F422971

General Info

Members Datasets Scaffolds Average Seq Length
363 232 352 244

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10347010|Ga0157376_103470102
Length 276
Sequence LKFQGFPLGPKLAALDSESVASRQGLKKNQMDNTLYVGLSRQIVLKREMDIVANNIANADTTGFKFESLMTKVAPSPPAFTAGGPKPVKFVAADGVARNFSQGGLRRTDAKFDLAIEGQGFFKVNTKAGERYTRDGHFRTDDTGRVTTQSGAVLADEGGGEITVDVQKPGEISVSEDGVVSQGEERIGKVGVFKFDSLSALEKTGDNLYQNASNQQPTAAADAKVRQGMLENSNVNPIVQITRMIEVNRAYEQVSQMISAESDLSRNSVARLGRLQ

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
10 2818991435 Caulobacter henricii 536 Isolate Unclassified
11 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
231 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
232 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.49
Nodule 0
Rhizoplane 2.2
Rhizosphere 68.04
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10084964 3300003316 Bacteria 2101
2 Ga0055537_1001254 3300003773 Bacteria 10591
3 Ga0055524_1019520 3300003775 Bacteria 2314
4 Ga0055524_1019696 3300003775 Bacteria 2297
5 Ga0055528_1008387 3300003790 Bacteria 4436
6 Ga0055530_10007468 3300003791 Bacteria 4590
7 Ga0055531_10000761 3300003794 Bacteria 27006
8 Ga0055531_10002133 3300003794 Bacteria 13543
9 Ga0065165_1000041 3300005262 Bacteria 203876
10 Ga0065165_1000624 3300005262 Bacteria 51434
11 Ga0070658_10036705 3300005327 Bacteria 3950
12 Ga0070658_10045901 3300005327 Bacteria 3534
13 Ga0070658_10221577 3300005327 Bacteria 1600
14 Ga0070658_10267313 3300005327 Bacteria 1453
15 Ga0070670_100010197 3300005331 Bacteria 8019
16 Ga0070670_100139534 3300005331 Bacteria 2096
17 Ga0070666_10099614 3300005335 Bacteria 2002
18 Ga0070666_10175615 3300005335 Bacteria 1502
19 Ga0070680_100004477 3300005336 Bacteria 10526
20 Ga0070660_100073331 3300005339 Bacteria 2676
21 Ga0070660_100112999 3300005339 Bacteria 2162
22 Ga0070691_10004455 3300005341 Bacteria 6363
23 Ga0070661_100184277 3300005344 Bacteria 1590
24 Ga0070668_100000354 3300005347 Bacteria 30316
25 Ga0070668_100002972 3300005347 Bacteria 12533
26 Ga0070668_100010666 3300005347 Bacteria 6831
27 Ga0070668_100030889 3300005347 Bacteria 4076
28 Ga0070669_100013735 3300005353 Bacteria 5756
29 Ga0070669_100034797 3300005353 Bacteria 3647
30 Ga0070671_100006435 3300005355 Bacteria 9385
31 Ga0070671_100295548 3300005355 Bacteria 1379
32 Ga0070659_100000056 3300005366 Bacteria 88478
33 Ga0070667_100013949 3300005367 Bacteria 6642
34 Ga0070663_100250009 3300005455 Bacteria 1403
35 Ga0070681_10002800 3300005458 Bacteria 16108
36 Ga0070681_10042677 3300005458 Bacteria 4544
37 Ga0070679_100027489 3300005530 Bacteria 5600
38 Ga0070679_100127610 3300005530 Bacteria 2525
39 Ga0070684_100382903 3300005535 Bacteria 1296
40 Ga0068853_100187161 3300005539 Bacteria 1880
41 Ga0068853_100463504 3300005539 Bacteria 1193
42 Ga0068853_100548954 3300005539 Bacteria 1094
43 Ga0070665_100000015 3300005548 Bacteria 462744
44 Ga0070665_100095623 3300005548 Bacteria 2976
45 Ga0070665_100100744 3300005548 Bacteria 2893
46 Ga0070665_100128582 3300005548 Bacteria 2536
47 Ga0068855_100009540 3300005563 Bacteria 11722
48 Ga0068855_100069735 3300005563 Bacteria 4091
49 Ga0068855_100233827 3300005563 Bacteria 2056
50 Ga0068855_100460990 3300005563 Bacteria 1386
51 Ga0070664_100410712 3300005564 Bacteria 1239
52 Ga0068857_100055964 3300005577 Bacteria 3500
53 Ga0068854_100168332 3300005578 Bacteria 1703
54 Ga0068856_100241715 3300005614 Bacteria 1821
55 Ga0068859_100000231 3300005617 Bacteria 55036
56 Ga0068859_100005468 3300005617 Bacteria 12925
57 Ga0068864_100001808 3300005618 Bacteria 17540
58 Ga0068864_100121896 3300005618 Bacteria 2332
59 Ga0068864_100217435 3300005618 Bacteria 1762
60 Ga0068863_100008609 3300005841 Bacteria 9972
61 Ga0068863_100047779 3300005841 Bacteria 4059
62 Ga0068858_100000040 3300005842 Bacteria 135911
63 Ga0068858_100009864 3300005842 Bacteria 9074
64 Ga0068858_100356356 3300005842 Bacteria 1402
65 Ga0068860_100000158 3300005843 Bacteria 110478
66 Ga0068860_100004249 3300005843 Bacteria 14669
67 Ga0068862_100011657 3300005844 Bacteria 7253
68 Ga0068862_100029794 3300005844 Bacteria 4599
69 Ga0068862_100124611 3300005844 Bacteria 2274
70 Ga0070717_10083472 3300006028 Bacteria 2687
71 Ga0075365_10224297 3300006038 Bacteria 1319
72 Ga0075368_10000491 3300006042 Bacteria 11705
73 Ga0075363_100140727 3300006048 Bacteria 1358
74 Ga0075364_10000426 3300006051 Bacteria 21063
75 Ga0075362_10005305 3300006177 Bacteria 4707
76 Ga0075367_10001318 3300006178 Bacteria 10522
77 Ga0075366_10009287 3300006195 Bacteria 5492
78 Ga0068871_100504519 3300006358 Bacteria 1091
79 Ga0068865_100009867 3300006881 Bacteria 5931
80 Ga0097620_100000231 3300006931 Bacteria 55036
81 Ga0097620_100005468 3300006931 Bacteria 12925
82 Ga0105240_10019715 3300009093 Bacteria 9007
83 Ga0105240_10041543 3300009093 Bacteria 5869
84 Ga0105240_10046025 3300009093 Bacteria 5531
85 Ga0105240_10057509 3300009093 Bacteria 4858
86 Ga0105240_10159347 3300009093 Bacteria 2682
87 Ga0105241_10088039 3300009174 Bacteria 2445
88 Ga0105242_10340040 3300009176 Bacteria 1383
89 Ga0105248_10000712 3300009177 Bacteria 37675
90 Ga0105248_10005819 3300009177 Bacteria 13549
91 Ga0105248_10094591 3300009177 Bacteria 3364
92 Ga0105248_10421194 3300009177 Bacteria 1504
93 Ga0105248_10512914 3300009177 Bacteria 1352
94 Ga0105237_10179447 3300009545 Bacteria 2118
95 Ga0105237_10222907 3300009545 Bacteria 1886
96 Ga0105237_10375527 3300009545 Bacteria 1426
97 Ga0105238_10021679 3300009551 Bacteria 6545
98 Ga0105238_10138424 3300009551 Bacteria 2412
99 Ga0105238_10177085 3300009551 Bacteria 2109
100 Ga0105238_10184173 3300009551 Bacteria 2065
101 Ga0105238_10528779 3300009551 Bacteria 1182
