F423014

General Info

Members Datasets Scaffolds Average Seq Length
363 189 361 249

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100100745|Ga0307408_1001007452
Length 241
Sequence MERYKNLHLWMIIPMAIMQIGIFYDYWGDLTENAWSVHIHYWTATLWYVYLIIQPYYATRNKLEKHRTNGIIGFFLAGGVAMTALSALHRDIVNAERSAQMPEVFGPFEPWFFYGIAAVEIVMMSAFIFAIIQSIRYRHSVEDHAWWLISTVFIIMMPALGRGMGVLLIIIFGPTSVVNNASLYLTTGIIIAITLWAAVKYGRVNHPATWLAIGVNLFNLLFEPLGKWEWLQGVLRAMIKG

Samples

Sample ID Description Type Environment
1 2739367651 Pedobacter sp. OK291 Isolate Unclassified
2 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
155 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
156 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
157 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
158 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
159 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
169 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
170 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
171 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
172 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
173 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
174 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
175 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
176 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
182 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
183 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
184 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
185 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
186 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.55
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1027736 3300001915 Unclassified 857
2 JGI24740J21852_10003511 3300001979 Bacteria 6872
3 JGI24739J22299_10001448 3300001989 Bacteria 8950
4 JGI24737J22298_10000410 3300001990 Bacteria 14666
5 JGI24738J21930_10001309 3300002075 Bacteria 6961
6 JGI24034J26672_10002635 3300002239 Bacteria 2471
7 JGI24751J29686_10000732 3300002459 Bacteria 7929
8 Ga0065714_10118312 3300005288 Bacteria 1380
9 Ga0065712_10284537 3300005290 Bacteria 883
10 Ga0065712_10338364 3300005290 Bacteria 793
11 Ga0065715_10103373 3300005293 Bacteria 3039
12 Ga0065715_10293209 3300005293 Bacteria 1050
13 Ga0070658_10001117 3300005327 Bacteria 22909
14 Ga0070658_10098318 3300005327 Unclassified 2417
15 Ga0070676_10000162 3300005328 Bacteria 26894
16 Ga0070676_10002241 3300005328 Bacteria 9869
17 Ga0070676_10027630 3300005328 Bacteria 3219
18 Ga0070670_100010999 3300005331 Bacteria 7730
19 Ga0070670_100215482 3300005331 Bacteria 1670
20 Ga0070670_100256497 3300005331 Bacteria 1524
21 Ga0070670_100425760 3300005331 Bacteria 1174
22 Ga0070677_10141328 3300005333 Unclassified 1111
23 Ga0070677_10301603 3300005333 Unclassified 814
24 Ga0068869_100000198 3300005334 Bacteria 31224
25 Ga0068869_100075695 3300005334 Bacteria 2501
26 Ga0068869_100118686 3300005334 Unclassified 2020
27 Ga0068869_100170784 3300005334 Bacteria 1698
28 Ga0068869_100204952 3300005334 Bacteria 1557
29 Ga0070682_100289501 3300005337 Unclassified 1197
30 Ga0068868_100005453 3300005338 Bacteria 8940
31 Ga0068868_100396454 3300005338 Bacteria 1190
32 Ga0068868_100752178 3300005338 Unclassified 876
33 Ga0070660_100007976 3300005339 Bacteria 7398
34 Ga0070660_100035692 3300005339 Unclassified 3764
35 Ga0070661_100225674 3300005344 Unclassified 1438
36 Ga0070692_10254987 3300005345 Unclassified 1052
37 Ga0070668_100003957 3300005347 Bacteria 10951
38 Ga0070668_100629430 3300005347 Bacteria 941
39 Ga0070669_100005945 3300005353 Bacteria 8804
40 Ga0070675_100085037 3300005354 Bacteria 2642
41 Ga0070675_100377555 3300005354 Bacteria 1261
42 Ga0070671_100310692 3300005355 Bacteria 1343
43 Ga0070674_100074092 3300005356 Bacteria 2415
44 Ga0070674_100592365 3300005356 Unclassified 936
45 Ga0070673_100003953 3300005364 Bacteria 9315
46 Ga0070673_100039657 3300005364 Bacteria 3606
47 Ga0070688_100017650 3300005365 Bacteria 4099
48 Ga0070659_100159430 3300005366 Bacteria 1844
49 Ga0070667_100108662 3300005367 Bacteria 2403
50 Ga0070667_100247665 3300005367 Bacteria 1592
51 Ga0070701_10098507 3300005438 Bacteria 1615
52 Ga0070663_100002083 3300005455 Bacteria 11184
53 Ga0070663_100132143 3300005455 Bacteria 1897
54 Ga0070678_100028880 3300005456 Bacteria 3789
55 Ga0070662_100136783 3300005457 Bacteria 1895
56 Ga0068867_100028807 3300005459 Bacteria 3998
57 Ga0068867_100046729 3300005459 Bacteria 3180
58 Ga0070685_10011933 3300005466 Bacteria 4555
59 Ga0070698_100119180 3300005471 Bacteria 2600
60 Ga0068853_100011123 3300005539 Bacteria 7300
61 Ga0068853_100215595 3300005539 Unclassified 1751
62 Ga0070672_100009126 3300005543 Bacteria 6823
63 Ga0070672_100133357 3300005543 Bacteria 2043
64 Ga0070686_100152260 3300005544 Unclassified 1621
65 Ga0070693_100076725 3300005547 Unclassified 1981
66 Ga0070665_100560837 3300005548 Bacteria 1155
67 Ga0070704_100067615 3300005549 Bacteria 2581
68 Ga0068855_100047224 3300005563 Bacteria 5087
69 Ga0068857_100013740 3300005577 Bacteria 7055
70 Ga0068854_100000599 3300005578 Bacteria 21420
71 Ga0070702_100029342 3300005615 Bacteria 2990
72 Ga0068852_100079115 3300005616 Bacteria 2911
73 Ga0068852_100382621 3300005616 Unclassified 1381
74 Ga0068859_100001069 3300005617 Bacteria 28045
