified | 2219 |
| 320 | Ga0501207_003263 | 3300049654 | Unclassified | 2153 |
| 321 | Ga0501209_018926 | 3300049656 | Bacteria | 1600 |
| 322 | Ga0501216_005314 | 3300049660 | Bacteria | 1936 |
| 323 | Ga0501217_000531 | 3300049661 | Bacteria | 6336 |
| 324 | Ga0501222_002733 | 3300049662 | Unclassified | 2442 |
| 325 | Ga0501223_001442 | 3300049663 | Bacteria | 5493 |
| 326 | Ga0501223_018294 | 3300049663 | Bacteria | 1379 |
| 327 | Ga0501223_022462 | 3300049663 | Bacteria | 1232 |
| 328 | Ga0501223_025743 | 3300049663 | Bacteria | 1145 |
| 329 | Ga0501224_003093 | 3300049664 | Unclassified | 2304 |
| 330 | Ga0501224_032771 | 3300049664 | Bacteria | 780 |
| 331 | Ga0501233_009761 | 3300049668 | Unclassified | 1878 |
| 332 | Ga0501235_005076 | 3300049669 | Unclassified | 2858 |
| 333 | Ga0501240_000591 | 3300049673 | Unclassified | 3049 |
| 334 | Ga0501242_013618 | 3300049674 | Bacteria | 1000 |
| 335 | Ga0501243_000676 | 3300049675 | Unclassified | 4686 |
| 336 | Ga0501250_001006 | 3300049680 | Bacteria | 2164 |
| 337 | Ga0501251_003235 | 3300049681 | Bacteria | 1617 |
| 338 | Ga0501252_001958 | 3300049682 | Unclassified | 1988 |
| 339 | Ga0501252_008048 | 3300049682 | Bacteria | 1205 |
| 340 | Ga0501259_001004 | 3300049688 | Bacteria | 4688 |
| 341 | Ga0501259_048493 | 3300049688 | Unclassified | 856 |
| 342 | Ga0501260_004612 | 3300049689 | Bacteria | 1278 |
| 343 | Ga0501261_002439 | 3300049690 | Unclassified | 2282 |
| 344 | Ga0501221_005886 | 3300049704 | Unclassified | 2060 |
| 345 | Ga0501221_056955 | 3300049704 | Bacteria | 894 |
| 346 | Ga0501225_0001142 | 3300049705 | Bacteria | 8296 |
| 347 | Ga0501225_0035853 | 3300049705 | Bacteria | 1366 |
| 348 | Ga0501234_002314 | 3300049707 | Unclassified | 3001 |
| 349 | Ga0501245_001229 | 3300049708 | Unclassified | 3302 |
| 350 | Ga0501266_000279 | 3300049763 | Bacteria | 6723 |
| 351 | Ga0501266_017095 | 3300049763 | Unclassified | 968 |
| 352 | Ga0501269_015159 | 3300049766 | Unclassified | 947 |
| 353 | Ga0501273_009116 | 3300049770 | Bacteria | 1199 |
| 354 | Ga0501278_005183 | 3300049774 | Unclassified | 953 |
| 355 | Ga0501279_020254 | 3300049775 | Unclassified | 944 |
| 356 | Ga0501212_003042 | 3300049851 | Bacteria | 2073 |
| 357 | Ga0501212_015037 | 3300049851 | Bacteria | 1151 |
| 358 | nmdc:mga08y16_61105_c1 | 3300050511 | Bacteria | 3934 |
| 359 | nmdc:mga08y16_65745_c1 | 3300050511 | Bacteria | 3785 |
| 360 | Ga0500658_0000107 | 3300053134 | Bacteria | 38715 |
| 361 | Ga0500616_0076373 | 3300053153 | Bacteria | 1694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042439 | Ga0439464_0000505 | Ga0439464_0000505_6836_7525 | 222 |
| 2 | 3300032005 | Ga0307411_10015728 | Ga0307411_100157284 | 223 |
| 3 | 3300049688 | Ga0501259_048493 | Ga0501259_048493_20_697 | 225 |
| 4 | 3300005841 | Ga0068863_100639974 | Ga0068863_1006399741 | 228 |
| 5 | 3300026089 | Ga0207648_10174476 | Ga0207648_101744762 | 228 |
| 6 | 3300026116 | Ga0207674_10396513 | Ga0207674_103965131 | 228 |
| 7 | 3300031824 | Ga0307413_10088360 | Ga0307413_100883603 | 228 |
| 8 | 3300031852 | Ga0307410_10171559 | Ga0307410_101715593 | 228 |
| 9 | 3300032126 | Ga0307415_100097123 | Ga0307415_1000971233 | 228 |
| 10 | 3300002459 | JGI24751J29686_10000732 | JGI24751J29686_1000073211 | 232 |
| 11 | 3300005290 | Ga0065712_10338364 | Ga0065712_103383641 | 232 |
| 12 | 3300005549 | Ga0070704_100067615 | Ga0070704_1000676152 | 232 |
| 13 | 3300005617 | Ga0068859_100001069 | Ga0068859_10000106910 | 232 |
| 14 | 3300005840 | Ga0068870_10180928 | Ga0068870_101809281 | 232 |
| 15 | 3300005844 | Ga0068862_100134655 | Ga0068862_1001346554 | 232 |
| 16 | 3300005844 | Ga0068862_100421659 | Ga0068862_1004216592 | 232 |
| 17 | 3300006931 | Ga0097620_100001069 | Ga0097620_10000106920 | 232 |