102 Ga0105238_10546881 3300009551 Bacteria 1162
103 Ga0105239_10048145 3300010375 Bacteria 4674
104 Ga0105239_10310094 3300010375 Bacteria 1778
105 Ga0105239_10550057 3300010375 Bacteria 1314
106 Ga0157370_10151155 3300013104 Bacteria 2160
107 Ga0163162_10061065 3300013306 Bacteria 3807
108 Ga0157372_10572558 3300013307 Bacteria 1316
109 Ga0157375_10588740 3300013308 Bacteria 1272
110 Ga0157375_10661117 3300013308 Bacteria 1201
111 Ga0163163_10002659 3300014325 Bacteria 15121
112 Ga0163163_10026223 3300014325 Bacteria 5568
113 Ga0163163_10305798 3300014325 Bacteria 1642
114 Ga0157379_10001045 3300014968 Bacteria 22478
115 Ga0157379_10036416 3300014968 Bacteria 4388
116 Ga0157376_10347010 3300014969 Bacteria 1419
117 Ga0213876_10000232 3300021384 Bacteria 54674
118 Ga0209148_1011225 3300025254 Bacteria 1670
119 Ga0209148_1012073 3300025254 Bacteria 1588
120 Ga0209565_1000652 3300025263 Bacteria 22290
121 Ga0209673_1000712 3300025273 Bacteria 46760
122 Ga0209675_1008279 3300025291 Bacteria 3846
123 Ga0209564_1028229 3300025295 Bacteria 1800
124 Ga0209758_1001434 3300025297 Bacteria 28162
125 Ga0209758_1001844 3300025297 Bacteria 23263
126 Ga0209758_1002481 3300025297 Bacteria 18757
127 Ga0209050_1000034 3300025298 Bacteria 433906
128 Ga0209050_1021575 3300025298 Bacteria 2342
129 Ga0209256_1009800 3300025299 Bacteria 4127
130 Ga0209257_1000052 3300025304 Bacteria 430947
131 Ga0209257_1000187 3300025304 Bacteria 154077
132 Ga0209257_1001208 3300025304 Bacteria 32440
133 Ga0207680_10095966 3300025903 Bacteria 1896
134 Ga0207705_10000362 3300025909 Bacteria 41196
135 Ga0207705_10166296 3300025909 Bacteria 1659
136 Ga0207654_10348110 3300025911 Bacteria 1020
137 Ga0207707_10027805 3300025912 Bacteria 4944
138 Ga0207707_10047699 3300025912 Bacteria 3730
139 Ga0207695_10000695 3300025913 Bacteria 65865
140 Ga0207695_10012458 3300025913 Bacteria 10210
141 Ga0207695_10074380 3300025913 Bacteria 3459
142 Ga0207695_10178614 3300025913 Bacteria 2044
143 Ga0207695_10269962 3300025913 Bacteria 1597
144 Ga0207660_10012096 3300025917 Bacteria 5641
145 Ga0207657_10000944 3300025919 Bacteria 30787
146 Ga0207657_10063656 3300025919 Bacteria 3152
147 Ga0207649_10127045 3300025920 Bacteria 1727
148 Ga0207652_10007594 3300025921 Bacteria 8731
149 Ga0207681_10118805 3300025923 Bacteria 1935
150 Ga0207694_10084403 3300025924 Bacteria 2498
151 Ga0207694_10086959 3300025924 Bacteria 2461
152 Ga0207694_10318795 3300025924 Bacteria 1282
153 Ga0207650_10014777 3300025925 Bacteria 5429
154 Ga0207650_10073159 3300025925 Bacteria 2581
155 Ga0207650_10098662 3300025925 Bacteria 2245
156 Ga0207687_10135881 3300025927 Bacteria 1859
157 Ga0207644_10001954 3300025931 Bacteria 13356
158 Ga0207644_10047993 3300025931 Bacteria 3050
159 Ga0207644_10269668 3300025931 Bacteria 1363
160 Ga0207644_10350612 3300025931 Bacteria 1198
161 Ga0207690_10003188 3300025932 Bacteria 9842
162 Ga0207690_10087495 3300025932 Bacteria 2192
163 Ga0207706_10097242 3300025933 Bacteria 2589
164 Ga0207704_10001569 3300025938 Bacteria 10248
165 Ga0207711_10003534 3300025941 Bacteria 13532
166 Ga0207711_10005676 3300025941 Bacteria 10542
167 Ga0207711_10085827 3300025941 Bacteria 2759
168 Ga0207711_10250286 3300025941 Bacteria 1627
169 Ga0207667_10045864 3300025949 Bacteria 4628
170 Ga0207667_10047562 3300025949 Bacteria 4540
171 Ga0207667_10117473 3300025949 Bacteria 2741
172 Ga0207668_10006788 3300025972 Bacteria 6778
173 Ga0207668_10007383 3300025972 Bacteria 6534
174 Ga0207668_10074249 3300025972 Bacteria 2440
175 Ga0207658_10386693 3300025986 Bacteria 1227
176 Ga0207703_10000279 3300026035 Bacteria 56629
177 Ga0207703_10001898 3300026035 Bacteria 18517
178 Ga0207639_10124619 3300026041 Bacteria 2122
179 Ga0207639_10168637 3300026041 Bacteria 1852
180 Ga0207639_10266331 3300026041 Bacteria 1501
181 Ga0207639_10450235 3300026041 Bacteria 1169
182 Ga0207702_10497116 3300026078 Bacteria 1188
183 Ga0207641_10017738 3300026088 Bacteria 5831
184 Ga0207641_10041907 3300026088 Bacteria 3839
185 Ga0207641_10174187 3300026088 Bacteria 1966
186 Ga0207676_10216307 3300026095 Bacteria 1703
187 Ga0207674_10139767 3300026116 Bacteria 2382
188 Ga0207675_100010978 3300026118 Bacteria 8486
189 Ga0268266_10000005 3300028379 Bacteria 1448194
190 Ga0268266_10070149 3300028379 Bacteria 3037
191 Ga0268266_10125670 3300028379 Bacteria 2288
192 Ga0268265_10004739 3300028380 Bacteria 9381
193 Ga0268264_10000029 3300028381 Bacteria 419246
194 Ga0268264_10031796 3300028381 Bacteria 4328
195 Ga0268264_10034874 3300028381 Bacteria 4141
196 Ga0307517_10062694 3300028786 Bacteria 3491
197 Ga0307517_10070347 3300028786 Bacteria 3154
198 Ga0307515_10028870 3300028794 Bacteria 9407
199 Ga0307511_10027432 3300030521 Bacteria 5203
200 Ga0265327_10005776 3300031251 Bacteria 10186
201 Ga0307513_10004531 3300031456 Bacteria 18528
202 Ga0307513_10024412 3300031456 Bacteria 7033
203 Ga0307408_100143159 3300031548 Bacteria 1879
204 Ga0265342_10156530 3300031712 Bacteria 1262
205 Ga0307413_10194016 3300031824 Bacteria 1460
206 Ga0307414_10248686 3300032004 Bacteria 1476
207 Ga0307411_10592111 3300032005 Bacteria 952
208 Ga0307510_10025367 3300033180 Bacteria 6836
209 Ga0373940_0026687 3300035088 Bacteria 1513
210 Ga0373944_0025752 3300035089 Bacteria 1734
211 Ga0373927_0000767 3300035695 Bacteria 24571
212 Ga0373925_0000222 3300037068 Bacteria 60920
213 Ga0373925_0073838 3300037068 Bacteria 2582
214 Ga0373925_0181159 3300037068 Bacteria 1668
215 Ga0395899_0000197 3300037312 Bacteria 88596
216 Ga0395900_0000006 3300037418 Bacteria 495364
217 Ga0395898_0060850 3300037466 Bacteria 3668
218 Ga0395898_0099993 3300037466 Bacteria 2785