75 Ga0068859_100027955 3300005617 Bacteria 5655
76 Ga0068859_100041431 3300005617 Bacteria 4625
77 Ga0068859_100057579 3300005617 Bacteria 3915
78 Ga0068859_100175498 3300005617 Bacteria 2225
79 Ga0068859_100243299 3300005617 Bacteria 1889
80 Ga0068859_100583462 3300005617 Bacteria 1211
81 Ga0068864_100007601 3300005618 Bacteria 8927
82 Ga0068864_100038363 3300005618 Bacteria 4091
83 Ga0068864_100251039 3300005618 Bacteria 1643
84 Ga0068866_10028343 3300005718 Bacteria 2667
85 Ga0068861_100177225 3300005719 Bacteria 1771
86 Ga0068851_10087516 3300005834 Bacteria 1636
87 Ga0068851_10155049 3300005834 Unclassified 1254
88 Ga0068851_10407926 3300005834 Unclassified 800
89 Ga0068870_10180928 3300005840 Bacteria 1265
90 Ga0068863_100004142 3300005841 Bacteria 14326
91 Ga0068863_100021780 3300005841 Bacteria 6116
92 Ga0068863_100034558 3300005841 Bacteria 4815
93 Ga0068863_100043383 3300005841 Bacteria 4270
94 Ga0068863_100061185 3300005841 Bacteria 3559
95 Ga0068863_100639974 3300005841 Unclassified 1054
96 Ga0068858_100004047 3300005842 Bacteria 14457
97 Ga0068860_100084177 3300005843 Bacteria 3025
98 Ga0068860_100099851 3300005843 Bacteria 2768
99 Ga0068860_100260989 3300005843 Bacteria 1689
100 Ga0068860_100554794 3300005843 Bacteria 1151
101 Ga0068862_100003966 3300005844 Bacteria 12575
102 Ga0068862_100026268 3300005844 Bacteria 4894
103 Ga0068862_100134655 3300005844 Unclassified 2189
104 Ga0068862_100198667 3300005844 Unclassified 1807
105 Ga0068862_100347048 3300005844 Unclassified 1376
106 Ga0068862_100421659 3300005844 Bacteria 1252
107 Ga0068862_100523615 3300005844 Unclassified 1128
108 Ga0097621_100283047 3300006237 Bacteria 1460
109 Ga0097621_100551445 3300006237 Unclassified 1049
110 Ga0068871_100007484 3300006358 Bacteria 7811
111 Ga0068871_100076822 3300006358 Bacteria 2758
112 Ga0075428_100114387 3300006844 Bacteria 2940
113 Ga0075428_100478032 3300006844 Bacteria 1333
114 Ga0068865_100007392 3300006881 Bacteria 6760
115 Ga0068865_100420646 3300006881 Unclassified 1098
116 Ga0097620_100001069 3300006931 Bacteria 28045
117 Ga0097620_100027955 3300006931 Bacteria 5655
118 Ga0097620_100041431 3300006931 Bacteria 4625
119 Ga0097620_100057576 3300006931 Bacteria 3915
120 Ga0097620_100175492 3300006931 Bacteria 2225
121 Ga0097620_100243305 3300006931 Bacteria 1889
122 Ga0097620_100583439 3300006931 Bacteria 1211
123 Ga0111539_10021370 3300009094 Bacteria 7967
124 Ga0111539_10359661 3300009094 Bacteria 1694
125 Ga0111539_11224056 3300009094 Bacteria 872
126 Ga0105245_10002561 3300009098 Bacteria 16366
127 Ga0105245_10040666 3300009098 Bacteria 4143
128 Ga0105243_10029828 3300009148 Bacteria 4197
129 Ga0105243_10188750 3300009148 Bacteria 1798
130 Ga0105241_10073112 3300009174 Unclassified 2666
131 Ga0105242_10171652 3300009176 Bacteria 1906
132 Ga0105242_10371820 3300009176 Bacteria 1326
133 Ga0105242_10658402 3300009176 Bacteria 1019
134 Ga0105248_10005697 3300009177 Bacteria 13685
135 Ga0105248_10036110 3300009177 Bacteria 5527
136 Ga0105249_10011702 3300009553 Bacteria 7717
137 Ga0105249_10422426 3300009553 Bacteria 1367
138 Ga0105239_10045011 3300010375 Bacteria 4837
139 Ga0105246_10019359 3300011119 Bacteria 4348
140 Ga0157373_10030026 3300013100 Bacteria 3912
141 Ga0157371_10006813 3300013102 Bacteria 9338
142 Ga0157370_10027055 3300013104 Bacteria 5655
143 Ga0157378_10020341 3300013297 Bacteria 5838
144 Ga0163162_10135395 3300013306 Bacteria 2574
145 Ga0163162_10391674 3300013306 Bacteria 1522
146 Ga0157375_10039115 3300013308 Bacteria 4561
147 Ga0157375_10072756 3300013308 Bacteria 3455
148 Ga0157375_10197512 3300013308 Bacteria 2167
149 Ga0157375_10726629 3300013308 Unclassified 1145
150 Ga0163163_10186772 3300014325 Bacteria 2120
151 Ga0163163_10496597 3300014325 Bacteria 1282
152 Ga0157380_10005499 3300014326 Bacteria 8855
153 Ga0157380_10057517 3300014326 Bacteria 3097
154 Ga0157380_10416836 3300014326 Bacteria 1279
155 Ga0157380_10492709 3300014326 Bacteria 1188
156 Ga0157380_10816172 3300014326 Unclassified 951
157 Ga0157380_11219409 3300014326 Unclassified 797
158 Ga0157377_10020406 3300014745 Bacteria 3471
159 Ga0157377_10038683 3300014745 Bacteria 2635
160 Ga0157379_10243009 3300014968 Bacteria 1633
161 Ga0157376_10133822 3300014969 Bacteria 2216
162 Ga0207697_10000285 3300025315 Bacteria 28077
163 Ga0207642_10158151 3300025899 Unclassified 1214
164 Ga0207688_10005358 3300025901 Bacteria 6964
165 Ga0207688_10007761 3300025901 Bacteria 5842
166 Ga0207647_10000475 3300025904 Bacteria 32451
167 Ga0207645_10008285 3300025907 Bacteria 7264
168 Ga0207645_10011547 3300025907 Bacteria 6025
169 Ga0207645_10126761 3300025907 Bacteria 1659
170 Ga0207643_10013142 3300025908 Bacteria 4479
171 Ga0207643_10013980 3300025908 Bacteria 4354
172 Ga0207705_10012309 3300025909 Bacteria 6180
173 Ga0207705_10042274 3300025909 Unclassified 3272
174 Ga0207662_10063389 3300025918 Bacteria 2223
175 Ga0207657_10011550 3300025919 Bacteria 8767
176 Ga0207657_10027437 3300025919 Bacteria 5215
177 Ga0207646_10337292 3300025922 Bacteria 1362
178 Ga0207681_10002863 3300025923 Bacteria 10904
179 Ga0207650_10008344 3300025925 Bacteria 7073
180 Ga0207650_10234216 3300025925 Bacteria 1482
181 Ga0207659_10076189 3300025926 Unclassified 2464
182 Ga0207687_10054431 3300025927 Bacteria 2799