| 18 | 3300013297 | Ga0157378_10020341 | Ga0157378_100203412 | 232 |
| 19 | 3300025961 | Ga0207712_10005300 | Ga0207712_1000530012 | 232 |
| 20 | 3300026116 | Ga0207674_10128588 | Ga0207674_101285882 | 232 |
| 21 | 3300031456 | Ga0307513_10319592 | Ga0307513_103195922 | 232 |
| 22 | 3300032005 | Ga0307411_10316843 | Ga0307411_103168431 | 232 |
| 23 | 3300044712 | Ga0453684_0269983 | Ga0453684_0269983_1227_1928 | 232 |
| 24 | 3300049515 | Ga0501292_033167 | Ga0501292_033167_163_864 | 232 |
| 25 | 3300049651 | Ga0501201_003017 | Ga0501201_003017_55_756 | 232 |
| 26 | 3300049656 | Ga0501209_018926 | Ga0501209_018926_520_1221 | 232 |
| 27 | 3300049664 | Ga0501224_032771 | Ga0501224_032771_57_758 | 232 |
| 28 | 3300049704 | Ga0501221_056955 | Ga0501221_056955_13_714 | 232 |
| 29 | 3300049763 | Ga0501266_017095 | Ga0501266_017095_245_946 | 232 |
| 30 | 3300049770 | Ga0501273_009116 | Ga0501273_009116_95_796 | 232 |
| 31 | iso_pu_bacteria | 2739367651 | 2739586452 | 233 |
| 32 | 3300049689 | Ga0501260_004612 | Ga0501260_004612_25_738 | 236 |
| 33 | 3300005331 | Ga0070670_100215482 | Ga0070670_1002154821 | 238 |
| 34 | 3300032004 | Ga0307414_10327043 | Ga0307414_103270432 | 238 |
| 35 | iso_pu_bacteria | 2884634485 | 2884635615 | 238 |
| 36 | 3300031548 | Ga0307408_100100745 | Ga0307408_1001007452 | 240 |
| 37 | 3300031824 | Ga0307413_10000642 | Ga0307413_100006424 | 240 |
| 38 | 3300031852 | Ga0307410_10042854 | Ga0307410_100428542 | 240 |
| 39 | 3300031901 | Ga0307406_10080490 | Ga0307406_100804903 | 240 |
| 40 | 3300031903 | Ga0307407_10001792 | Ga0307407_100017922 | 240 |
| 41 | 3300032005 | Ga0307411_10001578 | Ga0307411_100015788 | 240 |
| 42 | 3300037312 | Ga0395899_0162296 | Ga0395899_0162296_714_1466 | 240 |
| 43 | 3300037466 | Ga0395898_0303933 | Ga0395898_0303933_394_1146 | 240 |
| 44 | 3300005288 | Ga0065714_10118312 | Ga0065714_101183122 | 242 |
| 45 | 3300005290 | Ga0065712_10284537 | Ga0065712_102845371 | 242 |
| 46 | 3300005293 | Ga0065715_10103373 | Ga0065715_101033732 | 242 |
| 47 | 3300005328 | Ga0070676_10027630 | Ga0070676_100276301 | 242 |
| 48 | 3300005331 | Ga0070670_100256497 | Ga0070670_1002564972 | 242 |
| 49 | 3300005331 | Ga0070670_100425760 | Ga0070670_1004257602 | 242 |
| 50 | 3300005333 | Ga0070677_10141328 | Ga0070677_101413281 | 242 |
| 51 | 3300005333 | Ga0070677_10301603 | Ga0070677_103016031 | 242 |
| 52 | 3300005334 | Ga0068869_100075695 | Ga0068869_1000756952 | 242 |
| 53 | 3300005334 | Ga0068869_100204952 | Ga0068869_1002049522 | 242 |
| 54 | 3300005338 | Ga0068868_100396454 | Ga0068868_1003964541 | 242 |
| 55 | 3300005347 | Ga0070668_100629430 | Ga0070668_1006294301 | 242 |
| 56 | 3300005354 | Ga0070675_100085037 | Ga0070675_1000850374 | 242 |
| 57 | 3300005354 | Ga0070675_100377555 | Ga0070675_1003775552 | 242 |
| 58 | 3300005356 | Ga0070674_100592365 | Ga0070674_1005923651 | 242 |
| 59 | 3300005364 | Ga0070673_100039657 | Ga0070673_1000396572 | 242 |
| 60 | 3300005365 | Ga0070688_100017650 | Ga0070688_1000176502 | 242 |
| 61 | 3300005438 | Ga0070701_10098507 | Ga0070701_100985072 | 242 |
| 62 | 3300005459 | Ga0068867_100046729 | Ga0068867_1000467291 | 242 |
| 63 | 3300005466 | Ga0070685_10011933 | Ga0070685_100119335 | 242 |
| 64 | 3300005471 | Ga0070698_100119180 | Ga0070698_1001191804 | 242 |
| 65 | 3300005617 | Ga0068859_100027955 | Ga0068859_1000279557 | 242 |
| 66 | 3300005617 | Ga0068859_100041431 | Ga0068859_1000414313 | 242 |
| 67 | 3300005618 | Ga0068864_100038363 | Ga0068864_1000383632 | 242 |
| 68 | 3300005618 | Ga0068864_100251039 | Ga0068864_1002510392 | 242 |
| 69 | 3300005834 | Ga0068851_10087516 | Ga0068851_100875161 | 242 |
| 70 | 3300005841 | Ga0068863_100061185 | Ga0068863_1000611852 | 242 |