219 Ga0395905_0018884 3300037471 Bacteria 6538
220 Ga0395905_0334036 3300037471 Bacteria 1406
221 Ga0395905_0805947 3300037471 Bacteria 842
222 Ga0395905_0847079 3300037471 Bacteria 817
223 Ga0395901_0000001 3300038443 Bacteria 800383
224 Ga0436365_0577642 3300039437 Bacteria 77516
225 Ga0436365_0654970 3300039437 Bacteria 1688
226 Ga0436363_0115372 3300039450 Bacteria 2980
227 Ga0451847_0980637 3300041503 Bacteria 891
228 Ga0439431_0054658 3300041997 Bacteria 1042
229 Ga0450916_012500 3300042530 Bacteria 1084
230 Ga0466957_0153759 3300044842 Bacteria 1490
231 Ga0495617_040443 3300046452 Bacteria 1559
232 Ga0495627_000187 3300046453 Bacteria 69012
233 Ga0495629_0023611 3300046459 Bacteria 4381
234 Ga0495638_0001443 3300046460 Bacteria 21511
235 Ga0495638_0001602 3300046460 Bacteria 20202
236 Ga0495638_0033834 3300046460 Bacteria 3265
237 Ga0495638_0146157 3300046460 Bacteria 1375
238 Ga0495650_0000030 3300046471 Bacteria 436318
239 Ga0495596_0123437 3300046500 Bacteria 1005
240 Ga0495607_0086694 3300046501 Bacteria 1706
241 Ga0495583_0000002 3300046506 Bacteria 782521
242 Ga0495583_0037107 3300046506 Bacteria 2313
243 Ga0495606_0015238 3300046507 Bacteria 5935
244 Ga0495610_0002162 3300046512 Bacteria 16715
245 Ga0495616_0000366 3300046513 Bacteria 35310
246 Ga0495616_0056415 3300046513 Bacteria 1940
247 Ga0495620_0028824 3300046515 Bacteria 2577
248 Ga0495620_0063533 3300046515 Bacteria 1530
249 Ga0495631_0080346 3300046518 Bacteria 1407
250 Ga0495632_0145043 3300046519 Bacteria 1099
251 Ga0495637_0006645 3300046520 Bacteria 5789
252 Ga0495643_0011937 3300046522 Bacteria 5261
253 Ga0495643_0193627 3300046522 Bacteria 980
254 Ga0495648_0112533 3300046524 Bacteria 1478
255 Ga0495663_0007562 3300046525 Bacteria 3007
256 Ga0495654_0000048 3300046530 Bacteria 147348
257 Ga0495654_0015841 3300046530 Bacteria 3997
258 Ga0495597_0044991 3300046542 Bacteria 1961
259 Ga0495622_0003047 3300046557 Bacteria 7953
260 Ga0495668_0007252 3300046616 Bacteria 7114
261 Ga0495668_0077649 3300046616 Bacteria 1823
262 Ga0495668_0104257 3300046616 Bacteria 1551
263 Ga0495625_0000058 3300046660 Bacteria 180863
264 Ga0495625_0000505 3300046660 Bacteria 57930
265 Ga0495625_0100463 3300046660 Bacteria 1988
266 Ga0495625_0164542 3300046660 Bacteria 1484
267 Ga0495625_0269386 3300046660 Bacteria 1099
268 Ga0495625_0334773 3300046660 Bacteria 960
269 Ga0495669_0116470 3300046684 Bacteria 1250
270 Ga0495669_0236555 3300046684 Bacteria 876
271 Ga0495670_0172357 3300046691 Bacteria 1140
272 Ga0495589_0004949 3300046794 Bacteria 7058
273 Ga0495660_0053994 3300046810 Bacteria 2178
274 Ga0495672_0001285 3300047320 Bacteria 25031
275 Ga0495672_0019756 3300047320 Bacteria 4437
276 Ga0495679_007975 3300047446 Bacteria 4354
277 Ga0495673_0000163 3300047469 Bacteria 114230
278 Ga0495673_0002555 3300047469 Bacteria 12662
279 Ga0495681_0053861 3300047470 Bacteria 1882
280 Ga0495593_0010488 3300047673 Bacteria 5349
281 Ga0495602_0128157 3300048088 Bacteria 2029
282 Ga0496101_0086080 3300048904 Bacteria 2330
283 Ga0496102_0246006 3300048905 Bacteria 1686
284 Ga0496106_0033121 3300048909 Bacteria 3854
285 Ga0496107_0000137 3300048910 Bacteria 36013
286 Ga0496108_0385533 3300048911 Bacteria 1224
287 Ga0496109_0275653 3300048912 Bacteria 1585
288 Ga0496110_0349546 3300048913 Bacteria 1347
289 Ga0496114_0094011 3300048917 Bacteria 2550
290 Ga0496116_0148083 3300048919 Bacteria 1309
291 Ga0496117_0019610 3300048920 Bacteria 5546
292 Ga0496118_0017717 3300048921 Bacteria 6466
293 Ga0496119_0125177 3300048922 Bacteria 1407
294 Ga0496121_0000130 3300048924 Bacteria 168094
295 Ga0496121_0094222 3300048924 Bacteria 2330
296 Ga0496124_0074953 3300048927 Bacteria 2796
297 Ga0496125_0046054 3300048928 Bacteria 3664
298 Ga0496125_0152144 3300048928 Bacteria 1587
299 Ga0496126_0023914 3300048929 Bacteria 5908
300 Ga0501031_0364638 3300049568 Bacteria 935
301 Ga0501032_0105724 3300049569 Bacteria 1864
302 Ga0501043_0481486 3300049579 Bacteria 929
303 Ga0501238_003053 3300049671 Bacteria 2044
304 Ga0501035_0152724 3300049822 Bacteria 2003
305 Ga0501044_0001036 3300049823 Bacteria 33479
306 nmdc:mga03n38_204850_c1 3300050490 Bacteria 1023
307 nmdc:mga00v17_5454_c1 3300050491 Bacteria 6698
308 nmdc:mga0yw44_155120_c1 3300050492 Bacteria 1496
309 nmdc:mga0k408_226216_c1 3300050493 Bacteria 1117
310 nmdc:mga0k408_32680_c1 3300050493 Bacteria 2004
311 nmdc:mga06z11_6179_c1 3300050494 Bacteria 4854
312 nmdc:mga04h51_30952_c1 3300050495 Bacteria 1688
313 Ga0500635_0000120 3300053080 Bacteria 46183
314 Ga0500651_0014360 3300053093 Bacteria 4845
315 Ga0500566_0035052 3300053094 Bacteria 2917
316 Ga0500641_0026119 3300053096 Bacteria 2265
317 Ga0500650_0037858 3300053098 Bacteria 2218
318 Ga0500554_024925 3300053102 Bacteria 1700
319 Ga0500555_004101 3300053103 Bacteria 4143
320 Ga0500556_0004663 3300053104 Bacteria 3891
321 Ga0500556_0008685 3300053104 Bacteria 2936
322 Ga0500556_0082462 3300053104 Bacteria 1217
323 Ga0500562_000718 3300053108 Bacteria 8030
324 Ga0500569_015904 3300053109 Bacteria 1894
325 Ga0500572_002922 3300053111 Bacteria 4004
326 Ga0500595_003139 3300053119 Bacteria 7834
327 Ga0500595_053103 3300053119 Bacteria 1249
328 Ga0500607_101039 3300053121 Bacteria 1432
329 Ga0500608_037762 3300053122 Bacteria 2308
330 Ga0500614_008279 3300053123 Bacteria 2204
331 Ga0500618_000473 3300053125 Bacteria 26049
332 Ga0500642_0020504 3300053130 Bacteria 2600
333 Ga0500658_0003711 3300053134 Bacteria 5752
334 Ga0500658_0079929 3300053134 Bacteria 1396
335 Ga0500559_0000003 3300053136 Bacteria 252693
336 Ga0500559_0004254 3300053136 Bacteria 6846
337 Ga0500564_083423 3300053138 Bacteria 1430
338 Ga0500577_0000783 3300053142 Bacteria 8190