183 Ga0207644_10181142 3300025931 Unclassified 1651
184 Ga0207644_10334537 3300025931 Bacteria 1227
185 Ga0207690_10008460 3300025932 Bacteria 6110
186 Ga0207690_10342769 3300025932 Unclassified 1180
187 Ga0207706_10010466 3300025933 Bacteria 8475
188 Ga0207706_10168685 3300025933 Bacteria 1924
189 Ga0207706_10356533 3300025933 Bacteria 1271
190 Ga0207709_10025312 3300025935 Bacteria 3397
191 Ga0207709_10213595 3300025935 Bacteria 1386
192 Ga0207670_10061768 3300025936 Bacteria 2558
193 Ga0207669_10034142 3300025937 Bacteria 2879
194 Ga0207704_10091049 3300025938 Bacteria 2003
195 Ga0207691_10010451 3300025940 Bacteria 8904
196 Ga0207691_10025895 3300025940 Bacteria 5505
197 Ga0207691_10052804 3300025940 Bacteria 3711
198 Ga0207691_10671800 3300025940 Bacteria 874
199 Ga0207711_10009528 3300025941 Bacteria 8100
200 Ga0207711_10068690 3300025941 Bacteria 3070
201 Ga0207689_10008607 3300025942 Bacteria 8886
202 Ga0207689_10013340 3300025942 Bacteria 7011
203 Ga0207689_10110061 3300025942 Unclassified 2264
204 Ga0207689_10262575 3300025942 Bacteria 1429
205 Ga0207689_10351186 3300025942 Bacteria 1226
206 Ga0207679_10116399 3300025945 Unclassified 2119
207 Ga0207651_10012739 3300025960 Bacteria 4775
208 Ga0207651_10077911 3300025960 Bacteria 2375
209 Ga0207651_10213047 3300025960 Unclassified 1556
210 Ga0207712_10005300 3300025961 Bacteria 8143
211 Ga0207712_10185132 3300025961 Bacteria 1639
212 Ga0207668_10000129 3300025972 Bacteria 53619
213 Ga0207668_10100001 3300025972 Unclassified 2152
214 Ga0207640_10003726 3300025981 Bacteria 8223
215 Ga0207640_10098034 3300025981 Bacteria 2048
216 Ga0207640_10335894 3300025981 Unclassified 1208
217 Ga0207658_10011763 3300025986 Bacteria 5960
218 Ga0207658_10066160 3300025986 Bacteria 2717
219 Ga0207658_10069110 3300025986 Bacteria 2667
220 Ga0207677_10001108 3300026023 Bacteria 14712
221 Ga0207703_10014103 3300026035 Bacteria 6229
222 Ga0207639_10218623 3300026041 Unclassified 1644
223 Ga0207678_10030719 3300026067 Bacteria 4691
224 Ga0207678_10181644 3300026067 Unclassified 1796
225 Ga0207708_10115763 3300026075 Bacteria 2085
226 Ga0207641_10010041 3300026088 Bacteria 7786
227 Ga0207641_10013300 3300026088 Bacteria 6751
228 Ga0207641_10036841 3300026088 Bacteria 4083
229 Ga0207641_10039545 3300026088 Bacteria 3945
230 Ga0207641_10063028 3300026088 Bacteria 3166
231 Ga0207641_10472842 3300026088 Unclassified 1214
232 Ga0207648_10000838 3300026089 Bacteria 34648
233 Ga0207648_10000950 3300026089 Bacteria 32798
234 Ga0207648_10174476 3300026089 Bacteria 1901
235 Ga0207676_10003957 3300026095 Bacteria 10458
236 Ga0207676_10223320 3300026095 Bacteria 1679
237 Ga0207674_10013842 3300026116 Bacteria 8925
238 Ga0207674_10128588 3300026116 Bacteria 2497
239 Ga0207674_10396513 3300026116 Bacteria 1334
240 Ga0207683_10034323 3300026121 Bacteria 4408
241 Ga0207698_10001868 3300026142 Bacteria 12306
242 Ga0207698_10138833 3300026142 Bacteria 2090
243 Ga0268266_10357550 3300028379 Bacteria 1373
244 Ga0268266_10394235 3300028379 Bacteria 1308
245 Ga0268265_10002738 3300028380 Bacteria 13007
246 Ga0268265_10032151 3300028380 Bacteria 3798
247 Ga0268265_10117955 3300028380 Bacteria 2181
248 Ga0268265_10377385 3300028380 Bacteria 1303
249 Ga0268264_10011941 3300028381 Bacteria 7152
250 Ga0268264_10017410 3300028381 Bacteria 5885
251 Ga0268264_10149038 3300028381 Bacteria 2096
252 Ga0268264_10151196 3300028381 Unclassified 2081
253 Ga0268264_10473820 3300028381 Bacteria 1217
254 Ga0316182_1003818 3300030745 Unclassified 1824
255 Ga0307513_10319592 3300031456 Bacteria 1311
256 Ga0307408_100100745 3300031548 Bacteria 2201
257 Ga0307408_100110327 3300031548 Bacteria 2112
258 Ga0307408_100123078 3300031548 Unclassified 2012
259 Ga0307405_10017776 3300031731 Bacteria 3909
260 Ga0307405_10047269 3300031731 Unclassified 2649
261 Ga0307405_10075069 3300031731 Bacteria 2189
262 Ga0307413_10000642 3300031824 Bacteria 11821
263 Ga0307413_10009187 3300031824 Bacteria 4718
264 Ga0307413_10034031 3300031824 Bacteria 2908
265 Ga0307413_10088360 3300031824 Unclassified 2010
266 Ga0307413_10491827 3300031824 Bacteria 983
267 Ga0307410_10003301 3300031852 Bacteria 8063
268 Ga0307410_10006482 3300031852 Bacteria 6320
269 Ga0307410_10042854 3300031852 Bacteria 2994
270 Ga0307410_10152087 3300031852 Bacteria 1724
271 Ga0307410_10171559 3300031852 Unclassified 1635
272 Ga0307406_10080490 3300031901 Viruses 2163
273 Ga0307407_10001792 3300031903 Bacteria 8028
274 Ga0307407_10026403 3300031903 Bacteria 3074
275 Ga0307407_10032243 3300031903 Bacteria 2846
276 Ga0307409_100008332 3300031995 Bacteria 6283
277 Ga0307409_100056095 3300031995 Bacteria 3045
278 Ga0307409_100148977 3300031995 Bacteria 2028
279 Ga0307409_100174371 3300031995 Bacteria 1896
280 Ga0307409_100298001 3300031995 Bacteria 1498
281 Ga0307409_100340469 3300031995 Bacteria 1411
282 Ga0307409_100697220 3300031995 Unclassified 1014
283 Ga0307416_100008231 3300032002 Bacteria 6708
284 Ga0307416_100093230 3300032002 Bacteria 2593
285 Ga0307416_100247579 3300032002 Bacteria 1732
286 Ga0307416_100630982 3300032002 Unclassified 1154
287 Ga0307414_10028886 3300032004 Bacteria 3602
288 Ga0307414_10327043 3300032004 Bacteria 1307
289 Ga0307414_10330423 3300032004 Unclassified 1301
290 Ga0307414_10445588 3300032004 Unclassified 1134