| 71 | 3300005843 | Ga0068860_100099851 | Ga0068860_1000998512 | 242 |
| 72 | 3300005844 | Ga0068862_100347048 | Ga0068862_1003470481 | 242 |
| 73 | 3300006237 | Ga0097621_100283047 | Ga0097621_1002830472 | 242 |
| 74 | 3300006358 | Ga0068871_100076822 | Ga0068871_1000768222 | 242 |
| 75 | 3300006931 | Ga0097620_100027955 | Ga0097620_1000279557 | 242 |
| 76 | 3300006931 | Ga0097620_100041431 | Ga0097620_1000414313 | 242 |
| 77 | 3300009094 | Ga0111539_10359661 | Ga0111539_103596612 | 242 |
| 78 | 3300009176 | Ga0105242_10171652 | Ga0105242_101716522 | 242 |
| 79 | 3300009176 | Ga0105242_10658402 | Ga0105242_106584021 | 242 |
| 80 | 3300009177 | Ga0105248_10036110 | Ga0105248_100361102 | 242 |
| 81 | 3300009553 | Ga0105249_10011702 | Ga0105249_1001170210 | 242 |
| 82 | 3300009553 | Ga0105249_10422426 | Ga0105249_104224262 | 242 |
| 83 | 3300013104 | Ga0157370_10027055 | Ga0157370_100270552 | 242 |
| 84 | 3300013308 | Ga0157375_10072756 | Ga0157375_100727562 | 242 |
| 85 | 3300013308 | Ga0157375_10197512 | Ga0157375_101975122 | 242 |
| 86 | 3300014325 | Ga0163163_10186772 | Ga0163163_101867722 | 242 |
| 87 | 3300014325 | Ga0163163_10496597 | Ga0163163_104965971 | 242 |
| 88 | 3300014326 | Ga0157380_10005499 | Ga0157380_100054994 | 242 |
| 89 | 3300014326 | Ga0157380_10057517 | Ga0157380_100575172 | 242 |
| 90 | 3300014326 | Ga0157380_10416836 | Ga0157380_104168361 | 242 |
| 91 | 3300014326 | Ga0157380_10492709 | Ga0157380_104927092 | 242 |
| 92 | 3300014745 | Ga0157377_10020406 | Ga0157377_100204062 | 242 |
| 93 | 3300014745 | Ga0157377_10038683 | Ga0157377_100386831 | 242 |
| 94 | 3300014968 | Ga0157379_10243009 | Ga0157379_102430092 | 242 |
| 95 | 3300014969 | Ga0157376_10133822 | Ga0157376_101338222 | 242 |
| 96 | 3300025907 | Ga0207645_10126761 | Ga0207645_101267612 | 242 |
| 97 | 3300025908 | Ga0207643_10013142 | Ga0207643_100131424 | 242 |
| 98 | 3300025918 | Ga0207662_10063389 | Ga0207662_100633892 | 242 |
| 99 | 3300025922 | Ga0207646_10337292 | Ga0207646_103372922 | 242 |
| 100 | 3300025925 | Ga0207650_10234216 | Ga0207650_102342162 | 242 |
| 101 | 3300025940 | Ga0207691_10052804 | Ga0207691_100528043 | 242 |
| 102 | 3300025940 | Ga0207691_10671800 | Ga0207691_106718001 | 242 |
| 103 | 3300025942 | Ga0207689_10262575 | Ga0207689_102625752 | 242 |
| 104 | 3300025960 | Ga0207651_10077911 | Ga0207651_100779111 | 242 |
| 105 | 3300025961 | Ga0207712_10185132 | Ga0207712_101851322 | 242 |
| 106 | 3300025981 | Ga0207640_10098034 | Ga0207640_100980342 | 242 |
| 107 | 3300026075 | Ga0207708_10115763 | Ga0207708_101157632 | 242 |
| 108 | 3300026088 | Ga0207641_10472842 | Ga0207641_104728422 | 242 |
| 109 | 3300026095 | Ga0207676_10223320 | Ga0207676_102233201 | 242 |
| 110 | 3300028380 | Ga0268265_10117955 | Ga0268265_101179552 | 242 |
| 111 | 3300028380 | Ga0268265_10377385 | Ga0268265_103773851 | 242 |
| 112 | 3300028381 | Ga0268264_10151196 | Ga0268264_101511962 | 242 |
| 113 | 3300031548 | Ga0307408_100110327 | Ga0307408_1001103272 | 242 |
| 114 | 3300031548 | Ga0307408_100123078 | Ga0307408_1001230782 | 242 |
| 115 | 3300031731 | Ga0307405_10017776 | Ga0307405_100177762 | 242 |
| 116 | 3300031731 | Ga0307405_10047269 | Ga0307405_100472692 | 242 |
| 117 | 3300031731 | Ga0307405_10075069 | Ga0307405_100750692 | 242 |
| 118 | 3300031824 | Ga0307413_10009187 | Ga0307413_100091874 | 242 |
| 119 | 3300031824 | Ga0307413_10034031 | Ga0307413_100340312 | 242 |
| 120 | 3300031824 | Ga0307413_10491827 | Ga0307413_104918271 | 242 |
| 121 | 3300031852 | Ga0307410_10003301 | Ga0307410_100033018 | 242 |
| 122 | 3300031852 | Ga0307410_10006482 | Ga0307410_100064826 | 242 |
| 123 | 3300031903 | Ga0307407_10026403 | Ga0307407_100264032 | 242 |
| 124 | 3300031903 | Ga0307407_10032243 | Ga0307407_100322432 | 242 |