339 Ga0500590_007627 3300053148 Bacteria 5361
340 Ga0500590_084502 3300053148 Bacteria 1553
341 Ga0500616_0018310 3300053153 Bacteria 3962
342 Ga0500622_0017552 3300053156 Bacteria 3809
343 Ga0500634_0107503 3300053161 Bacteria 1384
344 Ga0500638_072118 3300053162 Bacteria 1650
345 Ga0500637_0071316 3300053178 Bacteria 1998
346 Ga0500637_0093289 3300053178 Bacteria 1744
347 Ga0500611_009887 3300053727 Bacteria 1527
348 Ga0500645_001471 3300053730 Bacteria 11841
349 Ga0500645_006700 3300053730 Bacteria 4085
350 Ga0500656_007443 3300053732 Bacteria 1139
351 Ga0500596_001418 3300053735 Bacteria 4840
352 Ga0500601_002442 3300053737 Bacteria 1995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0481486 Ga0501043_0481486_321_911 196
2 3300005335 Ga0070666_10175615 Ga0070666_101756152 224
3 3300005618 Ga0068864_100217435 Ga0068864_1002174352 224
4 3300026095 Ga0207676_10216307 Ga0207676_102163072 224
5 3300005842 Ga0068858_100356356 Ga0068858_1003563562 225
6 3300037471 Ga0395905_0847079 Ga0395905_0847079_121_804 227
7 3300048928 Ga0496125_0046054 Ga0496125_0046054_2369_3106 227
8 3300048928 Ga0496125_0152144 Ga0496125_0152144_576_1313 227
9 3300005563 Ga0068855_100069735 Ga0068855_1000697352 228
10 3300005564 Ga0070664_100410712 Ga0070664_1004107122 228
11 3300005614 Ga0068856_100241715 Ga0068856_1002417152 228
12 3300025949 Ga0207667_10045864 Ga0207667_100458645 228
13 3300031712 Ga0265342_10156530 Ga0265342_101565302 228
14 3300044842 Ga0466957_0153759 Ga0466957_0153759_526_1263 229
15 3300005548 Ga0070665_100000015 Ga0070665_100000015273 231
16 3300009551 Ga0105238_10528779 Ga0105238_105287791 231
17 3300028379 Ga0268266_10000005 Ga0268266_10000005845 231
18 3300031251 Ga0265327_10005776 Ga0265327_100057769 231
19 3300035089 Ga0373944_0025752 Ga0373944_0025752_947_1684 232
20 3300035695 Ga0373927_0000767 Ga0373927_0000767_9570_10307 232
21 3300037068 Ga0373925_0000222 Ga0373925_0000222_50849_51586 232
22 3300003773 Ga0055537_1001254 Ga0055537_10012546 233
23 3300003775 Ga0055524_1019520 Ga0055524_10195203 233
24 3300003775 Ga0055524_1019696 Ga0055524_10196962 233
25 3300003790 Ga0055528_1008387 Ga0055528_10083874 233
26 3300005327 Ga0070658_10045901 Ga0070658_100459013 233
27 3300005539 Ga0068853_100463504 Ga0068853_1004635041 233
28 3300013307 Ga0157372_10572558 Ga0157372_105725582 233
29 3300046519 Ga0495632_0145043 Ga0495632_0145043_31_732 233
30 3300053119 Ga0500595_053103 Ga0500595_053103_36_737 233
31 3300048917 Ga0496114_0094011 Ga0496114_0094011_1581_2318 234
32 3300048927 Ga0496124_0074953 Ga0496124_0074953_539_1276 234
33 3300048929 Ga0496126_0023914 Ga0496126_0023914_113_850 234
34 3300033180 Ga0307510_10025367 Ga0307510_100253674 235
35 3300037471 Ga0395905_0805947 Ga0395905_0805947_32_769 238
36 3300005327 Ga0070658_10221577 Ga0070658_102215772 239
37 3300005548 Ga0070665_100128582 Ga0070665_1001285822 239
38 3300006881 Ga0068865_100009867 Ga0068865_1000098676 239
39 3300013308 Ga0157375_10588740 Ga0157375_105887402 239
40 3300014325 Ga0163163_10305798 Ga0163163_103057982 239
41 3300025909 Ga0207705_10166296 Ga0207705_101662962 239
42 3300025938 Ga0207704_10001569 Ga0207704_100015696 239
43 3300028379 Ga0268266_10125670 Ga0268266_101256701 239
44 iso_pu_bacteria 2510917020 2511120529 241
45 iso_pu_bacteria 2582581280 2585151348 241
46 iso_pu_bacteria 2582581293 2585196061 241
47 iso_pu_bacteria 2643221552 2643782632 241
48 iso_pu_bacteria 2643221583 2643925880 241
49 iso_pu_bacteria 2643221584 2643928843 241
50 iso_pu_bacteria 2643221598 2643999848 241
51 iso_pu_bacteria 2818991435 2819537066 241
52 iso_pu_bacteria 2818991454 2819645478 241
53 3300003791 Ga0055530_10007468 Ga0055530_100074685 244
54 3300003794 Ga0055531_10002133 Ga0055531_100021333 244
55 3300005262 Ga0065165_1000041 Ga0065165_1000041145 244
56 3300005335 Ga0070666_10099614 Ga0070666_100996143 244
57 3300005844 Ga0068862_100029794 Ga0068862_1000297941 244
58 3300009093 Ga0105240_10046025 Ga0105240_100460255 244
59 3300009177 Ga0105248_10421194 Ga0105248_104211942 244
60 3300009551 Ga0105238_10184173 Ga0105238_101841732 244
61 3300010375 Ga0105239_10550057 Ga0105239_105500572 244
62 3300021384 Ga0213876_10000232 Ga0213876_1000023258 244
63 3300025297 Ga0209758_1001844 Ga0209758_100184423 244
64 3300025298 Ga0209050_1000034 Ga0209050_1000034351 244
65 3300025304 Ga0209257_1000052 Ga0209257_100005259 244
66 3300025903 Ga0207680_10095966 Ga0207680_100959661 244
67 3300025913 Ga0207695_10012458 Ga0207695_100124585 244
68 3300025924 Ga0207694_10318795 Ga0207694_103187951 244
69 3300025941 Ga0207711_10250286 Ga0207711_102502862 244
70 3300039437 Ga0436365_0577642 Ga0436365_0577642_2629_3363 244
71 3300039450 Ga0436363_0115372 Ga0436363_0115372_930_1664 244
72 3300049671 Ga0501238_003053 Ga0501238_003053_861_1595 244
73 3300053111 Ga0500572_002922 Ga0500572_002922_2592_3338 244
74 3300053148 Ga0500590_084502 Ga0500590_084502_99_845 244
75 3300003316 rootH1_10084964 rootH1_100849642 245
76 3300003794 Ga0055531_10000761 Ga0055531_1000076111 245
77 3300005262 Ga0065165_1000624 Ga0065165_100062423 245
78 3300005327 Ga0070658_10036705 Ga0070658_100367052 245
79 3300005327 Ga0070658_10267313 Ga0070658_102673132 245
80 3300005331 Ga0070670_100010197 Ga0070670_1000101972 245
81 3300005331 Ga0070670_100139534 Ga0070670_1001395343 245
82 3300005336 Ga0070680_100004477 Ga0070680_1000044774 245
83 3300005339 Ga0070660_100073331 Ga0070660_1000733313 245
84 3300005339 Ga0070660_100112999 Ga0070660_1001129991 245
85 3300005341 Ga0070691_10004455 Ga0070691_100044555 245
86 3300005344 Ga0070661_100184277 Ga0070661_1001842772 245
87 3300005347 Ga0070668_100000354 Ga0070668_10000035432 245