291 Ga0307411_10001578 3300032005 Bacteria 9448
292 Ga0307411_10015379 3300032005 Bacteria 4295
293 Ga0307411_10015728 3300032005 Bacteria 4260
294 Ga0307411_10056894 3300032005 Bacteria 2580
295 Ga0307411_10069337 3300032005 Bacteria 2381
296 Ga0307411_10316843 3300032005 Bacteria 1258
297 Ga0307415_100001788 3300032126 Bacteria 10525
298 Ga0307415_100002957 3300032126 Bacteria 8535
299 Ga0307415_100097123 3300032126 Unclassified 2149
300 Ga0316574_0338833 3300035398 Bacteria 953
301 Ga0395899_0162296 3300037312 Bacteria 1578
302 Ga0395898_0303933 3300037466 Unclassified 1522
303 Ga0395905_0440815 3300037471 Bacteria 1200
304 Ga0451800_0847870 3300041459 Bacteria 1737
305 Ga0451804_0473041 3300041463 Bacteria 1428
306 Ga0451853_1416695 3300041512 Bacteria 1315
307 Ga0439464_0000505 3300042439 Bacteria 7960
308 Ga0453684_0269983 3300044712 Bacteria 1944
309 Ga0495650_0048054 3300046471 Bacteria 1781
310 Ga0495598_0025119 3300046537 Bacteria 1622
311 Ga0495668_0010198 3300046616 Bacteria 5709
312 Ga0501292_033167 3300049515 Bacteria 874
313 Ga0501296_002374 3300049519 Unclassified 1964
314 Ga0501201_002078 3300049651 Bacteria 1843
315 Ga0501201_003017 3300049651 Bacteria 1545
316 Ga0501202_000334 3300049652 Bacteria 6563
317 Ga0501202_008600 3300049652 Bacteria 1862
318 Ga0501202_029515 3300049652 Bacteria 1137
319 Ga0501206_002743 3300049653 Unclassified 2219
320 Ga0501207_003263 3300049654 Unclassified 2153
321 Ga0501209_018926 3300049656 Bacteria 1600
322 Ga0501216_005314 3300049660 Bacteria 1936
323 Ga0501217_000531 3300049661 Bacteria 6336
324 Ga0501222_002733 3300049662 Unclassified 2442
325 Ga0501223_001442 3300049663 Bacteria 5493
326 Ga0501223_018294 3300049663 Bacteria 1379
327 Ga0501223_022462 3300049663 Bacteria 1232
328 Ga0501223_025743 3300049663 Bacteria 1145
329 Ga0501224_003093 3300049664 Unclassified 2304
330 Ga0501224_032771 3300049664 Bacteria 780
331 Ga0501233_009761 3300049668 Unclassified 1878
332 Ga0501235_005076 3300049669 Unclassified 2858
333 Ga0501240_000591 3300049673 Unclassified 3049
334 Ga0501242_013618 3300049674 Bacteria 1000
335 Ga0501243_000676 3300049675 Unclassified 4686
336 Ga0501250_001006 3300049680 Bacteria 2164
337 Ga0501251_003235 3300049681 Bacteria 1617
338 Ga0501252_001958 3300049682 Unclassified 1988
339 Ga0501252_008048 3300049682 Bacteria 1205
340 Ga0501259_001004 3300049688 Bacteria 4688
341 Ga0501259_048493 3300049688 Unclassified 856
342 Ga0501260_004612 3300049689 Bacteria 1278
343 Ga0501261_002439 3300049690 Unclassified 2282
344 Ga0501221_005886 3300049704 Unclassified 2060
345 Ga0501221_056955 3300049704 Bacteria 894
346 Ga0501225_0001142 3300049705 Bacteria 8296
347 Ga0501225_0035853 3300049705 Bacteria 1366
348 Ga0501234_002314 3300049707 Unclassified 3001
349 Ga0501245_001229 3300049708 Unclassified 3302
350 Ga0501266_000279 3300049763 Bacteria 6723
351 Ga0501266_017095 3300049763 Unclassified 968
352 Ga0501269_015159 3300049766 Unclassified 947
353 Ga0501273_009116 3300049770 Bacteria 1199
354 Ga0501278_005183 3300049774 Unclassified 953
355 Ga0501279_020254 3300049775 Unclassified 944
356 Ga0501212_003042 3300049851 Bacteria 2073
357 Ga0501212_015037 3300049851 Bacteria 1151
358 nmdc:mga08y16_61105_c1 3300050511 Bacteria 3934
359 nmdc:mga08y16_65745_c1 3300050511 Bacteria 3785
360 Ga0500658_0000107 3300053134 Bacteria 38715
361 Ga0500616_0076373 3300053153 Bacteria 1694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042439 Ga0439464_0000505 Ga0439464_0000505_6836_7525 222
2 3300032005 Ga0307411_10015728 Ga0307411_100157284 223
3 3300049688 Ga0501259_048493 Ga0501259_048493_20_697 225
4 3300005841 Ga0068863_100639974 Ga0068863_1006399741 228
5 3300026089 Ga0207648_10174476 Ga0207648_101744762 228
6 3300026116 Ga0207674_10396513 Ga0207674_103965131 228
7 3300031824 Ga0307413_10088360 Ga0307413_100883603 228
8 3300031852 Ga0307410_10171559 Ga0307410_101715593 228
9 3300032126 Ga0307415_100097123 Ga0307415_1000971233 228
10 3300002459 JGI24751J29686_10000732 JGI24751J29686_1000073211 232
11 3300005290 Ga0065712_10338364 Ga0065712_103383641 232
12 3300005549 Ga0070704_100067615 Ga0070704_1000676152 232
13 3300005617 Ga0068859_100001069 Ga0068859_10000106910 232
14 3300005840 Ga0068870_10180928 Ga0068870_101809281 232
15 3300005844 Ga0068862_100134655 Ga0068862_1001346554 232
16 3300005844 Ga0068862_100421659 Ga0068862_1004216592 232
17 3300006931 Ga0097620_100001069 Ga0097620_10000106920 232
18 3300013297 Ga0157378_10020341 Ga0157378_100203412 232
19 3300025961 Ga0207712_10005300 Ga0207712_1000530012 232
20 3300026116 Ga0207674_10128588 Ga0207674_101285882 232
21 3300031456 Ga0307513_10319592 Ga0307513_103195922 232
22 3300032005 Ga0307411_10316843 Ga0307411_103168431 232
23 3300044712 Ga0453684_0269983 Ga0453684_0269983_1227_1928 232
24 3300049515 Ga0501292_033167 Ga0501292_033167_163_864 232
25 3300049651 Ga0501201_003017 Ga0501201_003017_55_756 232
26 3300049656 Ga0501209_018926 Ga0501209_018926_520_1221 232
27 3300049664 Ga0501224_032771 Ga0501224_032771_57_758 232
28 3300049704 Ga0501221_056955 Ga0501221_056955_13_714 232
29 3300049763 Ga0501266_017095 Ga0501266_017095_245_946 232
30 3300049770 Ga0501273_009116 Ga0501273_009116_95_796 232
31 iso_pu_bacteria 2739367651 2739586452 233
32 3300049689 Ga0501260_004612 Ga0501260_004612_25_738 236