| 125 | 3300031995 | Ga0307409_100056095 | Ga0307409_1000560954 | 242 |
| 126 | 3300031995 | Ga0307409_100148977 | Ga0307409_1001489772 | 242 |
| 127 | 3300031995 | Ga0307409_100298001 | Ga0307409_1002980012 | 242 |
| 128 | 3300032002 | Ga0307416_100008231 | Ga0307416_1000082317 | 242 |
| 129 | 3300032002 | Ga0307416_100093230 | Ga0307416_1000932302 | 242 |
| 130 | 3300032002 | Ga0307416_100247579 | Ga0307416_1002475792 | 242 |
| 131 | 3300032004 | Ga0307414_10028886 | Ga0307414_100288862 | 242 |
| 132 | 3300032005 | Ga0307411_10015379 | Ga0307411_100153792 | 242 |
| 133 | 3300032126 | Ga0307415_100001788 | Ga0307415_1000017887 | 242 |
| 134 | 3300032126 | Ga0307415_100002957 | Ga0307415_1000029572 | 242 |
| 135 | 3300035398 | Ga0316574_0338833 | Ga0316574_0338833_30_761 | 242 |
| 136 | 3300041459 | Ga0451800_0847870 | Ga0451800_0847870_904_1638 | 242 |
| 137 | 3300041463 | Ga0451804_0473041 | Ga0451804_0473041_536_1270 | 242 |
| 138 | 3300046537 | Ga0495598_0025119 | Ga0495598_0025119_85_816 | 242 |
| 139 | 3300049652 | Ga0501202_000334 | Ga0501202_000334_3933_4664 | 242 |
| 140 | 3300049663 | Ga0501223_018294 | Ga0501223_018294_107_838 | 242 |
| 141 | 3300049674 | Ga0501242_013618 | Ga0501242_013618_193_924 | 242 |
| 142 | 3300049705 | Ga0501225_0035853 | Ga0501225_0035853_419_1150 | 242 |
| 143 | 3300049775 | Ga0501279_020254 | Ga0501279_020254_127_858 | 242 |
| 144 | 3300050511 | nmdc:mga08y16_61105_c1 | nmdc:mga08y16_61105_c1_1954_2685 | 242 |
| 145 | 3300053153 | Ga0500616_0076373 | Ga0500616_0076373_262_993 | 242 |
| 146 | 3300006844 | Ga0075428_100478032 | Ga0075428_1004780322 | 243 |
| 147 | 3300009174 | Ga0105241_10073112 | Ga0105241_100731125 | 243 |
| 148 | 3300049663 | Ga0501223_022462 | Ga0501223_022462_21_800 | 243 |
| 149 | 3300006844 | Ga0075428_100114387 | Ga0075428_1001143872 | 244 |
| 150 | 3300009094 | Ga0111539_10021370 | Ga0111539_100213704 | 244 |
| 151 | 3300014326 | Ga0157380_11219409 | Ga0157380_112194091 | 244 |
| 152 | 3300031995 | Ga0307409_100697220 | Ga0307409_1006972201 | 244 |
| 153 | 3300032002 | Ga0307416_100630982 | Ga0307416_1006309821 | 244 |
| 154 | 3300050511 | nmdc:mga08y16_65745_c1 | nmdc:mga08y16_65745_c1_2150_2887 | 244 |
| 155 | 3300030745 | Ga0316182_1003818 | Ga0316182_10038181 | 245 |
| 156 | 3300031852 | Ga0307410_10152087 | Ga0307410_101520872 | 245 |
| 157 | 3300005843 | Ga0068860_100554794 | Ga0068860_1005547942 | 246 |
| 158 | 3300009094 | Ga0111539_11224056 | Ga0111539_112240562 | 246 |
| 159 | 3300028381 | Ga0268264_10473820 | Ga0268264_104738201 | 246 |
| 160 | 3300005617 | Ga0068859_100583462 | Ga0068859_1005834622 | 247 |
| 161 | 3300005719 | Ga0068861_100177225 | Ga0068861_1001772252 | 247 |
| 162 | 3300006931 | Ga0097620_100583439 | Ga0097620_1005834392 | 247 |
| 163 | 3300025942 | Ga0207689_10351186 | Ga0207689_103511862 | 247 |
| 164 | 3300049651 | Ga0501201_002078 | Ga0501201_002078_216_1037 | 248 |
| 165 | 3300049652 | Ga0501202_008600 | Ga0501202_008600_187_1008 | 248 |
| 166 | 3300049653 | Ga0501206_002743 | Ga0501206_002743_79_900 | 248 |
| 167 | 3300049654 | Ga0501207_003263 | Ga0501207_003263_22_843 | 248 |
| 168 | 3300049660 | Ga0501216_005314 | Ga0501216_005314_1102_1923 | 248 |
| 169 | 3300049661 | Ga0501217_000531 | Ga0501217_000531_4723_5544 | 248 |
| 170 | 3300049662 | Ga0501222_002733 | Ga0501222_002733_491_1312 | 248 |
| 171 | 3300049663 | Ga0501223_001442 | Ga0501223_001442_1492_2313 | 248 |
| 172 | 3300049664 | Ga0501224_003093 | Ga0501224_003093_860_1681 | 248 |
| 173 | 3300049668 | Ga0501233_009761 | Ga0501233_009761_672_1493 | 248 |
| 174 | 3300049669 | Ga0501235_005076 | Ga0501235_005076_1807_2628 | 248 |
| 175 | 3300049673 | Ga0501240_000591 | Ga0501240_000591_1585_2406 | 248 |