88 3300005347 Ga0070668_100002972 Ga0070668_1000029727 245
89 3300005347 Ga0070668_100010666 Ga0070668_1000106666 245
90 3300005347 Ga0070668_100030889 Ga0070668_1000308891 245
91 3300005353 Ga0070669_100013735 Ga0070669_1000137353 245
92 3300005353 Ga0070669_100034797 Ga0070669_1000347973 245
93 3300005355 Ga0070671_100006435 Ga0070671_1000064356 245
94 3300005355 Ga0070671_100295548 Ga0070671_1002955482 245
95 3300005366 Ga0070659_100000056 Ga0070659_10000005644 245
96 3300005367 Ga0070667_100013949 Ga0070667_1000139496 245
97 3300005455 Ga0070663_100250009 Ga0070663_1002500092 245
98 3300005458 Ga0070681_10002800 Ga0070681_1000280016 245
99 3300005458 Ga0070681_10042677 Ga0070681_100426774 245
100 3300005530 Ga0070679_100027489 Ga0070679_1000274895 245
101 3300005530 Ga0070679_100127610 Ga0070679_1001276103 245
102 3300005535 Ga0070684_100382903 Ga0070684_1003829032 245
103 3300005539 Ga0068853_100187161 Ga0068853_1001871612 245
104 3300005539 Ga0068853_100548954 Ga0068853_1005489541 245
105 3300005548 Ga0070665_100095623 Ga0070665_1000956232 245
106 3300005548 Ga0070665_100100744 Ga0070665_1001007444 245
107 3300005563 Ga0068855_100009540 Ga0068855_1000095403 245
108 3300005563 Ga0068855_100233827 Ga0068855_1002338272 245
109 3300005563 Ga0068855_100460990 Ga0068855_1004609902 245
110 3300005577 Ga0068857_100055964 Ga0068857_1000559643 245
111 3300005578 Ga0068854_100168332 Ga0068854_1001683322 245
112 3300005617 Ga0068859_100000231 Ga0068859_10000023150 245
113 3300005617 Ga0068859_100005468 Ga0068859_10000546812 245
114 3300005618 Ga0068864_100001808 Ga0068864_10000180817 245
115 3300005618 Ga0068864_100121896 Ga0068864_1001218962 245
116 3300005841 Ga0068863_100008609 Ga0068863_1000086096 245
117 3300005841 Ga0068863_100047779 Ga0068863_1000477794 245
118 3300005842 Ga0068858_100000040 Ga0068858_10000004056 245
119 3300005842 Ga0068858_100009864 Ga0068858_1000098646 245
120 3300005843 Ga0068860_100000158 Ga0068860_10000015847 245
121 3300005843 Ga0068860_100004249 Ga0068860_10000424917 245
122 3300005844 Ga0068862_100011657 Ga0068862_1000116573 245
123 3300005844 Ga0068862_100124611 Ga0068862_1001246112 245
124 3300006028 Ga0070717_10083472 Ga0070717_100834722 245
125 3300006038 Ga0075365_10224297 Ga0075365_102242971 245
126 3300006042 Ga0075368_10000491 Ga0075368_100004916 245
127 3300006048 Ga0075363_100140727 Ga0075363_1001407272 245
128 3300006051 Ga0075364_10000426 Ga0075364_1000042612 245
129 3300006177 Ga0075362_10005305 Ga0075362_100053052 245
130 3300006178 Ga0075367_10001318 Ga0075367_1000131810 245
131 3300006195 Ga0075366_10009287 Ga0075366_100092876 245
132 3300006358 Ga0068871_100504519 Ga0068871_1005045192 245
133 3300006931 Ga0097620_100000231 Ga0097620_10000023150 245
134 3300006931 Ga0097620_100005468 Ga0097620_10000546812 245
135 3300009093 Ga0105240_10019715 Ga0105240_100197152 245
136 3300009093 Ga0105240_10041543 Ga0105240_100415435 245
137 3300009093 Ga0105240_10057509 Ga0105240_100575093 245
138 3300009093 Ga0105240_10159347 Ga0105240_101593472 245
139 3300009174 Ga0105241_10088039 Ga0105241_100880393 245
140 3300009176 Ga0105242_10340040 Ga0105242_103400402 245
141 3300009177 Ga0105248_10000712 Ga0105248_1000071221 245
142 3300009177 Ga0105248_10005819 Ga0105248_100058196 245
143 3300009177 Ga0105248_10094591 Ga0105248_100945913 245
144 3300009177 Ga0105248_10512914 Ga0105248_105129142 245
145 3300009545 Ga0105237_10179447 Ga0105237_101794472 245
146 3300009545 Ga0105237_10222907 Ga0105237_102229072 245
147 3300009545 Ga0105237_10375527 Ga0105237_103755272 245
148 3300009551 Ga0105238_10021679 Ga0105238_100216793 245
149 3300009551 Ga0105238_10138424 Ga0105238_101384242 245
150 3300009551 Ga0105238_10177085 Ga0105238_101770853 245
151 3300009551 Ga0105238_10546881 Ga0105238_105468812 245
152 3300010375 Ga0105239_10048145 Ga0105239_100481453 245
153 3300010375 Ga0105239_10310094 Ga0105239_103100941 245
154 3300013104 Ga0157370_10151155 Ga0157370_101511552 245
155 3300013306 Ga0163162_10061065 Ga0163162_100610653 245
156 3300013308 Ga0157375_10661117 Ga0157375_106611171 245
157 3300014325 Ga0163163_10002659 Ga0163163_100026592 245
158 3300014325 Ga0163163_10026223 Ga0163163_100262236 245
159 3300014968 Ga0157379_10001045 Ga0157379_100010454 245
160 3300014968 Ga0157379_10036416 Ga0157379_100364163 245
161 3300014969 Ga0157376_10347010 Ga0157376_103470102 245
162 3300025254 Ga0209148_1011225 Ga0209148_10112252 245
163 3300025254 Ga0209148_1012073 Ga0209148_10120732 245
164 3300025263 Ga0209565_1000652 Ga0209565_100065214 245
165 3300025273 Ga0209673_1000712 Ga0209673_100071231 245
166 3300025291 Ga0209675_1008279 Ga0209675_10082794 245
167 3300025295 Ga0209564_1028229 Ga0209564_10282292 245
168 3300025297 Ga0209758_1001434 Ga0209758_100143430 245
169 3300025297 Ga0209758_1002481 Ga0209758_10024813 245
170 3300025298 Ga0209050_1021575 Ga0209050_10215752 245
171 3300025299 Ga0209256_1009800 Ga0209256_10098003 245
172 3300025304 Ga0209257_1000187 Ga0209257_1000187125 245
173 3300025304 Ga0209257_1001208 Ga0209257_10012086 245
174 3300025909 Ga0207705_10000362 Ga0207705_1000036215 245
175 3300025911 Ga0207654_10348110 Ga0207654_103481101 245
176 3300025912 Ga0207707_10027805 Ga0207707_100278055 245
177 3300025912 Ga0207707_10047699 Ga0207707_100476993 245
178 3300025913 Ga0207695_10000695 Ga0207695_1000069534 245
179 3300025913 Ga0207695_10074380 Ga0207695_100743804 245
180 3300025913 Ga0207695_10178614 Ga0207695_101786142 245
181 3300025913 Ga0207695_10269962 Ga0207695_102699622 245
182 3300025917 Ga0207660_10012096 Ga0207660_100120965 245
183 3300025919 Ga0207657_10000944 Ga0207657_1000094414 245