33 3300005331 Ga0070670_100215482 Ga0070670_1002154821 238
34 3300032004 Ga0307414_10327043 Ga0307414_103270432 238
35 iso_pu_bacteria 2884634485 2884635615 238
36 3300031548 Ga0307408_100100745 Ga0307408_1001007452 240
37 3300031824 Ga0307413_10000642 Ga0307413_100006424 240
38 3300031852 Ga0307410_10042854 Ga0307410_100428542 240
39 3300031901 Ga0307406_10080490 Ga0307406_100804903 240
40 3300031903 Ga0307407_10001792 Ga0307407_100017922 240
41 3300032005 Ga0307411_10001578 Ga0307411_100015788 240
42 3300037312 Ga0395899_0162296 Ga0395899_0162296_714_1466 240
43 3300037466 Ga0395898_0303933 Ga0395898_0303933_394_1146 240
44 3300005288 Ga0065714_10118312 Ga0065714_101183122 242
45 3300005290 Ga0065712_10284537 Ga0065712_102845371 242
46 3300005293 Ga0065715_10103373 Ga0065715_101033732 242
47 3300005328 Ga0070676_10027630 Ga0070676_100276301 242
48 3300005331 Ga0070670_100256497 Ga0070670_1002564972 242
49 3300005331 Ga0070670_100425760 Ga0070670_1004257602 242
50 3300005333 Ga0070677_10141328 Ga0070677_101413281 242
51 3300005333 Ga0070677_10301603 Ga0070677_103016031 242
52 3300005334 Ga0068869_100075695 Ga0068869_1000756952 242
53 3300005334 Ga0068869_100204952 Ga0068869_1002049522 242
54 3300005338 Ga0068868_100396454 Ga0068868_1003964541 242
55 3300005347 Ga0070668_100629430 Ga0070668_1006294301 242
56 3300005354 Ga0070675_100085037 Ga0070675_1000850374 242
57 3300005354 Ga0070675_100377555 Ga0070675_1003775552 242
58 3300005356 Ga0070674_100592365 Ga0070674_1005923651 242
59 3300005364 Ga0070673_100039657 Ga0070673_1000396572 242
60 3300005365 Ga0070688_100017650 Ga0070688_1000176502 242
61 3300005438 Ga0070701_10098507 Ga0070701_100985072 242
62 3300005459 Ga0068867_100046729 Ga0068867_1000467291 242
63 3300005466 Ga0070685_10011933 Ga0070685_100119335 242
64 3300005471 Ga0070698_100119180 Ga0070698_1001191804 242
65 3300005617 Ga0068859_100027955 Ga0068859_1000279557 242
66 3300005617 Ga0068859_100041431 Ga0068859_1000414313 242
67 3300005618 Ga0068864_100038363 Ga0068864_1000383632 242
68 3300005618 Ga0068864_100251039 Ga0068864_1002510392 242
69 3300005834 Ga0068851_10087516 Ga0068851_100875161 242
70 3300005841 Ga0068863_100061185 Ga0068863_1000611852 242
71 3300005843 Ga0068860_100099851 Ga0068860_1000998512 242
72 3300005844 Ga0068862_100347048 Ga0068862_1003470481 242
73 3300006237 Ga0097621_100283047 Ga0097621_1002830472 242
74 3300006358 Ga0068871_100076822 Ga0068871_1000768222 242
75 3300006931 Ga0097620_100027955 Ga0097620_1000279557 242
76 3300006931 Ga0097620_100041431 Ga0097620_1000414313 242
77 3300009094 Ga0111539_10359661 Ga0111539_103596612 242
78 3300009176 Ga0105242_10171652 Ga0105242_101716522 242
79 3300009176 Ga0105242_10658402 Ga0105242_106584021 242
80 3300009177 Ga0105248_10036110 Ga0105248_100361102 242
81 3300009553 Ga0105249_10011702 Ga0105249_1001170210 242
82 3300009553 Ga0105249_10422426 Ga0105249_104224262 242
83 3300013104 Ga0157370_10027055 Ga0157370_100270552 242
84 3300013308 Ga0157375_10072756 Ga0157375_100727562 242
85 3300013308 Ga0157375_10197512 Ga0157375_101975122 242
86 3300014325 Ga0163163_10186772 Ga0163163_101867722 242
87 3300014325 Ga0163163_10496597 Ga0163163_104965971 242
88 3300014326 Ga0157380_10005499 Ga0157380_100054994 242
89 3300014326 Ga0157380_10057517 Ga0157380_100575172 242
90 3300014326 Ga0157380_10416836 Ga0157380_104168361 242
91 3300014326 Ga0157380_10492709 Ga0157380_104927092 242
92 3300014745 Ga0157377_10020406 Ga0157377_100204062 242
93 3300014745 Ga0157377_10038683 Ga0157377_100386831 242
94 3300014968 Ga0157379_10243009 Ga0157379_102430092 242
95 3300014969 Ga0157376_10133822 Ga0157376_101338222 242
96 3300025907 Ga0207645_10126761 Ga0207645_101267612 242
97 3300025908 Ga0207643_10013142 Ga0207643_100131424 242
98 3300025918 Ga0207662_10063389 Ga0207662_100633892 242
99 3300025922 Ga0207646_10337292 Ga0207646_103372922 242
100 3300025925 Ga0207650_10234216 Ga0207650_102342162 242
101 3300025940 Ga0207691_10052804 Ga0207691_100528043 242
102 3300025940 Ga0207691_10671800 Ga0207691_106718001 242
103 3300025942 Ga0207689_10262575 Ga0207689_102625752 242
104 3300025960 Ga0207651_10077911 Ga0207651_100779111 242
105 3300025961 Ga0207712_10185132 Ga0207712_101851322 242
106 3300025981 Ga0207640_10098034 Ga0207640_100980342 242
107 3300026075 Ga0207708_10115763 Ga0207708_101157632 242
108 3300026088 Ga0207641_10472842 Ga0207641_104728422 242
109 3300026095 Ga0207676_10223320 Ga0207676_102233201 242
110 3300028380 Ga0268265_10117955 Ga0268265_101179552 242
111 3300028380 Ga0268265_10377385 Ga0268265_103773851 242
112 3300028381 Ga0268264_10151196 Ga0268264_101511962 242
113 3300031548 Ga0307408_100110327 Ga0307408_1001103272 242
114 3300031548 Ga0307408_100123078 Ga0307408_1001230782 242
115 3300031731 Ga0307405_10017776 Ga0307405_100177762 242
116 3300031731 Ga0307405_10047269 Ga0307405_100472692 242
117 3300031731 Ga0307405_10075069 Ga0307405_100750692 242
118 3300031824 Ga0307413_10009187 Ga0307413_100091874 242
119 3300031824 Ga0307413_10034031 Ga0307413_100340312 242
120 3300031824 Ga0307413_10491827 Ga0307413_104918271 242
121 3300031852 Ga0307410_10003301 Ga0307410_100033018 242
122 3300031852 Ga0307410_10006482 Ga0307410_100064826 242
123 3300031903 Ga0307407_10026403 Ga0307407_100264032 242