| 176 | 3300049675 | Ga0501243_000676 | Ga0501243_000676_2327_3148 | 248 |
| 177 | 3300049681 | Ga0501251_003235 | Ga0501251_003235_738_1559 | 248 |
| 178 | 3300049682 | Ga0501252_001958 | Ga0501252_001958_271_1092 | 248 |
| 179 | 3300049688 | Ga0501259_001004 | Ga0501259_001004_3707_4528 | 248 |
| 180 | 3300049690 | Ga0501261_002439 | Ga0501261_002439_841_1662 | 248 |
| 181 | 3300049704 | Ga0501221_005886 | Ga0501221_005886_14_835 | 248 |
| 182 | 3300049705 | Ga0501225_0001142 | Ga0501225_0001142_2920_3741 | 248 |
| 183 | 3300049707 | Ga0501234_002314 | Ga0501234_002314_1539_2360 | 248 |
| 184 | 3300049708 | Ga0501245_001229 | Ga0501245_001229_1054_1875 | 248 |
| 185 | 3300049766 | Ga0501269_015159 | Ga0501269_015159_37_858 | 248 |
| 186 | 3300049774 | Ga0501278_005183 | Ga0501278_005183_13_834 | 248 |
| 187 | 3300049851 | Ga0501212_003042 | Ga0501212_003042_15_836 | 248 |
| 188 | 3300028379 | Ga0268266_10394235 | Ga0268266_103942351 | 249 |
| 189 | 3300001915 | JGI24741J21665_1027736 | JGI24741J21665_10277361 | 250 |
| 190 | 3300001979 | JGI24740J21852_10003511 | JGI24740J21852_100035113 | 250 |
| 191 | 3300001989 | JGI24739J22299_10001448 | JGI24739J22299_100014485 | 250 |
| 192 | 3300001990 | JGI24737J22298_10000410 | JGI24737J22298_100004105 | 250 |
| 193 | 3300002075 | JGI24738J21930_10001309 | JGI24738J21930_100013096 | 250 |
| 194 | 3300002239 | JGI24034J26672_10002635 | JGI24034J26672_100026353 | 250 |
| 195 | 3300005293 | Ga0065715_10293209 | Ga0065715_102932092 | 250 |
| 196 | 3300005327 | Ga0070658_10001117 | Ga0070658_1000111722 | 250 |
| 197 | 3300005327 | Ga0070658_10098318 | Ga0070658_100983181 | 250 |
| 198 | 3300005328 | Ga0070676_10000162 | Ga0070676_100001622 | 250 |
| 199 | 3300005328 | Ga0070676_10002241 | Ga0070676_1000224112 | 250 |
| 200 | 3300005331 | Ga0070670_100010999 | Ga0070670_1000109993 | 250 |
| 201 | 3300005334 | Ga0068869_100000198 | Ga0068869_1000001985 | 250 |
| 202 | 3300005334 | Ga0068869_100118686 | Ga0068869_1001186863 | 250 |
| 203 | 3300005334 | Ga0068869_100170784 | Ga0068869_1001707842 | 250 |
| 204 | 3300005337 | Ga0070682_100289501 | Ga0070682_1002895012 | 250 |
| 205 | 3300005338 | Ga0068868_100005453 | Ga0068868_1000054535 | 250 |
| 206 | 3300005338 | Ga0068868_100752178 | Ga0068868_1007521781 | 250 |
| 207 | 3300005339 | Ga0070660_100007976 | Ga0070660_1000079766 | 250 |
| 208 | 3300005339 | Ga0070660_100035692 | Ga0070660_1000356925 | 250 |
| 209 | 3300005344 | Ga0070661_100225674 | Ga0070661_1002256742 | 250 |
| 210 | 3300005345 | Ga0070692_10254987 | Ga0070692_102549871 | 250 |
| 211 | 3300005347 | Ga0070668_100003957 | Ga0070668_10000395714 | 250 |
| 212 | 3300005353 | Ga0070669_100005945 | Ga0070669_1000059459 | 250 |
| 213 | 3300005355 | Ga0070671_100310692 | Ga0070671_1003106922 | 250 |
| 214 | 3300005356 | Ga0070674_100074092 | Ga0070674_1000740922 | 250 |
| 215 | 3300005364 | Ga0070673_100003953 | Ga0070673_1000039535 | 250 |
| 216 | 3300005366 | Ga0070659_100159430 | Ga0070659_1001594302 | 250 |
| 217 | 3300005367 | Ga0070667_100108662 | Ga0070667_1001086623 | 250 |
| 218 | 3300005367 | Ga0070667_100247665 | Ga0070667_1002476651 | 250 |
| 219 | 3300005455 | Ga0070663_100002083 | Ga0070663_1000020838 | 250 |
| 220 | 3300005455 | Ga0070663_100132143 | Ga0070663_1001321431 | 250 |
| 221 | 3300005456 | Ga0070678_100028880 | Ga0070678_1000288805 | 250 |
| 222 | 3300005457 | Ga0070662_100136783 | Ga0070662_1001367831 | 250 |
| 223 | 3300005459 | Ga0068867_100028807 | Ga0068867_1000288075 | 250 |
| 224 | 3300005539 | Ga0068853_100011123 | Ga0068853_1000111237 | 250 |
| 225 | 3300005539 | Ga0068853_100215595 | Ga0068853_1002155952 | 250 |
| 226 | 3300005543 | Ga0070672_100009126 | Ga0070672_1000091265 | 250 |
| 227 | 3300005543 | Ga0070672_100133357 | Ga0070672_1001333572 | 250 |