184 3300025919 Ga0207657_10063656 Ga0207657_100636564 245
185 3300025920 Ga0207649_10127045 Ga0207649_101270452 245
186 3300025921 Ga0207652_10007594 Ga0207652_100075947 245
187 3300025923 Ga0207681_10118805 Ga0207681_101188052 245
188 3300025924 Ga0207694_10084403 Ga0207694_100844032 245
189 3300025924 Ga0207694_10086959 Ga0207694_100869592 245
190 3300025925 Ga0207650_10014777 Ga0207650_100147777 245
191 3300025925 Ga0207650_10073159 Ga0207650_100731592 245
192 3300025925 Ga0207650_10098662 Ga0207650_100986622 245
193 3300025927 Ga0207687_10135881 Ga0207687_101358813 245
194 3300025931 Ga0207644_10001954 Ga0207644_100019544 245
195 3300025931 Ga0207644_10047993 Ga0207644_100479931 245
196 3300025931 Ga0207644_10269668 Ga0207644_102696682 245
197 3300025931 Ga0207644_10350612 Ga0207644_103506121 245
198 3300025932 Ga0207690_10003188 Ga0207690_100031886 245
199 3300025932 Ga0207690_10087495 Ga0207690_100874951 245
200 3300025933 Ga0207706_10097242 Ga0207706_100972422 245
201 3300025941 Ga0207711_10003534 Ga0207711_1000353415 245
202 3300025941 Ga0207711_10005676 Ga0207711_100056767 245
203 3300025941 Ga0207711_10085827 Ga0207711_100858273 245
204 3300025949 Ga0207667_10047562 Ga0207667_100475623 245
205 3300025949 Ga0207667_10117473 Ga0207667_101174733 245
206 3300025972 Ga0207668_10006788 Ga0207668_100067883 245
207 3300025972 Ga0207668_10007383 Ga0207668_100073836 245
208 3300025972 Ga0207668_10074249 Ga0207668_100742492 245
209 3300025986 Ga0207658_10386693 Ga0207658_103866931 245
210 3300026035 Ga0207703_10000279 Ga0207703_1000027921 245
211 3300026035 Ga0207703_10001898 Ga0207703_100018989 245
212 3300026041 Ga0207639_10124619 Ga0207639_101246192 245
213 3300026041 Ga0207639_10168637 Ga0207639_101686372 245
214 3300026041 Ga0207639_10266331 Ga0207639_102663312 245
215 3300026041 Ga0207639_10450235 Ga0207639_104502351 245
216 3300026078 Ga0207702_10497116 Ga0207702_104971162 245
217 3300026088 Ga0207641_10017738 Ga0207641_100177384 245
218 3300026088 Ga0207641_10041907 Ga0207641_100419074 245
219 3300026088 Ga0207641_10174187 Ga0207641_101741872 245
220 3300026116 Ga0207674_10139767 Ga0207674_101397673 245
221 3300026118 Ga0207675_100010978 Ga0207675_1000109785 245
222 3300028379 Ga0268266_10070149 Ga0268266_100701494 245
223 3300028380 Ga0268265_10004739 Ga0268265_100047392 245
224 3300028381 Ga0268264_10000029 Ga0268264_10000029245 245
225 3300028381 Ga0268264_10031796 Ga0268264_100317962 245
226 3300028381 Ga0268264_10034874 Ga0268264_100348742 245
227 3300028786 Ga0307517_10062694 Ga0307517_100626943 245
228 3300028786 Ga0307517_10070347 Ga0307517_100703473 245
229 3300028794 Ga0307515_10028870 Ga0307515_100288702 245
230 3300030521 Ga0307511_10027432 Ga0307511_100274325 245
231 3300031456 Ga0307513_10004531 Ga0307513_100045319 245
232 3300031456 Ga0307513_10024412 Ga0307513_100244124 245
233 3300031548 Ga0307408_100143159 Ga0307408_1001431593 245
234 3300031824 Ga0307413_10194016 Ga0307413_101940161 245
235 3300032004 Ga0307414_10248686 Ga0307414_102486862 245
236 3300032005 Ga0307411_10592111 Ga0307411_105921111 245
237 3300035088 Ga0373940_0026687 Ga0373940_0026687_273_1010 245
238 3300037068 Ga0373925_0073838 Ga0373925_0073838_1419_2156 245
239 3300037068 Ga0373925_0181159 Ga0373925_0181159_429_1166 245
240 3300037312 Ga0395899_0000197 Ga0395899_0000197_30317_31096 245
241 3300037418 Ga0395900_0000006 Ga0395900_0000006_171593_172372 245
242 3300037466 Ga0395898_0060850 Ga0395898_0060850_868_1653 245
243 3300037466 Ga0395898_0099993 Ga0395898_0099993_1032_1769 245
244 3300037471 Ga0395905_0018884 Ga0395905_0018884_1321_2100 245
245 3300037471 Ga0395905_0334036 Ga0395905_0334036_116_853 245
246 3300038443 Ga0395901_0000001 Ga0395901_0000001_214842_215621 245
247 3300039437 Ga0436365_0654970 Ga0436365_0654970_473_1210 245
248 3300041503 Ga0451847_0980637 Ga0451847_0980637_61_798 245
249 3300041997 Ga0439431_0054658 Ga0439431_0054658_281_1018 245
250 3300042530 Ga0450916_012500 Ga0450916_012500_206_943 245
251 3300046452 Ga0495617_040443 Ga0495617_040443_555_1292 245
252 3300046453 Ga0495627_000187 Ga0495627_000187_34358_35095 245
253 3300046459 Ga0495629_0023611 Ga0495629_0023611_513_1250 245
254 3300046460 Ga0495638_0001443 Ga0495638_0001443_19606_20343 245
255 3300046460 Ga0495638_0001602 Ga0495638_0001602_3692_4429 245
256 3300046460 Ga0495638_0033834 Ga0495638_0033834_1512_2249 245
257 3300046460 Ga0495638_0146157 Ga0495638_0146157_254_991 245
258 3300046471 Ga0495650_0000030 Ga0495650_0000030_257167_257904 245
259 3300046500 Ga0495596_0123437 Ga0495596_0123437_229_966 245
260 3300046501 Ga0495607_0086694 Ga0495607_0086694_343_1080 245
261 3300046506 Ga0495583_0000002 Ga0495583_0000002_116369_117106 245
262 3300046506 Ga0495583_0037107 Ga0495583_0037107_1378_2115 245
263 3300046507 Ga0495606_0015238 Ga0495606_0015238_3795_4532 245
264 3300046512 Ga0495610_0002162 Ga0495610_0002162_4862_5599 245
265 3300046513 Ga0495616_0000366 Ga0495616_0000366_25427_26164 245
266 3300046513 Ga0495616_0056415 Ga0495616_0056415_1041_1778 245
267 3300046515 Ga0495620_0028824 Ga0495620_0028824_343_1080 245
268 3300046515 Ga0495620_0063533 Ga0495620_0063533_25_762 245
269 3300046518 Ga0495631_0080346 Ga0495631_0080346_280_1017 245
270 3300046520 Ga0495637_0006645 Ga0495637_0006645_4967_5704 245
271 3300046522 Ga0495643_0011937 Ga0495643_0011937_4143_4880 245
272 3300046522 Ga0495643_0193627 Ga0495643_0193627_35_772 245
273 3300046524 Ga0495648_0112533 Ga0495648_0112533_369_1106 245
274 3300046525 Ga0495663_0007562 Ga0495663_0007562_540_1277 245
275 3300046530 Ga0495654_0000048 Ga0495654_0000048_93952_94689 245
276 3300046530 Ga0495654_0015841 Ga0495654_0015841_2560_3297 245
277 3300046542 Ga0495597_0044991 Ga0495597_0044991_843_1580 245
278 3300046557 Ga0495622_0003047 Ga0495622_0003047_1127_1864 245
279 3300046616 Ga0495668_0007252 Ga0495668_0007252_5293_6030 245
280 3300046616 Ga0495668_0077649 Ga0495668_0077649_102_839 245
281 3300046616 Ga0495668_0104257 Ga0495668_0104257_581_1318 245
282 3300046660 Ga0495625_0000058 Ga0495625_0000058_174858_175595 245
283 3300046660 Ga0495625_0000505 Ga0495625_0000505_9661_10398 245
284 3300046660 Ga0495625_0100463 Ga0495625_0100463_1115_1852 245
285 3300046660 Ga0495625_0164542 Ga0495625_0164542_434_1171 245
286 3300046660 Ga0495625_0269386 Ga0495625_0269386_205_942 245
287 3300046660 Ga0495625_0334773 Ga0495625_0334773_87_824 245
288 3300046684 Ga0495669_0116470 Ga0495669_0116470_487_1224 245
289 3300046684 Ga0495669_0236555 Ga0495669_0236555_25_762 245
290 3300046691 Ga0495670_0172357 Ga0495670_0172357_377_1114 245
291 3300046794 Ga0495589_0004949 Ga0495589_0004949_6044_6781 245
292 3300046810 Ga0495660_0053994 Ga0495660_0053994_1061_1798 245
293 3300047320 Ga0495672_0001285 Ga0495672_0001285_18032_18769 245
294 3300047320 Ga0495672_0019756 Ga0495672_0019756_621_1358 245
295 3300047446 Ga0495679_007975 Ga0495679_007975_434_1171 245
296 3300047469 Ga0495673_0000163 Ga0495673_0000163_1066_1803 245
297 3300047469 Ga0495673_0002555 Ga0495673_0002555_10859_11596 245
298 3300047470 Ga0495681_0053861 Ga0495681_0053861_258_995 245
299 3300047673 Ga0495593_0010488 Ga0495593_0010488_1729_2466 245
300 3300048088 Ga0495602_0128157 Ga0495602_0128157_324_1061 245
301 3300048904 Ga0496101_0086080 Ga0496101_0086080_968_1705 245
302 3300048905 Ga0496102_0246006 Ga0496102_0246006_212_949 245
303 3300048909 Ga0496106_0033121 Ga0496106_0033121_1639_2376 245
304 3300048910 Ga0496107_0000137 Ga0496107_0000137_14758_15495 245
305 3300048911 Ga0496108_0385533 Ga0496108_0385533_380_1117 245
306 3300048912 Ga0496109_0275653 Ga0496109_0275653_344_1081 245
307 3300048913 Ga0496110_0349546 Ga0496110_0349546_385_1122 245
308 3300048919 Ga0496116_0148083 Ga0496116_0148083_44_781 245
309 3300048920 Ga0496117_0019610 Ga0496117_0019610_4305_5042 245
310 3300048921 Ga0496118_0017717 Ga0496118_0017717_3381_4118 245
311 3300048922 Ga0496119_0125177 Ga0496119_0125177_550_1287 245
312 3300048924 Ga0496121_0000130 Ga0496121_0000130_93812_94549 245
313 3300048924 Ga0496121_0094222 Ga0496121_0094222_164_901 245
314 3300049568 Ga0501031_0364638 Ga0501031_0364638_182_919 245
315 3300049569 Ga0501032_0105724 Ga0501032_0105724_365_1102 245
316 3300049822 Ga0501035_0152724 Ga0501035_0152724_1039_1776 245
317 3300049823 Ga0501044_0001036 Ga0501044_0001036_26047_26784 245
318 3300050490 nmdc:mga03n38_204850_c1 nmdc:mga03n38_204850_c1_114_884 245
319 3300050491 nmdc:mga00v17_5454_c1 nmdc:mga00v17_5454_c1_3319_4056 245
320 3300050492 nmdc:mga0yw44_155120_c1 nmdc:mga0yw44_155120_c1_370_1140 245
321 3300050493 nmdc:mga0k408_226216_c1 nmdc:mga0k408_226216_c1_242_979 245
322 3300050493 nmdc:mga0k408_32680_c1 nmdc:mga0k408_32680_c1_12_749 245
323 3300050494 nmdc:mga06z11_6179_c1 nmdc:mga06z11_6179_c1_1829_2566 245
324 3300050495 nmdc:mga04h51_30952_c1 nmdc:mga04h51_30952_c1_521_1258 245
325 3300053080 Ga0500635_0000120 Ga0500635_0000120_7409_8146 245
326 3300053093 Ga0500651_0014360 Ga0500651_0014360_3258_3995 245
327 3300053094 Ga0500566_0035052 Ga0500566_0035052_844_1581 245
328 3300053096 Ga0500641_0026119 Ga0500641_0026119_300_1037 245
329 3300053098 Ga0500650_0037858 Ga0500650_0037858_1317_2054 245
330 3300053102 Ga0500554_024925 Ga0500554_024925_545_1282 245
331 3300053103 Ga0500555_004101 Ga0500555_004101_1163_1900 245
332 3300053104 Ga0500556_0004663 Ga0500556_0004663_588_1325 245
333 3300053104 Ga0500556_0008685 Ga0500556_0008685_1493_2230 245
334 3300053104 Ga0500556_0082462 Ga0500556_0082462_131_868 245
335 3300053108 Ga0500562_000718 Ga0500562_000718_2519_3259 245
336 3300053109 Ga0500569_015904 Ga0500569_015904_783_1520 245
337 3300053119 Ga0500595_003139 Ga0500595_003139_926_1663 245
338 3300053121 Ga0500607_101039 Ga0500607_101039_207_944 245
339 3300053122 Ga0500608_037762 Ga0500608_037762_1114_1851 245
340 3300053123 Ga0500614_008279 Ga0500614_008279_1242_1979 245
341 3300053125 Ga0500618_000473 Ga0500618_000473_21957_22694 245
342 3300053130 Ga0500642_0020504 Ga0500642_0020504_541_1278 245
343 3300053134 Ga0500658_0003711 Ga0500658_0003711_651_1388 245
344 3300053134 Ga0500658_0079929 Ga0500658_0079929_382_1119 245
345 3300053136 Ga0500559_0000003 Ga0500559_0000003_1087_1824 245
346 3300053136 Ga0500559_0004254 Ga0500559_0004254_5562_6299 245
347 3300053138 Ga0500564_083423 Ga0500564_083423_593_1330 245
348 3300053142 Ga0500577_0000783 Ga0500577_0000783_4761_5498 245
349 3300053148 Ga0500590_007627 Ga0500590_007627_1951_2688 245
350 3300053153 Ga0500616_0018310 Ga0500616_0018310_2973_3710 245
351 3300053156 Ga0500622_0017552 Ga0500622_0017552_332_1069 245
352 3300053161 Ga0500634_0107503 Ga0500634_0107503_62_799 245
353 3300053162 Ga0500638_072118 Ga0500638_072118_168_905 245
354 3300053178 Ga0500637_0071316 Ga0500637_0071316_881_1618 245
355 3300053178 Ga0500637_0093289 Ga0500637_0093289_670_1407 245
356 3300053727 Ga0500611_009887 Ga0500611_009887_688_1425 245
357 3300053730 Ga0500645_001471 Ga0500645_001471_3181_3918 245
358 3300053730 Ga0500645_006700 Ga0500645_006700_2044_2781 245
359 3300053732 Ga0500656_007443 Ga0500656_007443_159_896 245
360 3300053735 Ga0500596_001418 Ga0500596_001418_72_809 245
361 3300053737 Ga0500601_002442 Ga0500601_002442_352_1089 245
362 iso_pu_bacteria 2643221545 2643749585 245
363 iso_pu_bacteria 2643221691 2644508542 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