124 3300031903 Ga0307407_10032243 Ga0307407_100322432 242
125 3300031995 Ga0307409_100056095 Ga0307409_1000560954 242
126 3300031995 Ga0307409_100148977 Ga0307409_1001489772 242
127 3300031995 Ga0307409_100298001 Ga0307409_1002980012 242
128 3300032002 Ga0307416_100008231 Ga0307416_1000082317 242
129 3300032002 Ga0307416_100093230 Ga0307416_1000932302 242
130 3300032002 Ga0307416_100247579 Ga0307416_1002475792 242
131 3300032004 Ga0307414_10028886 Ga0307414_100288862 242
132 3300032005 Ga0307411_10015379 Ga0307411_100153792 242
133 3300032126 Ga0307415_100001788 Ga0307415_1000017887 242
134 3300032126 Ga0307415_100002957 Ga0307415_1000029572 242
135 3300035398 Ga0316574_0338833 Ga0316574_0338833_30_761 242
136 3300041459 Ga0451800_0847870 Ga0451800_0847870_904_1638 242
137 3300041463 Ga0451804_0473041 Ga0451804_0473041_536_1270 242
138 3300046537 Ga0495598_0025119 Ga0495598_0025119_85_816 242
139 3300049652 Ga0501202_000334 Ga0501202_000334_3933_4664 242
140 3300049663 Ga0501223_018294 Ga0501223_018294_107_838 242
141 3300049674 Ga0501242_013618 Ga0501242_013618_193_924 242
142 3300049705 Ga0501225_0035853 Ga0501225_0035853_419_1150 242
143 3300049775 Ga0501279_020254 Ga0501279_020254_127_858 242
144 3300050511 nmdc:mga08y16_61105_c1 nmdc:mga08y16_61105_c1_1954_2685 242
145 3300053153 Ga0500616_0076373 Ga0500616_0076373_262_993 242
146 3300006844 Ga0075428_100478032 Ga0075428_1004780322 243
147 3300009174 Ga0105241_10073112 Ga0105241_100731125 243
148 3300049663 Ga0501223_022462 Ga0501223_022462_21_800 243
149 3300006844 Ga0075428_100114387 Ga0075428_1001143872 244
150 3300009094 Ga0111539_10021370 Ga0111539_100213704 244
151 3300014326 Ga0157380_11219409 Ga0157380_112194091 244
152 3300031995 Ga0307409_100697220 Ga0307409_1006972201 244
153 3300032002 Ga0307416_100630982 Ga0307416_1006309821 244
154 3300050511 nmdc:mga08y16_65745_c1 nmdc:mga08y16_65745_c1_2150_2887 244
155 3300030745 Ga0316182_1003818 Ga0316182_10038181 245
156 3300031852 Ga0307410_10152087 Ga0307410_101520872 245
157 3300005843 Ga0068860_100554794 Ga0068860_1005547942 246
158 3300009094 Ga0111539_11224056 Ga0111539_112240562 246
159 3300028381 Ga0268264_10473820 Ga0268264_104738201 246
160 3300005617 Ga0068859_100583462 Ga0068859_1005834622 247
161 3300005719 Ga0068861_100177225 Ga0068861_1001772252 247
162 3300006931 Ga0097620_100583439 Ga0097620_1005834392 247
163 3300025942 Ga0207689_10351186 Ga0207689_103511862 247
164 3300049651 Ga0501201_002078 Ga0501201_002078_216_1037 248
165 3300049652 Ga0501202_008600 Ga0501202_008600_187_1008 248
166 3300049653 Ga0501206_002743 Ga0501206_002743_79_900 248
167 3300049654 Ga0501207_003263 Ga0501207_003263_22_843 248
168 3300049660 Ga0501216_005314 Ga0501216_005314_1102_1923 248
169 3300049661 Ga0501217_000531 Ga0501217_000531_4723_5544 248
170 3300049662 Ga0501222_002733 Ga0501222_002733_491_1312 248
171 3300049663 Ga0501223_001442 Ga0501223_001442_1492_2313 248
172 3300049664 Ga0501224_003093 Ga0501224_003093_860_1681 248
173 3300049668 Ga0501233_009761 Ga0501233_009761_672_1493 248
174 3300049669 Ga0501235_005076 Ga0501235_005076_1807_2628 248
175 3300049673 Ga0501240_000591 Ga0501240_000591_1585_2406 248
176 3300049675 Ga0501243_000676 Ga0501243_000676_2327_3148 248
177 3300049681 Ga0501251_003235 Ga0501251_003235_738_1559 248
178 3300049682 Ga0501252_001958 Ga0501252_001958_271_1092 248
179 3300049688 Ga0501259_001004 Ga0501259_001004_3707_4528 248
180 3300049690 Ga0501261_002439 Ga0501261_002439_841_1662 248
181 3300049704 Ga0501221_005886 Ga0501221_005886_14_835 248
182 3300049705 Ga0501225_0001142 Ga0501225_0001142_2920_3741 248
183 3300049707 Ga0501234_002314 Ga0501234_002314_1539_2360 248
184 3300049708 Ga0501245_001229 Ga0501245_001229_1054_1875 248
185 3300049766 Ga0501269_015159 Ga0501269_015159_37_858 248
186 3300049774 Ga0501278_005183 Ga0501278_005183_13_834 248
187 3300049851 Ga0501212_003042 Ga0501212_003042_15_836 248
188 3300028379 Ga0268266_10394235 Ga0268266_103942351 249
189 3300001915 JGI24741J21665_1027736 JGI24741J21665_10277361 250
190 3300001979 JGI24740J21852_10003511 JGI24740J21852_100035113 250
191 3300001989 JGI24739J22299_10001448 JGI24739J22299_100014485 250
192 3300001990 JGI24737J22298_10000410 JGI24737J22298_100004105 250
193 3300002075 JGI24738J21930_10001309 JGI24738J21930_100013096 250
194 3300002239 JGI24034J26672_10002635 JGI24034J26672_100026353 250
195 3300005293 Ga0065715_10293209 Ga0065715_102932092 250
196 3300005327 Ga0070658_10001117 Ga0070658_1000111722 250
197 3300005327 Ga0070658_10098318 Ga0070658_100983181 250
198 3300005328 Ga0070676_10000162 Ga0070676_100001622 250
199 3300005328 Ga0070676_10002241 Ga0070676_1000224112 250
200 3300005331 Ga0070670_100010999 Ga0070670_1000109993 250
201 3300005334 Ga0068869_100000198 Ga0068869_1000001985 250
202 3300005334 Ga0068869_100118686 Ga0068869_1001186863 250
203 3300005334 Ga0068869_100170784 Ga0068869_1001707842 250
204 3300005337 Ga0070682_100289501 Ga0070682_1002895012 250
205 3300005338 Ga0068868_100005453 Ga0068868_1000054535 250
206 3300005338 Ga0068868_100752178 Ga0068868_1007521781 250
207 3300005339 Ga0070660_100007976 Ga0070660_1000079766 250
208 3300005339 Ga0070660_100035692 Ga0070660_1000356925 250
209 3300005344 Ga0070661_100225674 Ga0070661_1002256742 250