| 228 | 3300005544 | Ga0070686_100152260 | Ga0070686_1001522601 | 250 |
| 229 | 3300005547 | Ga0070693_100076725 | Ga0070693_1000767253 | 250 |
| 230 | 3300005548 | Ga0070665_100560837 | Ga0070665_1005608372 | 250 |
| 231 | 3300005563 | Ga0068855_100047224 | Ga0068855_1000472245 | 250 |
| 232 | 3300005577 | Ga0068857_100013740 | Ga0068857_1000137406 | 250 |
| 233 | 3300005578 | Ga0068854_100000599 | Ga0068854_1000005995 | 250 |
| 234 | 3300005615 | Ga0070702_100029342 | Ga0070702_1000293423 | 250 |
| 235 | 3300005616 | Ga0068852_100079115 | Ga0068852_1000791155 | 250 |
| 236 | 3300005616 | Ga0068852_100382621 | Ga0068852_1003826212 | 250 |
| 237 | 3300005617 | Ga0068859_100057579 | Ga0068859_1000575795 | 250 |
| 238 | 3300005617 | Ga0068859_100175498 | Ga0068859_1001754982 | 250 |
| 239 | 3300005617 | Ga0068859_100243299 | Ga0068859_1002432993 | 250 |
| 240 | 3300005618 | Ga0068864_100007601 | Ga0068864_10000760110 | 250 |
| 241 | 3300005718 | Ga0068866_10028343 | Ga0068866_100283432 | 250 |
| 242 | 3300005834 | Ga0068851_10155049 | Ga0068851_101550491 | 250 |
| 243 | 3300005834 | Ga0068851_10407926 | Ga0068851_104079261 | 250 |
| 244 | 3300005841 | Ga0068863_100004142 | Ga0068863_10000414216 | 250 |
| 245 | 3300005841 | Ga0068863_100021780 | Ga0068863_1000217806 | 250 |
| 246 | 3300005841 | Ga0068863_100034558 | Ga0068863_1000345583 | 250 |
| 247 | 3300005841 | Ga0068863_100043383 | Ga0068863_1000433832 | 250 |
| 248 | 3300005842 | Ga0068858_100004047 | Ga0068858_1000040475 | 250 |
| 249 | 3300005843 | Ga0068860_100084177 | Ga0068860_1000841773 | 250 |
| 250 | 3300005843 | Ga0068860_100260989 | Ga0068860_1002609891 | 250 |
| 251 | 3300005844 | Ga0068862_100003966 | Ga0068862_1000039662 | 250 |
| 252 | 3300005844 | Ga0068862_100026268 | Ga0068862_1000262682 | 250 |
| 253 | 3300005844 | Ga0068862_100198667 | Ga0068862_1001986672 | 250 |
| 254 | 3300005844 | Ga0068862_100523615 | Ga0068862_1005236152 | 250 |
| 255 | 3300006237 | Ga0097621_100551445 | Ga0097621_1005514451 | 250 |
| 256 | 3300006358 | Ga0068871_100007484 | Ga0068871_1000074842 | 250 |
| 257 | 3300006881 | Ga0068865_100007392 | Ga0068865_1000073928 | 250 |
| 258 | 3300006881 | Ga0068865_100420646 | Ga0068865_1004206461 | 250 |
| 259 | 3300006931 | Ga0097620_100057576 | Ga0097620_1000575765 | 250 |
| 260 | 3300006931 | Ga0097620_100175492 | Ga0097620_1001754922 | 250 |
| 261 | 3300006931 | Ga0097620_100243305 | Ga0097620_1002433052 | 250 |
| 262 | 3300009098 | Ga0105245_10002561 | Ga0105245_1000256118 | 250 |
| 263 | 3300009098 | Ga0105245_10040666 | Ga0105245_100406663 | 250 |
| 264 | 3300009148 | Ga0105243_10029828 | Ga0105243_100298283 | 250 |
| 265 | 3300009148 | Ga0105243_10188750 | Ga0105243_101887501 | 250 |
| 266 | 3300009176 | Ga0105242_10371820 | Ga0105242_103718201 | 250 |
| 267 | 3300009177 | Ga0105248_10005697 | Ga0105248_1000569714 | 250 |
| 268 | 3300010375 | Ga0105239_10045011 | Ga0105239_100450113 | 250 |
| 269 | 3300011119 | Ga0105246_10019359 | Ga0105246_100193595 | 250 |
| 270 | 3300013100 | Ga0157373_10030026 | Ga0157373_100300264 | 250 |
| 271 | 3300013102 | Ga0157371_10006813 | Ga0157371_100068134 | 250 |
| 272 | 3300013306 | Ga0163162_10135395 | Ga0163162_101353955 | 250 |
| 273 | 3300013306 | Ga0163162_10391674 | Ga0163162_103916742 | 250 |
| 274 | 3300013308 | Ga0157375_10039115 | Ga0157375_100391155 | 250 |
| 275 | 3300013308 | Ga0157375_10726629 | Ga0157375_107266292 | 250 |
| 276 | 3300014326 | Ga0157380_10816172 | Ga0157380_108161721 | 250 |
| 277 | 3300025315 | Ga0207697_10000285 | Ga0207697_100002854 | 250 |
| 278 | 3300025899 | Ga0207642_10158151 | Ga0207642_101581512 | 250 |
| 279 | 3300025901 | Ga0207688_10005358 | Ga0207688_100053588 | 250 |