35

65

0.98

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

226

272

0.93

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

115

182

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_k cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9244 2 39
7cg0-assembly1.cif.gz_m cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9169 2 40
7cgo-assembly1.cif.gz_l cryo-em structure of the flagellar motor-hook complex from salmonella 0.9119 2 40
7cg0-assembly1.cif.gz_o cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9103 1 40
5npy-assembly1.cif.gz_A crystal structure of helicobacter pylori flagellar hook protein flge2 0.8968 76 127
ID Description Score Start End Superfamily
af_H2KZQ6_199_375_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.412 11 69 1.20.120.350
1biaA03 Mainly Beta;Roll;SH3 type barrels.; 0.36 91 133 2.30.30.100
af_Q94AM9_46_130_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.3587 91 128 2.30.30.100
1biaA03 Mainly Beta;Roll;SH3 type barrels.; 0.3377 91 133 2.30.30.100
af_Q54DW4_990_1130_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.2887 107 231 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A420WNY8-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9638 1 244 GO:0030694
GO:0071978
AF-A0A839CW50-F1-model_v4 Flagellar hook-basal body complex protein 0.9577 1 243 GO:0009425
GO:0071978
AF-A0A1M5UN17-F1-model_v4 Flagellar basal-body rod protein FlgF 0.955 1 243 GO:0030694
GO:0071978
AF-A0A2E1XFB9-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9532 1 244 GO:0030694
GO:0071978
AF-A0A1H5ZAP7-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9528 1 243 GO:0030694
GO:0071978

Feature Viewer

pLDDT pTM Quality
84.18 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map