210 3300005345 Ga0070692_10254987 Ga0070692_102549871 250
211 3300005347 Ga0070668_100003957 Ga0070668_10000395714 250
212 3300005353 Ga0070669_100005945 Ga0070669_1000059459 250
213 3300005355 Ga0070671_100310692 Ga0070671_1003106922 250
214 3300005356 Ga0070674_100074092 Ga0070674_1000740922 250
215 3300005364 Ga0070673_100003953 Ga0070673_1000039535 250
216 3300005366 Ga0070659_100159430 Ga0070659_1001594302 250
217 3300005367 Ga0070667_100108662 Ga0070667_1001086623 250
218 3300005367 Ga0070667_100247665 Ga0070667_1002476651 250
219 3300005455 Ga0070663_100002083 Ga0070663_1000020838 250
220 3300005455 Ga0070663_100132143 Ga0070663_1001321431 250
221 3300005456 Ga0070678_100028880 Ga0070678_1000288805 250
222 3300005457 Ga0070662_100136783 Ga0070662_1001367831 250
223 3300005459 Ga0068867_100028807 Ga0068867_1000288075 250
224 3300005539 Ga0068853_100011123 Ga0068853_1000111237 250
225 3300005539 Ga0068853_100215595 Ga0068853_1002155952 250
226 3300005543 Ga0070672_100009126 Ga0070672_1000091265 250
227 3300005543 Ga0070672_100133357 Ga0070672_1001333572 250
228 3300005544 Ga0070686_100152260 Ga0070686_1001522601 250
229 3300005547 Ga0070693_100076725 Ga0070693_1000767253 250
230 3300005548 Ga0070665_100560837 Ga0070665_1005608372 250
231 3300005563 Ga0068855_100047224 Ga0068855_1000472245 250
232 3300005577 Ga0068857_100013740 Ga0068857_1000137406 250
233 3300005578 Ga0068854_100000599 Ga0068854_1000005995 250
234 3300005615 Ga0070702_100029342 Ga0070702_1000293423 250
235 3300005616 Ga0068852_100079115 Ga0068852_1000791155 250
236 3300005616 Ga0068852_100382621 Ga0068852_1003826212 250
237 3300005617 Ga0068859_100057579 Ga0068859_1000575795 250
238 3300005617 Ga0068859_100175498 Ga0068859_1001754982 250
239 3300005617 Ga0068859_100243299 Ga0068859_1002432993 250
240 3300005618 Ga0068864_100007601 Ga0068864_10000760110 250
241 3300005718 Ga0068866_10028343 Ga0068866_100283432 250
242 3300005834 Ga0068851_10155049 Ga0068851_101550491 250
243 3300005834 Ga0068851_10407926 Ga0068851_104079261 250
244 3300005841 Ga0068863_100004142 Ga0068863_10000414216 250
245 3300005841 Ga0068863_100021780 Ga0068863_1000217806 250
246 3300005841 Ga0068863_100034558 Ga0068863_1000345583 250
247 3300005841 Ga0068863_100043383 Ga0068863_1000433832 250
248 3300005842 Ga0068858_100004047 Ga0068858_1000040475 250
249 3300005843 Ga0068860_100084177 Ga0068860_1000841773 250
250 3300005843 Ga0068860_100260989 Ga0068860_1002609891 250
251 3300005844 Ga0068862_100003966 Ga0068862_1000039662 250
252 3300005844 Ga0068862_100026268 Ga0068862_1000262682 250
253 3300005844 Ga0068862_100198667 Ga0068862_1001986672 250
254 3300005844 Ga0068862_100523615 Ga0068862_1005236152 250
255 3300006237 Ga0097621_100551445 Ga0097621_1005514451 250
256 3300006358 Ga0068871_100007484 Ga0068871_1000074842 250
257 3300006881 Ga0068865_100007392 Ga0068865_1000073928 250
258 3300006881 Ga0068865_100420646 Ga0068865_1004206461 250
259 3300006931 Ga0097620_100057576 Ga0097620_1000575765 250
260 3300006931 Ga0097620_100175492 Ga0097620_1001754922 250
261 3300006931 Ga0097620_100243305 Ga0097620_1002433052 250
262 3300009098 Ga0105245_10002561 Ga0105245_1000256118 250
263 3300009098 Ga0105245_10040666 Ga0105245_100406663 250
264 3300009148 Ga0105243_10029828 Ga0105243_100298283 250
265 3300009148 Ga0105243_10188750 Ga0105243_101887501 250
266 3300009176 Ga0105242_10371820 Ga0105242_103718201 250
267 3300009177 Ga0105248_10005697 Ga0105248_1000569714 250
268 3300010375 Ga0105239_10045011 Ga0105239_100450113 250
269 3300011119 Ga0105246_10019359 Ga0105246_100193595 250
270 3300013100 Ga0157373_10030026 Ga0157373_100300264 250
271 3300013102 Ga0157371_10006813 Ga0157371_100068134 250
272 3300013306 Ga0163162_10135395 Ga0163162_101353955 250
273 3300013306 Ga0163162_10391674 Ga0163162_103916742 250
274 3300013308 Ga0157375_10039115 Ga0157375_100391155 250
275 3300013308 Ga0157375_10726629 Ga0157375_107266292 250
276 3300014326 Ga0157380_10816172 Ga0157380_108161721 250
277 3300025315 Ga0207697_10000285 Ga0207697_100002854 250
278 3300025899 Ga0207642_10158151 Ga0207642_101581512 250
279 3300025901 Ga0207688_10005358 Ga0207688_100053588 250
280 3300025901 Ga0207688_10007761 Ga0207688_100077614 250
281 3300025904 Ga0207647_10000475 Ga0207647_1000047511 250
282 3300025907 Ga0207645_10008285 Ga0207645_100082859 250
283 3300025907 Ga0207645_10011547 Ga0207645_100115472 250
284 3300025908 Ga0207643_10013980 Ga0207643_100139802 250
285 3300025909 Ga0207705_10012309 Ga0207705_100123094 250
286 3300025909 Ga0207705_10042274 Ga0207705_100422743 250
287 3300025919 Ga0207657_10011550 Ga0207657_100115504 250
288 3300025919 Ga0207657_10027437 Ga0207657_100274376 250
289 3300025923 Ga0207681_10002863 Ga0207681_100028634 250
290 3300025925 Ga0207650_10008344 Ga0207650_100083444 250
291 3300025926 Ga0207659_10076189 Ga0207659_100761893 250
292 3300025927 Ga0207687_10054431 Ga0207687_100544313 250
293 3300025931 Ga0207644_10181142 Ga0207644_101811422 250
294 3300025931 Ga0207644_10334537 Ga0207644_103345371 250
295 3300025932 Ga0207690_10008460 Ga0207690_100084604 250
296 3300025932 Ga0207690_10342769 Ga0207690_103427691 250
297 3300025933 Ga0207706_10010466 Ga0207706_100104663 250
298 3300025933 Ga0207706_10168685 Ga0207706_101686851 250
299 3300025933 Ga0207706_10356533 Ga0207706_103565332 250
300 3300025935 Ga0207709_10025312 Ga0207709_100253125 250
301 3300025935 Ga0207709_10213595 Ga0207709_102135952 250
302 3300025936 Ga0207670_10061768 Ga0207670_100617683 250
303 3300025937 Ga0207669_10034142 Ga0207669_100341423 250
304 3300025938 Ga0207704_10091049 Ga0207704_100910492 250
305 3300025940 Ga0207691_10010451 Ga0207691_100104514 250
306 3300025940 Ga0207691_10025895 Ga0207691_100258952 250
307 3300025941 Ga0207711_10009528 Ga0207711_100095283 250
308 3300025941 Ga0207711_10068690 Ga0207711_100686905 250
309 3300025942 Ga0207689_10008607 Ga0207689_100086079 250
310 3300025942 Ga0207689_10013340 Ga0207689_100133404 250
311 3300025942 Ga0207689_10110061 Ga0207689_101100613 250
312 3300025945 Ga0207679_10116399 Ga0207679_101163992 250
313 3300025960 Ga0207651_10012739 Ga0207651_100127394 250
314 3300025960 Ga0207651_10213047 Ga0207651_102130473 250
315 3300025972 Ga0207668_10000129 Ga0207668_1000012960 250
316 3300025972 Ga0207668_10100001 Ga0207668_101000012 250
317 3300025981 Ga0207640_10003726 Ga0207640_100037262 250
318 3300025981 Ga0207640_10335894 Ga0207640_103358941 250
319 3300025986 Ga0207658_10011763 Ga0207658_100117633 250
320 3300025986 Ga0207658_10066160 Ga0207658_100661603 250
321 3300025986 Ga0207658_10069110 Ga0207658_100691102 250
322 3300026023 Ga0207677_10001108 Ga0207677_100011084 250
323 3300026035 Ga0207703_10014103 Ga0207703_100141031 250
324 3300026041 Ga0207639_10218623 Ga0207639_102186232 250
325 3300026067 Ga0207678_10030719 Ga0207678_100307194 250
326 3300026067 Ga0207678_10181644 Ga0207678_101816443 250
327 3300026088 Ga0207641_10010041 Ga0207641_100100418 250
328 3300026088 Ga0207641_10013300 Ga0207641_100133003 250
329 3300026088 Ga0207641_10036841 Ga0207641_100368412 250
330 3300026088 Ga0207641_10039545 Ga0207641_100395452 250
331 3300026088 Ga0207641_10063028 Ga0207641_100630282 250
332 3300026089 Ga0207648_10000838 Ga0207648_100008388 250
333 3300026089 Ga0207648_10000950 Ga0207648_1000095010 250
334 3300026095 Ga0207676_10003957 Ga0207676_100039574 250
335 3300026116 Ga0207674_10013842 Ga0207674_100138424 250
336 3300026121 Ga0207683_10034323 Ga0207683_100343232 250
337 3300026142 Ga0207698_10001868 Ga0207698_100018681 250
338 3300026142 Ga0207698_10138833 Ga0207698_101388332 250
339 3300028379 Ga0268266_10357550 Ga0268266_103575502 250
340 3300028380 Ga0268265_10002738 Ga0268265_100027382 250
341 3300028380 Ga0268265_10032151 Ga0268265_100321513 250
342 3300028381 Ga0268264_10011941 Ga0268264_100119418 250
343 3300028381 Ga0268264_10017410 Ga0268264_100174104 250
344 3300028381 Ga0268264_10149038 Ga0268264_101490383 250
345 3300031995 Ga0307409_100008332 Ga0307409_1000083327 250
346 3300031995 Ga0307409_100174371 Ga0307409_1001743711 250
347 3300031995 Ga0307409_100340469 Ga0307409_1003404692 250
348 3300032004 Ga0307414_10330423 Ga0307414_103304232 250
349 3300032004 Ga0307414_10445588 Ga0307414_104455882 250
350 3300032005 Ga0307411_10056894 Ga0307411_100568941 250
351 3300032005 Ga0307411_10069337 Ga0307411_100693372 250
352 3300037471 Ga0395905_0440815 Ga0395905_0440815_286_1038 250
353 3300041512 Ga0451853_1416695 Ga0451853_1416695_108_947 250
354 3300046471 Ga0495650_0048054 Ga0495650_0048054_694_1446 250
355 3300046616 Ga0495668_0010198 Ga0495668_0010198_1412_2164 250
356 3300049519 Ga0501296_002374 Ga0501296_002374_36_842 250
357 3300049652 Ga0501202_029515 Ga0501202_029515_72_878 250
358 3300049663 Ga0501223_025743 Ga0501223_025743_106_912 250
359 3300049680 Ga0501250_001006 Ga0501250_001006_995_1801 250
360 3300049682 Ga0501252_008048 Ga0501252_008048_333_1139 250
361 3300049763 Ga0501266_000279 Ga0501266_000279_2738_3544 250
362 3300049851 Ga0501212_015037 Ga0501212_015037_333_1139 250
363 3300053134 Ga0500658_0000107 Ga0500658_0000107_20800_21552 250

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjq-assembly1.cif.gz_G vascular katp channel: kir6.1 sur2b quatrefoil-like conformation 2 0.4616 121 246
6e9z-assembly1.cif.gz_B dhf119 filament 0.4465 1 236
8e0m-assembly4.cif.gz_L homotrimeric variant of tctrp9, bgl15 0.4185 88 237
6e9z-assembly1.cif.gz_B dhf119 filament 0.4003 1 236
6fel-assembly2.cif.gz_C structure of 14-3-3 gamma in complex with camkk2 14-3-3 binding motif ser511 0.4001 44 229
ID Description Score Start End Superfamily
af_Q8GXA1_46_203_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5673 118 235 1.20.140.40
af_K7K831_27_178_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5628 118 236 1.20.140.40
af_Q7F0H7_42_198_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5534 118 247 1.20.140.40
af_Q0DJG7_36_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5345 103 235 1.20.140.40
af_Q65XN3_57_205_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5312 119 234 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A4Q8QHK5-F1-model_v4 Uncharacterized protein 0.9069 10 250 GO:0016020
AF-A0A4Q8QHK5-F1-model_v4 Uncharacterized protein 0.8965 10 250 GO:0016020
AF-M7N2B1-F1-model_v4 Uncharacterized protein 0.8951 7 250 GO:0016020
AF-A0A6B3WCU3-F1-model_v4 Uncharacterized protein 0.8757 8 250 GO:0016020
AF-A0A516HFP2-F1-model_v4 Uncharacterized protein 0.8731 10 249 GO:0016020

Feature Viewer

pLDDT pTM Quality
79.18 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map