| 280 | 3300025901 | Ga0207688_10007761 | Ga0207688_100077614 | 250 |
| 281 | 3300025904 | Ga0207647_10000475 | Ga0207647_1000047511 | 250 |
| 282 | 3300025907 | Ga0207645_10008285 | Ga0207645_100082859 | 250 |
| 283 | 3300025907 | Ga0207645_10011547 | Ga0207645_100115472 | 250 |
| 284 | 3300025908 | Ga0207643_10013980 | Ga0207643_100139802 | 250 |
| 285 | 3300025909 | Ga0207705_10012309 | Ga0207705_100123094 | 250 |
| 286 | 3300025909 | Ga0207705_10042274 | Ga0207705_100422743 | 250 |
| 287 | 3300025919 | Ga0207657_10011550 | Ga0207657_100115504 | 250 |
| 288 | 3300025919 | Ga0207657_10027437 | Ga0207657_100274376 | 250 |
| 289 | 3300025923 | Ga0207681_10002863 | Ga0207681_100028634 | 250 |
| 290 | 3300025925 | Ga0207650_10008344 | Ga0207650_100083444 | 250 |
| 291 | 3300025926 | Ga0207659_10076189 | Ga0207659_100761893 | 250 |
| 292 | 3300025927 | Ga0207687_10054431 | Ga0207687_100544313 | 250 |
| 293 | 3300025931 | Ga0207644_10181142 | Ga0207644_101811422 | 250 |
| 294 | 3300025931 | Ga0207644_10334537 | Ga0207644_103345371 | 250 |
| 295 | 3300025932 | Ga0207690_10008460 | Ga0207690_100084604 | 250 |
| 296 | 3300025932 | Ga0207690_10342769 | Ga0207690_103427691 | 250 |
| 297 | 3300025933 | Ga0207706_10010466 | Ga0207706_100104663 | 250 |
| 298 | 3300025933 | Ga0207706_10168685 | Ga0207706_101686851 | 250 |
| 299 | 3300025933 | Ga0207706_10356533 | Ga0207706_103565332 | 250 |
| 300 | 3300025935 | Ga0207709_10025312 | Ga0207709_100253125 | 250 |
| 301 | 3300025935 | Ga0207709_10213595 | Ga0207709_102135952 | 250 |
| 302 | 3300025936 | Ga0207670_10061768 | Ga0207670_100617683 | 250 |
| 303 | 3300025937 | Ga0207669_10034142 | Ga0207669_100341423 | 250 |
| 304 | 3300025938 | Ga0207704_10091049 | Ga0207704_100910492 | 250 |
| 305 | 3300025940 | Ga0207691_10010451 | Ga0207691_100104514 | 250 |
| 306 | 3300025940 | Ga0207691_10025895 | Ga0207691_100258952 | 250 |
| 307 | 3300025941 | Ga0207711_10009528 | Ga0207711_100095283 | 250 |
| 308 | 3300025941 | Ga0207711_10068690 | Ga0207711_100686905 | 250 |
| 309 | 3300025942 | Ga0207689_10008607 | Ga0207689_100086079 | 250 |
| 310 | 3300025942 | Ga0207689_10013340 | Ga0207689_100133404 | 250 |
| 311 | 3300025942 | Ga0207689_10110061 | Ga0207689_101100613 | 250 |
| 312 | 3300025945 | Ga0207679_10116399 | Ga0207679_101163992 | 250 |
| 313 | 3300025960 | Ga0207651_10012739 | Ga0207651_100127394 | 250 |
| 314 | 3300025960 | Ga0207651_10213047 | Ga0207651_102130473 | 250 |
| 315 | 3300025972 | Ga0207668_10000129 | Ga0207668_1000012960 | 250 |
| 316 | 3300025972 | Ga0207668_10100001 | Ga0207668_101000012 | 250 |
| 317 | 3300025981 | Ga0207640_10003726 | Ga0207640_100037262 | 250 |
| 318 | 3300025981 | Ga0207640_10335894 | Ga0207640_103358941 | 250 |
| 319 | 3300025986 | Ga0207658_10011763 | Ga0207658_100117633 | 250 |
| 320 | 3300025986 | Ga0207658_10066160 | Ga0207658_100661603 | 250 |
| 321 | 3300025986 | Ga0207658_10069110 | Ga0207658_100691102 | 250 |
| 322 | 3300026023 | Ga0207677_10001108 | Ga0207677_100011084 | 250 |
| 323 | 3300026035 | Ga0207703_10014103 | Ga0207703_100141031 | 250 |
| 324 | 3300026041 | Ga0207639_10218623 | Ga0207639_102186232 | 250 |
| 325 | 3300026067 | Ga0207678_10030719 | Ga0207678_100307194 | 250 |
| 326 | 3300026067 | Ga0207678_10181644 | Ga0207678_101816443 | 250 |
| 327 | 3300026088 | Ga0207641_10010041 | Ga0207641_100100418 | 250 |
| 328 | 3300026088 | Ga0207641_10013300 | Ga0207641_100133003 | 250 |
| 329 | 3300026088 | Ga0207641_10036841 | Ga0207641_100368412 | 250 |
| 330 | 3300026088 | Ga0207641_10039545 | Ga0207641_100395452 | 250 |
| 331 | 3300026088 | Ga0207641_10063028 | Ga0207641_100630282 | 250 |
| 332 | 3300026089 | Ga0207648_10000838 | Ga0207648_100008388 | 250 |
| 333 | 3300026089 | Ga0207648_10000950 | Ga0207648_1000095010 | 250 |
| 334 | 3300026095 | Ga0207676_10003957 | Ga0207676_100039574 | 250 |
| 335 | 3300026116 | Ga0207674_10013842 | Ga0207674_100138424 | 250 |
| 336 | 3300026121 | Ga0207683_10034323 | Ga0207683_100343232 | 250 |
| 337 | 3300026142 | Ga0207698_10001868 | Ga0207698_100018681 | 250 |
| 338 | 3300026142 | Ga0207698_10138833 | Ga0207698_101388332 | 250 |
| 339 | 3300028379 | Ga0268266_10357550 | Ga0268266_103575502 | 250 |
| 340 | 3300028380 | Ga0268265_10002738 | Ga0268265_100027382 | 250 |
| 341 | 3300028380 | Ga0268265_10032151 | Ga0268265_100321513 | 250 |
| 342 | 3300028381 | Ga0268264_10011941 | Ga0268264_100119418 | 250 |
| 343 | 3300028381 | Ga0268264_10017410 | Ga0268264_100174104 | 250 |
| 344 | 3300028381 | Ga0268264_10149038 | Ga0268264_101490383 | 250 |
| 345 | 3300031995 | Ga0307409_100008332 | Ga0307409_1000083327 | 250 |
| 346 | 3300031995 | Ga0307409_100174371 | Ga0307409_1001743711 | 250 |
| 347 | 3300031995 | Ga0307409_100340469 | Ga0307409_1003404692 | 250 |
| 348 | 3300032004 | Ga0307414_10330423 | Ga0307414_103304232 | 250 |
| 349 | 3300032004 | Ga0307414_10445588 | Ga0307414_104455882 | 250 |
| 350 | 3300032005 | Ga0307411_10056894 | Ga0307411_100568941 | 250 |
| 351 | 3300032005 | Ga0307411_10069337 | Ga0307411_100693372 | 250 |
| 352 | 3300037471 | Ga0395905_0440815 | Ga0395905_0440815_286_1038 | 250 |
| 353 | 3300041512 | Ga0451853_1416695 | Ga0451853_1416695_108_947 | 250 |
| 354 | 3300046471 | Ga0495650_0048054 | Ga0495650_0048054_694_1446 | 250 |
| 355 | 3300046616 | Ga0495668_0010198 | Ga0495668_0010198_1412_2164 | 250 |
| 356 | 3300049519 | Ga0501296_002374 | Ga0501296_002374_36_842 | 250 |
| 357 | 3300049652 | Ga0501202_029515 | Ga0501202_029515_72_878 | 250 |
| 358 | 3300049663 | Ga0501223_025743 | Ga0501223_025743_106_912 | 250 |
| 359 | 3300049680 | Ga0501250_001006 | Ga0501250_001006_995_1801 | 250 |
| 360 | 3300049682 | Ga0501252_008048 | Ga0501252_008048_333_1139 | 250 |
| 361 | 3300049763 | Ga0501266_000279 | Ga0501266_000279_2738_3544 | 250 |
| 362 | 3300049851 | Ga0501212_015037 | Ga0501212_015037_333_1139 | 250 |
| 363 | 3300053134 | Ga0500658_0000107 | Ga0500658_0000107_20800_21552 | 250 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mjq-assembly1.cif.gz_G | vascular katp channel: kir6.1 sur2b quatrefoil-like conformation 2 | 0.4616 | 121 | 246 |
| 6e9z-assembly1.cif.gz_B | dhf119 filament | 0.4465 | 1 | 236 |
| 8e0m-assembly4.cif.gz_L | homotrimeric variant of tctrp9, bgl15 | 0.4185 | 88 | 237 |
| 6e9z-assembly1.cif.gz_B | dhf119 filament | 0.4003 | 1 | 236 |
| 6fel-assembly2.cif.gz_C | structure of 14-3-3 gamma in complex with camkk2 14-3-3 binding motif ser511 | 0.4001 | 44 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8GXA1_46_203_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.5673 | 118 | 235 | 1.20.140.40 |
| af_K7K831_27_178_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.5628 | 118 | 236 | 1.20.140.40 |
| af_Q7F0H7_42_198_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.5534 | 118 | 247 | 1.20.140.40 |
| af_Q0DJG7_36_181_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.5345 | 103 | 235 | 1.20.140.40 |
| af_Q65XN3_57_205_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.5312 | 119 | 234 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q8QHK5-F1-model_v4 | Uncharacterized protein | 0.9069 | 10 | 250 |
GO:0016020
|
| AF-A0A4Q8QHK5-F1-model_v4 | Uncharacterized protein | 0.8965 | 10 | 250 |
GO:0016020
|
| AF-M7N2B1-F1-model_v4 | Uncharacterized protein | 0.8951 | 7 | 250 |
GO:0016020
|
| AF-A0A6B3WCU3-F1-model_v4 | Uncharacterized protein | 0.8757 | 8 | 250 |
GO:0016020
|
| AF-A0A516HFP2-F1-model_v4 | Uncharacterized protein | 0.8731 | 10 | 249 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar