F422947

General Info

Members Datasets Scaffolds Average Seq Length
363 216 337 339

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10296283|Ga0105237_102962832
Length 359
Sequence LAYEQLFFDSFIFYRTYIHMSQILIIYTGGTIGMMSDPQTKVLKPINFEQIMDNVPELEKLNCKIKVHSFEQIIDSSNMNPAIWSELASLIESNYNDVDGFVILHGSDTMAFSASVLSFMLEGLGKPVIFTGSQLPISAIRTDAKENLMTSIEIAKAKKNDRARVPEVCIYFDYKLFRGNRSFKYNSSKFEAFRSPNYPILAESGVHLRFSANDIRHPKEGETLKVHKNLVSDVAVLKLYPGISPKVVETILGADVRGVVMETFGAGNTTTDDWFVDLLKQAIDSGKVILDISQCKVGTVELGRYETSKQLKDIGVANGYDMTYESAVTKMMYLLGQFDNPQDVKEHLEMDIRGEITVS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
10 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
11 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
12 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
13 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
14 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
15 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
16 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
17 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
18 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
19 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
20 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
21 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
22 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
23 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
24 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
25 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
26 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
216 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.28
Isolates 7.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0
Rhizoplane 2.2
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1558989 2162886007 Bacteria 3652
2 JGI24740J21852_10015341 3300001979 Bacteria 2801
3 JGI24739J22299_10045081 3300001989 Bacteria 1449
4 JGI24737J22298_10000077 3300001990 Bacteria 28981
5 JGI24737J22298_10035692 3300001990 Bacteria 1538
6 JGI24735J21928_10000005 3300002067 Bacteria 356755
7 JGI24744J21845_10016887 3300002077 Bacteria 1452
8 JGI25162J39368_1000596 3300002737 Bacteria 26217
9 JGI25165J46597_1002041 3300003214 Bacteria 7635
10 rootH1_10026072 3300003316 Bacteria 16591
11 rootH2_10024240 3300003320 Bacteria 36961
12 rootH2_10035444 3300003320 Bacteria 12072
13 rootH2_10069782 3300003320 Bacteria 1362
14 rootH2_10076019 3300003320 Bacteria 7044
15 rootH2_10122926 3300003320 Bacteria 1670
16 rootH2_10209505 3300003320 Bacteria 2957
17 rootL2_10021894 3300003322 Bacteria 11126
18 rootH1_10005386 3300003323 Bacteria 37172
19 rootH1_10007323 3300003323 Bacteria 15190
20 rootH1_10080363 3300003323 Bacteria 5682
21 JGI25160J50197_1007425 3300003354 Bacteria 4289
22 Ga0055529_1005870 3300003763 Bacteria 1746
23 Ga0058863_11005245 3300004799 Bacteria 3341
24 Ga0070658_10000917 3300005327 Bacteria 25190
25 Ga0070658_10050510 3300005327 Bacteria 3371
26 Ga0070676_10000030 3300005328 Bacteria 43467
27 Ga0070683_100182168 3300005329 Bacteria 1994
28 Ga0070670_100171232 3300005331 Bacteria 1883
29 Ga0070666_10118763 3300005335 Unclassified 1832
30 Ga0070680_100001753 3300005336 Bacteria 15938
31 Ga0068868_100364142 3300005338 Bacteria 1241
32 Ga0070660_100107558 3300005339 Bacteria 2216
33 Ga0070660_100111286 3300005339 Bacteria 2179
34 Ga0070671_100001418 3300005355 Bacteria 17923
35 Ga0070671_100062693 3300005355 Bacteria 3095
36 Ga0070674_100107452 3300005356 Bacteria 2043
37 Ga0070673_100001160 3300005364 Bacteria 15150
38 Ga0070659_100024209 3300005366 Bacteria 4653
39 Ga0070659_100088431 3300005366 Bacteria 2481
40 Ga0070659_100101692 3300005366 Bacteria 2314
41 Ga0070663_100218493 3300005455 Bacteria 1495
42 Ga0070678_100001694 3300005456 Bacteria 11820
43 Ga0070662_100000003 3300005457 Bacteria 239813
44 Ga0070681_10024611 3300005458 Bacteria 6057
45 Ga0068867_100012919 3300005459 Bacteria 5908
46 Ga0068867_100158694 3300005459 Unclassified 1782
47 Ga0070679_100002253 3300005530 Bacteria 17431
48 Ga0070679_100081415 3300005530 Bacteria 3227
49 Ga0070684_100084098 3300005535 Bacteria 2820
50 Ga0068853_100003188 3300005539 Bacteria 12525
51 Ga0068853_100250764 3300005539 Bacteria 1624
52 Ga0070672_100312038 3300005543 Bacteria 1335
53 Ga0070665_100000212 3300005548 Bacteria 100019
54 Ga0070665_100147639 3300005548 Bacteria 2354
55 Ga0070665_100578087 3300005548 Bacteria 1136
56 Ga0068855_100000127 3300005563 Bacteria 96826
57 Ga0068855_100000201 3300005563 Bacteria 76965
58 Ga0068855_100114425 3300005563 Bacteria 3093
59 Ga0068855_100179556 3300005563 Bacteria 2394
60 Ga0068855_100419481 3300005563 Bacteria 1464
61 Ga0070664_100056658 3300005564 Bacteria 3330
62 Ga0068857_100020049 3300005577 Bacteria 5879
63 Ga0068856_100000036 3300005614 Bacteria 121468
64 Ga0068856_100007014 3300005614 Bacteria 11006
65 Ga0068856_100454929 3300005614 Bacteria 1301
66 Ga0068852_100000729 3300005616 Bacteria 21570
67 Ga0075366_10000073 3300006195 Bacteria 38953
68 Ga0075366_10007201 3300006195 Bacteria 6130
69 Ga0075366_10023976 3300006195 Bacteria 3557
70 Ga0097621_100000353 3300006237 Bacteria 31725
71 Ga0097621_100001494 3300006237 Bacteria 16035
72 Ga0075370_10067937 3300006353 Bacteria 2035
73 Ga0068871_100000042 3300006358 Bacteria 67951
74 Ga0068871_100000162 3300006358 Bacteria 44419
75 Ga0068865_100000075 3300006881 Bacteria 51751
76 Ga0105240_10000185 3300009093 Bacteria 126364
77 Ga0105240_10022581 3300009093 Bacteria 8338
78 Ga0105240_10082194 3300009093 Bacteria 3956
79 Ga0105240_10089237 3300009093 Bacteria 3771
80 Ga0105240_10463636 3300009093 Bacteria 1415
81 Ga0105243_10000003 3300009148 Bacteria 712931
82 Ga0105241_10001639 3300009174 Bacteria 17064
83 Ga0105241_10007443 3300009174 Bacteria 8058
84 Ga0105241_10019658 3300009174 Bacteria 4984
85 Ga0105241_10111747 3300009174 Bacteria 2188
86 Ga0105241_10235974 3300009174 Bacteria 1544
87 Ga0105242_10010606 3300009176 Bacteria 7073
88 Ga0105237_10000154 3300009545 Bacteria 96509
89 Ga0105237_10000808 3300009545 Bacteria 42764
90 Ga0105237_10001785 3300009545 Bacteria 27820
91 Ga0105237_10002335 3300009545 Bacteria 23567
92 Ga0105237_10010324 3300009545 Bacteria 9948
93 Ga0105237_10052950 3300009545 Bacteria 4072
94 Ga0105237_10296283 3300009545 Bacteria 1620
95 Ga0105237_10346529 3300009545 Bacteria 1490
96 Ga0105238_10007841 3300009551 Bacteria 10676
97 Ga0105238_10011638 3300009551 Bacteria 8863
98 Ga0105249_10018966 3300009553 Bacteria 6132
99 Ga0105249_10123231 3300009553 Bacteria 2466
100 Ga0105239_10000008 3300010375 Bacteria 376925
101 Ga0105239_10000045 3300010375 Bacteria 186314
102 Ga0105239_10000446 3300010375 Bacteria 60289
103 Ga0105239_10002896 3300010375 Bacteria 21449
104 Ga0105239_10048703 3300010375 Bacteria 4647
105 Ga0105239_10114553 3300010375 Bacteria 2990
106 Ga0105239_10274782 3300010375 Bacteria 1896
107 Ga0157373_10000091 3300013100 Bacteria 75012
108 Ga0157373_10003653 3300013100 Bacteria 11625
109 Ga0157373_10054956 3300013100 Bacteria 2829
110 Ga0157371_10000155 3300013102 Bacteria 100230
111 Ga0157371_10002671 3300013102 Bacteria 16870
112 Ga0157371_10019428 3300013102 Bacteria 5013
113 Ga0157371_10042384 3300013102 Bacteria 3244
114 Ga0157370_10064769 3300013104 Bacteria 3459
115 Ga0157370_10194791 3300013104 Bacteria 1881
116 Ga0157369_10001051 3300013105 Bacteria 34842
117 Ga0157369_10071612 3300013105 Bacteria 3721
118 Ga0157369_10124852 3300013105 Bacteria 2730
119 Ga0157374_10001433 3300013296 Bacteria 20152
120 Ga0157374_10009075 3300013296 Bacteria 8521
121 Ga0157374_10301027 3300013296 Bacteria 1586
122 Ga0157378_10006635 3300013297 Bacteria 10114
123 Ga0163162_10000041 3300013306 Bacteria 132375
124 Ga0163162_10003627 3300013306 Bacteria 14800
125 Ga0163162_10030011 3300013306 Bacteria 5384
126 Ga0163162_10077773 3300013306 Bacteria 3382
127 Ga0163162_10620502 3300013306 Bacteria 1206
128 Ga0157372_10000009 3300013307 Bacteria 302051
129 Ga0157372_10001387 3300013307 Bacteria 26142
130 Ga0157372_10003738 3300013307 Bacteria 16334
131 Ga0157372_10019416 3300013307 Bacteria 7327
132 Ga0157372_10069679 3300013307 Bacteria 3956
133 Ga0157372_10128176 3300013307 Bacteria 2918
134 Ga0157372_10275799 3300013307 Bacteria 1955
135 Ga0157375_10000182 3300013308 Bacteria 59120
136 Ga0157375_10012227 3300013308 Bacteria 7610
137 Ga0157375_10042141 3300013308 Bacteria 4416
138 Ga0157375_10297475 3300013308 Bacteria 1777
139 Ga0163163_10001809 3300014325 Bacteria 18036
140 Ga0163163_10707075 3300014325 Bacteria 1071
141 Ga0157377_10046968 3300014745 Bacteria 2417
142 Ga0157379_10019053 3300014968 Bacteria 6059
143 Ga0157379_10118284 3300014968 Bacteria 2383
144 Ga0157376_10001366 3300014969 Bacteria 16065
145 Ga0157376_10222559 3300014969 Bacteria 1749
146 Ga0163161_10002927 3300017792 Bacteria 12089
147 Ga0163161_10022533 3300017792 Bacteria 4437
148 Ga0163161_10124675 3300017792 Bacteria 1938
149 Ga0213872_10013780 3300021361 Bacteria 3782
150 Ga0207427_100109 3300025231 Bacteria 116061
151 Ga0209437_100096 3300025233 Bacteria 233558
152 Ga0209437_100507 3300025233 Bacteria 27709
153 Ga0209026_1000225 3300025250 Bacteria 77234
154 Ga0209026_1001350 3300025250 Bacteria 10961
155 Ga0209129_1006483 3300025258 Bacteria 3766
156 Ga0209233_1000029 3300025261 Bacteria 641642
157 Ga0209233_1003414 3300025261 Bacteria 5602
158 Ga0209233_1027993 3300025261 Bacteria 1358
159 Ga0209455_1001235 3300025272 Bacteria 12098
160 Ga0209130_1003558 3300025284 Bacteria 6519
161 Ga0207426_1000415 3300025302 Bacteria 70247
162 Ga0207647_10000135 3300025904 Bacteria 58247
163 Ga0207647_10035660 3300025904 Bacteria 3168
164 Ga0207645_10000014 3300025907 Bacteria 117512
165 Ga0207705_10000833 3300025909 Bacteria 25202
166 Ga0207705_10039697 3300025909 Bacteria 3374
167 Ga0207654_10004469 3300025911 Bacteria 7059
168 Ga0207654_10005992 3300025911 Bacteria 6117
169 Ga0207654_10015207 3300025911 Bacteria 3989
170 Ga0207654_10097780 3300025911 Bacteria 1803
171 Ga0207695_10000117 3300025913 Bacteria 237982
172 Ga0207695_10010304 3300025913 Bacteria 11443
173 Ga0207695_10011948 3300025913 Bacteria 10454
174 Ga0207671_10000185 3300025914 Bacteria 95649
175 Ga0207671_10001286 3300025914 Bacteria 29511
176 Ga0207671_10002683 3300025914 Bacteria 18663
177 Ga0207671_10003474 3300025914 Bacteria 15671
178 Ga0207660_10008055 3300025917 Bacteria 6817
179 Ga0207657_10188464 3300025919 Bacteria 1665
180 Ga0207657_10247362 3300025919 Bacteria 1422
181 Ga0207652_10011555 3300025921 Bacteria 7120
182 Ga0207694_10024184 3300025924 Bacteria 4612
183 Ga0207694_10045871 3300025924 Bacteria 3377
184 Ga0207650_10191878 3300025925 Bacteria 1632
185 Ga0207644_10017612 3300025931 Bacteria 4830
186 Ga0207644_10143756 3300025931 Bacteria 1839
187 Ga0207690_10015056 3300025932 Bacteria 4682
188 Ga0207706_10000009 3300025933 Bacteria 200607
189 Ga0207686_10041848 3300025934 Bacteria 2797
190 Ga0207709_10000008 3300025935 Bacteria 713099
191 Ga0207704_10000118 3300025938 Bacteria 43936
192 Ga0207661_10063070 3300025944 Bacteria 3000
193 Ga0207667_10000171 3300025949 Bacteria 95554
194 Ga0207667_10000236 3300025949 Bacteria 77019
195 Ga0207667_10014886 3300025949 Bacteria 8845
196 Ga0207667_10138115 3300025949 Bacteria 2510
197 Ga0207651_10005229 3300025960 Bacteria 6633
198 Ga0207677_10024067 3300026023 Bacteria 3776
199 Ga0207639_10001022 3300026041 Bacteria 19034
200 Ga0207639_10014208 3300026041 Bacteria 5591
201 Ga0207639_10223496 3300026041 Bacteria 1628
202 Ga0207702_10000088 3300026078 Bacteria 105505
203 Ga0207702_10015658 3300026078 Bacteria 6276
204 Ga0207702_10025309 3300026078 Bacteria 4925
205 Ga0207702_10414091 3300026078 Bacteria 1302
206 Ga0207648_10000459 3300026089 Bacteria 45286
207 Ga0207648_10226087 3300026089 Bacteria 1664
208 Ga0207674_10040744 3300026116 Bacteria 4808
209 Ga0207674_10156143 3300026116 Bacteria 2237
210 Ga0207683_10002362 3300026121 Bacteria 16484
211 Ga0207698_10023382 3300026142 Bacteria 4316
212 Ga0209968_1002282 3300027526 Bacteria 2902
213 Ga0209974_10008742 3300027876 Bacteria 3450
214 Ga0268266_10000177 3300028379 Bacteria 114318
215 Ga0307517_10000553 3300028786 Bacteria 63892
216 Ga0307515_10000595 3300028794 Bacteria 84423
217 Ga0307515_10001029 3300028794 Bacteria 63730
218 Ga0307515_10234983 3300028794 Bacteria 1616
219 Ga0265338_10043721 3300028800 Bacteria 4149
220 Ga0316176_1047582 3300030732 Bacteria 13233
221 Ga0316183_1089491 3300030742 Bacteria 19428
222 Ga0316181_1178606 3300030744 Bacteria 13203
223 Ga0307408_100001869 3300031548 Bacteria 15354
224 Ga0307408_100001899 3300031548 Bacteria 15198
225 Ga0307408_100013466 3300031548 Bacteria 5429
226 Ga0307405_10110649 3300031731 Bacteria 1860
227 Ga0307412_10000925 3300031911 Bacteria 16779
228 Ga0307412_10022610 3300031911 Bacteria 3857
229 Ga0307414_10181002 3300032004 Bacteria 1695
230 Ga0307507_10001172 3300033179 Bacteria 58234
231 Ga0307510_10000172 3300033180 Bacteria 54812
232 Ga0395899_0000017 3300037312 Bacteria 440179
233 Ga0395899_0000327 3300037312 Bacteria 60343
234 Ga0395900_0000197 3300037418 Bacteria 95775
235 Ga0395900_0000609 3300037418 Bacteria 48753
236 Ga0395900_0004982 3300037418 Bacteria 13961
237 Ga0395900_0261053 3300037418 Bacteria 1730
238 Ga0395898_0011895 3300037466 Bacteria 9012
239 Ga0395905_0000186 3300037471 Bacteria 99159
240 Ga0395905_0059218 3300037471 Bacteria 3580
241 Ga0395901_0000368 3300038443 Bacteria 54066
242 Ga0395901_0131861 3300038443 Bacteria 2626
243 Ga0395901_0153676 3300038443 Bacteria 2417
244 Ga0436361_0967822 3300039447 Bacteria 7535
245 Ga0439436_0041589 3300041404 Bacteria 1315
246 Ga0439448_0001244 3300042005 Bacteria 6503
247 Ga0439457_011387 3300042014 Bacteria 2024
248 Ga0451577_0014190 3300042876 Bacteria 7427
249 Ga0453683_0009891 3300044673 Bacteria 6349
250 Ga0466966_0011694 3300044684 Bacteria 5817
251 Ga0466966_0286401 3300044684 Bacteria 990
252 Ga0466961_0074001 3300044693 Bacteria 2160
253 Ga0453684_0000143 3300044712 Bacteria 315998
254 Ga0453684_0018760 3300044712 Bacteria 10589
255 Ga0453684_0148477 3300044712 Bacteria 2789
256 Ga0453684_0222057 3300044712 Bacteria 2188
257 Ga0453684_0277779 3300044712 Bacteria 1911
258 Ga0453684_0352577 3300044712 Bacteria 1659
259 Ga0466957_0200763 3300044842 Bacteria 1310
260 Ga0466959_0006644 3300045049 Bacteria 8036
261 Ga0451576_0022510 3300045051 Bacteria 6833
262 Ga0451576_0144877 3300045051 Bacteria 2477
263 Ga0451576_0210561 3300045051 Bacteria 2030
264 Ga0451576_0258771 3300045051 Bacteria 1819
265 Ga0466958_0037793 3300045836 Bacteria 2894
266 Ga0495650_0000225 3300046471 Bacteria 117898
267 Ga0495650_0024378 3300046471 Bacteria 2858
268 Ga0495585_0000074 3300046492 Bacteria 102651
269 Ga0495607_0014893 3300046501 Bacteria 5054
270 Ga0495607_0087317 3300046501 Bacteria 1698
271 Ga0495606_0000074 3300046507 Bacteria 170848
272 Ga0495606_0011030 3300046507 Bacteria 7416
273 Ga0495606_0015802 3300046507 Bacteria 5793
274 Ga0495606_0025785 3300046507 Bacteria 4201
275 Ga0495606_0067679 3300046507 Bacteria 2261
276 Ga0495610_0001170 3300046512 Bacteria 23824
277 Ga0495616_0002088 3300046513 Bacteria 13429
278 Ga0495631_0005662 3300046518 Bacteria 6518
279 Ga0495631_0016589 3300046518 Bacteria 3507
280 Ga0495637_0053489 3300046520 Bacteria 1680
281 Ga0495648_0031261 3300046524 Bacteria 3508
282 Ga0495609_0014746 3300046538 Bacteria 3669
283 Ga0495622_0034930 3300046557 Bacteria 2345
284 Ga0495633_0000006 3300046558 Bacteria 326774
285 Ga0495633_0000025 3300046558 Bacteria 218627
286 Ga0495633_0005495 3300046558 Bacteria 7716
287 Ga0495668_0000011 3300046616 Bacteria 472186
288 Ga0495625_0000067 3300046660 Bacteria 171483
289 Ga0495625_0000660 3300046660 Bacteria 49270
290 Ga0495625_0002214 3300046660 Bacteria 21483
291 Ga0495625_0020512 3300046660 Bacteria 5100
292 Ga0495661_0001183 3300046665 Bacteria 22653
293 Ga0495661_0003220 3300046665 Bacteria 12186
294 Ga0495670_0069475 3300046691 Bacteria 1781
295 Ga0495649_0000054 3300046694 Bacteria 107048
296 Ga0495649_0074641 3300046694 Bacteria 1817
297 Ga0495660_0078823 3300046810 Bacteria 1731
298 Ga0495683_0038971 3300047323 Bacteria 2403
299 Ga0495687_001083 3300047443 Bacteria 26756
300 Ga0495687_002879 3300047443 Bacteria 13149
301 Ga0495685_040045 3300047447 Bacteria 1603
302 Ga0495673_0035812 3300047469 Bacteria 2283
303 Ga0495686_0000783 3300047472 Bacteria 41638
304 Ga0495686_0001252 3300047472 Bacteria 28871
305 Ga0495686_0108544 3300047472 Bacteria 1667
306 Ga0495614_0072355 3300048089 Bacteria 1487
307 Ga0496100_0020389 3300048903 Bacteria 3974
308 Ga0496101_0197322 3300048904 Unclassified 1555
309 Ga0496102_0389927 3300048905 Unclassified 1310
310 Ga0496104_0377535 3300048907 Unclassified 1330
311 Ga0496105_0202861 3300048908 Unclassified 1618
312 Ga0496114_0298071 3300048917 Unclassified 1423
313 Ga0496115_0045793 3300048918 Bacteria 3493
314 Ga0496116_0005899 3300048919 Bacteria 11244
315 Ga0496117_0005949 3300048920 Bacteria 12577
316 Ga0496118_0106467 3300048921 Bacteria 1876
317 Ga0496122_0003774 3300048925 Bacteria 19531
318 Ga0496123_0018910 3300048926 Bacteria 5453
319 Ga0496125_0003293 3300048928 Bacteria 19812
320 Ga0496126_0021822 3300048929 Bacteria 6247
321 Ga0496126_0377907 3300048929 Bacteria 1154
322 Ga0495678_010512 3300049459 Bacteria 4495
323 Ga0501034_0037681 3300049571 Bacteria 4897
324 Ga0501036_0305702 3300049572 Bacteria 1330
325 Ga0501043_0266503 3300049579 Bacteria 1316
326 Ga0501047_0050690 3300049581 Bacteria 4009
327 Ga0501217_070423 3300049661 Unclassified 951
328 Ga0501044_0013100 3300049823 Bacteria 8977
329 nmdc:mga0k408_106_c1 3300050493 Bacteria 40767
330 nmdc:mga0k408_3774_c1 3300050493 Bacteria 8035
331 nmdc:mga0k408_626_c1 3300050493 Bacteria 19472
332 Ga0500635_0005805 3300053080 Bacteria 3265
333 Ga0500608_001805 3300053122 Bacteria 7635
334 Ga0500614_004410 3300053123 Bacteria 2974
335 Ga0500618_000006 3300053125 Bacteria 239188
336 Ga0500622_0000891 3300053156 Bacteria 25423
337 Ga0500624_000514 3300053157 Bacteria 11241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0074641 Ga0495649_0074641_44_886 280
2 3300049661 Ga0501217_070423 Ga0501217_070423_18_893 281
3 3300037471 Ga0395905_0059218 Ga0395905_0059218_2673_3569 298
4 3300046691 Ga0495670_0069475 Ga0495670_0069475_839_1762 307
5 3300044712 Ga0453684_0018760 Ga0453684_0018760_5056_6078 308
6 3300013307 Ga0157372_10128176 Ga0157372_101281762 316
7 3300044684 Ga0466966_0286401 Ga0466966_0286401_21_974 317
8 3300046501 Ga0495607_0087317 Ga0495607_0087317_409_1386 322
9 3300048928 Ga0496125_0003293 Ga0496125_0003293_16426_17403 322
10 3300003320 rootH2_10069782 rootH2_100697821 324
11 3300005327 Ga0070658_10000917 Ga0070658_1000091721 324
12 3300005331 Ga0070670_100171232 Ga0070670_1001712322 324
13 3300005543 Ga0070672_100312038 Ga0070672_1003120382 324
14 3300005563 Ga0068855_100419481 Ga0068855_1004194811 324
15 3300009553 Ga0105249_10018966 Ga0105249_100189663 324
16 3300013306 Ga0163162_10003627 Ga0163162_1000362712 324
17 3300013308 Ga0157375_10000182 Ga0157375_1000018212 324
18 3300014325 Ga0163163_10001809 Ga0163163_1000180915 324
19 3300014325 Ga0163163_10707075 Ga0163163_107070751 324
20 3300014968 Ga0157379_10019053 Ga0157379_100190536 324
21 3300014968 Ga0157379_10118284 Ga0157379_101182843 324
22 3300014969 Ga0157376_10001366 Ga0157376_1000136611 324
23 3300017792 Ga0163161_10124675 Ga0163161_101246752 324
24 3300021361 Ga0213872_10013780 Ga0213872_100137802 324
25 3300025911 Ga0207654_10005992 Ga0207654_100059923 324
26 3300025911 Ga0207654_10097780 Ga0207654_100977802 324
27 3300025925 Ga0207650_10191878 Ga0207650_101918782 324
28 3300026023 Ga0207677_10024067 Ga0207677_100240672 324
29 3300026041 Ga0207639_10223496 Ga0207639_102234962 324
30 3300037418 Ga0395900_0261053 Ga0395900_0261053_28_1005 324
31 3300048903 Ga0496100_0020389 Ga0496100_0020389_1599_2579 324
32 3300048904 Ga0496101_0197322 Ga0496101_0197322_471_1451 324
33 3300048905 Ga0496102_0389927 Ga0496102_0389927_229_1209 324
34 3300048907 Ga0496104_0377535 Ga0496104_0377535_191_1171 324
35 3300048908 Ga0496105_0202861 Ga0496105_0202861_355_1335 324
36 3300048917 Ga0496114_0298071 Ga0496114_0298071_187_1167 324
37 3300041404 Ga0439436_0041589 Ga0439436_0041589_11_1018 325
38 3300045051 Ga0451576_0022510 Ga0451576_0022510_4367_5395 325
39 iso_pu_bacteria 2842903701 2842905219 333
40 3300005530 Ga0070679_100081415 Ga0070679_1000814153 334
41 iso_pu_bacteria 2599185184 2599479977 334
42 iso_pu_bacteria 2852623160 2852625727 334
43 iso_pu_bacteria 2884933994 2884935748 334
44 iso_pu_bacteria 2896344016 2896346000 334
45 iso_pu_bacteria 2919437846 2919440180 334
46 iso_pu_bacteria 2928078545 2928081107 334
47 iso_pu_bacteria 2928147474 2928152472 334
48 iso_pu_bacteria 2932082852 2932087757 334
49 iso_pu_bacteria 2958512119 2958514410 334
50 iso_pu_bacteria 2977232053 2977235581 334
51 iso_pu_bacteria 2721755487 2722730553 335
52 iso_pu_bacteria 2884791551 2884797284 335
53 iso_pu_bacteria 2890737413 2890739349 335
54 iso_pu_bacteria 2896317667 2896319555 335
55 iso_pu_bacteria 2898713307 2898713644 335
56 iso_pu_bacteria 2904780799 2904785177 335
57 iso_pu_bacteria 2919177583 2919181747 335
58 iso_pu_bacteria 2929177148 2929177247 335
59 iso_pu_bacteria 3003233435 3003236716 335
60 iso_pu_bacteria 8055588893 8055588900 335
61 3300017792 Ga0163161_10022533 Ga0163161_100225333 336
62 3300027526 Ga0209968_1002282 Ga0209968_10022823 336
63 3300027876 Ga0209974_10008742 Ga0209974_100087424 336
64 3300044712 Ga0453684_0222057 Ga0453684_0222057_335_1369 336
65 3300046507 Ga0495606_0025785 Ga0495606_0025785_2086_3114 336
66 3300046810 Ga0495660_0078823 Ga0495660_0078823_325_1350 336
67 3300048918 Ga0496115_0045793 Ga0496115_0045793_540_1568 336
68 3300048929 Ga0496126_0021822 Ga0496126_0021822_2149_3177 336
69 iso_pu_bacteria 2881247448 2881250588 336
70 iso_pu_bacteria 2911138879 2911142742 336
71 3300013104 Ga0157370_10194791 Ga0157370_101947912 337
72 3300030732 Ga0316176_1047582 Ga0316176_10475824 337
73 3300030742 Ga0316183_1089491 Ga0316183_108949112 337
74 3300030744 Ga0316181_1178606 Ga0316181_11786061 337
75 3300044712 Ga0453684_0277779 Ga0453684_0277779_698_1738 337
76 3300045051 Ga0451576_0144877 Ga0451576_0144877_176_1216 337
77 3300046501 Ga0495607_0014893 Ga0495607_0014893_1082_2110 337
78 3300001979 JGI24740J21852_10015341 JGI24740J21852_100153413 338
79 3300001989 JGI24739J22299_10045081 JGI24739J22299_100450811 338
80 3300001990 JGI24737J22298_10000077 JGI24737J22298_1000007718 338
81 3300001990 JGI24737J22298_10035692 JGI24737J22298_100356922 338
82 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005111 338
83 3300002077 JGI24744J21845_10016887 JGI24744J21845_100168871 338
84 3300002737 JGI25162J39368_1000596 JGI25162J39368_100059622 338
85 3300003214 JGI25165J46597_1002041 JGI25165J46597_10020416 338
86 3300003316 rootH1_10026072 rootH1_1002607210 338
87 3300003320 rootH2_10024240 rootH2_100242406 338
88 3300003320 rootH2_10035444 rootH2_100354444 338
89 3300003320 rootH2_10122926 rootH2_101229263 338
90 3300003320 rootH2_10209505 rootH2_102095051 338
91 3300003322 rootL2_10021894 rootL2_1002189414 338
92 3300003323 rootH1_10005386 rootH1_100053863 338
93 3300003323 rootH1_10080363 rootH1_100803634 338
94 3300003763 Ga0055529_1005870 Ga0055529_10058702 338
95 3300004799 Ga0058863_11005245 Ga0058863_110052453 338
96 3300005327 Ga0070658_10050510 Ga0070658_100505101 338
97 3300005328 Ga0070676_10000030 Ga0070676_1000003033 338
98 3300005329 Ga0070683_100182168 Ga0070683_1001821682 338
99 3300005335 Ga0070666_10118763 Ga0070666_101187632 338
100 3300005336 Ga0070680_100001753 Ga0070680_10000175310 338
101 3300005338 Ga0068868_100364142 Ga0068868_1003641422 338
102 3300005339 Ga0070660_100107558 Ga0070660_1001075582 338
103 3300005339 Ga0070660_100111286 Ga0070660_1001112862 338
104 3300005355 Ga0070671_100001418 Ga0070671_1000014182 338
105 3300005355 Ga0070671_100062693 Ga0070671_1000626933 338
106 3300005356 Ga0070674_100107452 Ga0070674_1001074522 338
107 3300005364 Ga0070673_100001160 Ga0070673_1000011603 338
108 3300005366 Ga0070659_100024209 Ga0070659_1000242094 338
109 3300005366 Ga0070659_100088431 Ga0070659_1000884311 338
110 3300005366 Ga0070659_100101692 Ga0070659_1001016923 338
111 3300005455 Ga0070663_100218493 Ga0070663_1002184932 338
112 3300005456 Ga0070678_100001694 Ga0070678_1000016945 338
113 3300005457 Ga0070662_100000003 Ga0070662_100000003137 338
114 3300005458 Ga0070681_10024611 Ga0070681_100246114 338
115 3300005459 Ga0068867_100012919 Ga0068867_1000129192 338
116 3300005459 Ga0068867_100158694 Ga0068867_1001586942 338
117 3300005530 Ga0070679_100002253 Ga0070679_10000225312 338
118 3300005535 Ga0070684_100084098 Ga0070684_1000840982 338
119 3300005539 Ga0068853_100003188 Ga0068853_1000031888 338
120 3300005539 Ga0068853_100250764 Ga0068853_1002507642 338
121 3300005548 Ga0070665_100000212 Ga0070665_10000021224 338
122 3300005548 Ga0070665_100147639 Ga0070665_1001476392 338
123 3300005548 Ga0070665_100578087 Ga0070665_1005780871 338
124 3300005563 Ga0068855_100000127 Ga0068855_10000012716 338
125 3300005563 Ga0068855_100000201 Ga0068855_1000002016 338
126 3300005563 Ga0068855_100114425 Ga0068855_1001144252 338
127 3300005563 Ga0068855_100179556 Ga0068855_1001795563 338
128 3300005564 Ga0070664_100056658 Ga0070664_1000566583 338
129 3300005577 Ga0068857_100020049 Ga0068857_1000200492 338
130 3300005614 Ga0068856_100000036 Ga0068856_100000036107 338
131 3300005614 Ga0068856_100007014 Ga0068856_1000070142 338
132 3300005614 Ga0068856_100454929 Ga0068856_1004549292 338
133 3300005616 Ga0068852_100000729 Ga0068852_1000007293 338
134 3300006195 Ga0075366_10000073 Ga0075366_100000737 338
135 3300006195 Ga0075366_10007201 Ga0075366_100072014 338
136 3300006195 Ga0075366_10023976 Ga0075366_100239765 338
137 3300006237 Ga0097621_100000353 Ga0097621_1000003536 338
138 3300006237 Ga0097621_100001494 Ga0097621_10000149410 338
139 3300006353 Ga0075370_10067937 Ga0075370_100679372 338
140 3300006358 Ga0068871_100000042 Ga0068871_10000004254 338
141 3300006358 Ga0068871_100000162 Ga0068871_10000016216 338
142 3300006881 Ga0068865_100000075 Ga0068865_10000007527 338
143 3300009093 Ga0105240_10000185 Ga0105240_1000018582 338
144 3300009093 Ga0105240_10022581 Ga0105240_100225813 338
145 3300009093 Ga0105240_10082194 Ga0105240_100821944 338
146 3300009093 Ga0105240_10089237 Ga0105240_100892373 338
147 3300009093 Ga0105240_10463636 Ga0105240_104636361 338
148 3300009174 Ga0105241_10001639 Ga0105241_100016395 338
149 3300009174 Ga0105241_10007443 Ga0105241_100074432 338
150 3300009174 Ga0105241_10019658 Ga0105241_100196582 338
151 3300009174 Ga0105241_10111747 Ga0105241_101117472 338
152 3300009174 Ga0105241_10235974 Ga0105241_102359742 338
153 3300009176 Ga0105242_10010606 Ga0105242_100106064 338
154 3300009545 Ga0105237_10000154 Ga0105237_1000015438 338
155 3300009545 Ga0105237_10000808 Ga0105237_1000080820 338
156 3300009545 Ga0105237_10001785 Ga0105237_1000178513 338
157 3300009545 Ga0105237_10002335 Ga0105237_1000233510 338
158 3300009545 Ga0105237_10010324 Ga0105237_1001032412 338
159 3300009545 Ga0105237_10052950 Ga0105237_100529504 338
160 3300009545 Ga0105237_10296283 Ga0105237_102962832 338
161 3300009545 Ga0105237_10346529 Ga0105237_103465292 338
162 3300009551 Ga0105238_10007841 Ga0105238_100078413 338
163 3300009551 Ga0105238_10011638 Ga0105238_1001163810 338
164 3300009553 Ga0105249_10123231 Ga0105249_101232313 338
165 3300010375 Ga0105239_10000008 Ga0105239_10000008157 338
166 3300010375 Ga0105239_10000045 Ga0105239_1000004572 338
167 3300010375 Ga0105239_10000446 Ga0105239_1000044648 338
168 3300010375 Ga0105239_10002896 Ga0105239_1000289610 338
169 3300010375 Ga0105239_10048703 Ga0105239_100487033 338
170 3300010375 Ga0105239_10114553 Ga0105239_101145532 338
171 3300010375 Ga0105239_10274782 Ga0105239_102747821 338
172 3300013100 Ga0157373_10000091 Ga0157373_1000009142 338
173 3300013100 Ga0157373_10003653 Ga0157373_100036532 338
174 3300013100 Ga0157373_10054956 Ga0157373_100549562 338
175 3300013102 Ga0157371_10000155 Ga0157371_1000015562 338
176 3300013102 Ga0157371_10002671 Ga0157371_1000267113 338
177 3300013102 Ga0157371_10019428 Ga0157371_100194284 338
178 3300013102 Ga0157371_10042384 Ga0157371_100423843 338
179 3300013104 Ga0157370_10064769 Ga0157370_100647693 338
180 3300013105 Ga0157369_10001051 Ga0157369_1000105127 338
181 3300013105 Ga0157369_10071612 Ga0157369_100716122 338
182 3300013105 Ga0157369_10124852 Ga0157369_101248522 338
183 3300013296 Ga0157374_10001433 Ga0157374_1000143315 338
184 3300013296 Ga0157374_10009075 Ga0157374_100090753 338
185 3300013296 Ga0157374_10301027 Ga0157374_103010272 338
186 3300013297 Ga0157378_10006635 Ga0157378_100066356 338
187 3300013306 Ga0163162_10000041 Ga0163162_1000004135 338
188 3300013306 Ga0163162_10030011 Ga0163162_100300112 338
189 3300013306 Ga0163162_10077773 Ga0163162_100777734 338
190 3300013306 Ga0163162_10620502 Ga0163162_106205022 338
191 3300013307 Ga0157372_10000009 Ga0157372_1000000916 338
192 3300013307 Ga0157372_10001387 Ga0157372_100013873 338
193 3300013307 Ga0157372_10003738 Ga0157372_100037387 338
194 3300013307 Ga0157372_10069679 Ga0157372_100696792 338
195 3300013307 Ga0157372_10275799 Ga0157372_102757992 338
196 3300013308 Ga0157375_10012227 Ga0157375_100122273 338
197 3300013308 Ga0157375_10042141 Ga0157375_100421412 338
198 3300013308 Ga0157375_10297475 Ga0157375_102974752 338
199 3300014745 Ga0157377_10046968 Ga0157377_100469682 338
200 3300014969 Ga0157376_10222559 Ga0157376_102225592 338
201 3300017792 Ga0163161_10002927 Ga0163161_100029272 338
202 3300025231 Ga0207427_100109 Ga0207427_10010934 338
203 3300025233 Ga0209437_100096 Ga0209437_100096141 338
204 3300025233 Ga0209437_100507 Ga0209437_10050715 338
205 3300025250 Ga0209026_1000225 Ga0209026_100022574 338
206 3300025250 Ga0209026_1001350 Ga0209026_10013507 338
207 3300025258 Ga0209129_1006483 Ga0209129_10064833 338
208 3300025261 Ga0209233_1000029 Ga0209233_1000029517 338
209 3300025261 Ga0209233_1003414 Ga0209233_10034145 338
210 3300025261 Ga0209233_1027993 Ga0209233_10279932 338
211 3300025272 Ga0209455_1001235 Ga0209455_10012357 338
212 3300025904 Ga0207647_10000135 Ga0207647_1000013516 338
213 3300025904 Ga0207647_10035660 Ga0207647_100356603 338
214 3300025907 Ga0207645_10000014 Ga0207645_1000001465 338
215 3300025909 Ga0207705_10000833 Ga0207705_1000083323 338
216 3300025909 Ga0207705_10039697 Ga0207705_100396971 338
217 3300025911 Ga0207654_10004469 Ga0207654_100044691 338
218 3300025911 Ga0207654_10015207 Ga0207654_100152072 338
219 3300025913 Ga0207695_10000117 Ga0207695_10000117183 338
220 3300025913 Ga0207695_10010304 Ga0207695_100103046 338
221 3300025913 Ga0207695_10011948 Ga0207695_100119484 338
222 3300025914 Ga0207671_10000185 Ga0207671_1000018537 338
223 3300025914 Ga0207671_10001286 Ga0207671_1000128616 338
224 3300025914 Ga0207671_10002683 Ga0207671_1000268311 338
225 3300025914 Ga0207671_10003474 Ga0207671_100034744 338
226 3300025917 Ga0207660_10008055 Ga0207660_100080554 338
227 3300025919 Ga0207657_10188464 Ga0207657_101884642 338
228 3300025919 Ga0207657_10247362 Ga0207657_102473622 338
229 3300025921 Ga0207652_10011555 Ga0207652_100115554 338
230 3300025924 Ga0207694_10024184 Ga0207694_100241845 338
231 3300025924 Ga0207694_10045871 Ga0207694_100458712 338
232 3300025931 Ga0207644_10017612 Ga0207644_100176123 338
233 3300025931 Ga0207644_10143756 Ga0207644_101437562 338
234 3300025932 Ga0207690_10015056 Ga0207690_100150562 338
235 3300025933 Ga0207706_10000009 Ga0207706_10000009146 338
236 3300025934 Ga0207686_10041848 Ga0207686_100418482 338
237 3300025938 Ga0207704_10000118 Ga0207704_1000011817 338
238 3300025944 Ga0207661_10063070 Ga0207661_100630702 338
239 3300025949 Ga0207667_10000171 Ga0207667_1000017166 338
240 3300025949 Ga0207667_10000236 Ga0207667_1000023655 338
241 3300025949 Ga0207667_10014886 Ga0207667_100148863 338
242 3300025949 Ga0207667_10138115 Ga0207667_101381152 338
243 3300025960 Ga0207651_10005229 Ga0207651_100052293 338
244 3300026041 Ga0207639_10001022 Ga0207639_1000102217 338
245 3300026041 Ga0207639_10014208 Ga0207639_100142086 338
246 3300026078 Ga0207702_10000088 Ga0207702_100000887 338
247 3300026078 Ga0207702_10015658 Ga0207702_100156582 338
248 3300026078 Ga0207702_10025309 Ga0207702_100253093 338
249 3300026078 Ga0207702_10414091 Ga0207702_104140911 338
250 3300026089 Ga0207648_10000459 Ga0207648_100004596 338
251 3300026089 Ga0207648_10226087 Ga0207648_102260872 338
252 3300026116 Ga0207674_10040744 Ga0207674_100407442 338
253 3300026116 Ga0207674_10156143 Ga0207674_101561432 338
254 3300026121 Ga0207683_10002362 Ga0207683_1000236212 338
255 3300026142 Ga0207698_10023382 Ga0207698_100233824 338
256 3300028379 Ga0268266_10000177 Ga0268266_1000017792 338
257 3300028786 Ga0307517_10000553 Ga0307517_1000055325 338
258 3300028794 Ga0307515_10000595 Ga0307515_1000059530 338
259 3300028794 Ga0307515_10001029 Ga0307515_1000102930 338
260 3300028794 Ga0307515_10234983 Ga0307515_102349831 338
261 3300028800 Ga0265338_10043721 Ga0265338_100437213 338
262 3300033179 Ga0307507_10001172 Ga0307507_1000117242 338
263 3300033180 Ga0307510_10000172 Ga0307510_100001723 338
264 3300037312 Ga0395899_0000017 Ga0395899_0000017_343210_344229 338
265 3300037312 Ga0395899_0000327 Ga0395899_0000327_25958_26977 338
266 3300037418 Ga0395900_0000197 Ga0395900_0000197_12170_13189 338
267 3300037418 Ga0395900_0000609 Ga0395900_0000609_16395_17414 338
268 3300037418 Ga0395900_0004982 Ga0395900_0004982_45_1064 338
269 3300037466 Ga0395898_0011895 Ga0395898_0011895_7494_8513 338
270 3300037471 Ga0395905_0000186 Ga0395905_0000186_89472_90491 338
271 3300038443 Ga0395901_0000368 Ga0395901_0000368_44266_45285 338
272 3300038443 Ga0395901_0131861 Ga0395901_0131861_431_1450 338
273 3300038443 Ga0395901_0153676 Ga0395901_0153676_312_1331 338
274 3300039447 Ga0436361_0967822 Ga0436361_0967822_5318_6337 338
275 3300042005 Ga0439448_0001244 Ga0439448_0001244_4388_5407 338
276 3300042876 Ga0451577_0014190 Ga0451577_0014190_6198_7247 338
277 3300044673 Ga0453683_0009891 Ga0453683_0009891_1105_2145 338
278 3300044684 Ga0466966_0011694 Ga0466966_0011694_790_1809 338
279 3300044693 Ga0466961_0074001 Ga0466961_0074001_549_1568 338
280 3300044712 Ga0453684_0000143 Ga0453684_0000143_213259_214308 338
281 3300044712 Ga0453684_0148477 Ga0453684_0148477_1244_2275 338
282 3300044712 Ga0453684_0352577 Ga0453684_0352577_426_1466 338
283 3300044842 Ga0466957_0200763 Ga0466957_0200763_213_1232 338
284 3300045049 Ga0466959_0006644 Ga0466959_0006644_2565_3584 338
285 3300045051 Ga0451576_0210561 Ga0451576_0210561_550_1599 338
286 3300045051 Ga0451576_0258771 Ga0451576_0258771_171_1211 338
287 3300045836 Ga0466958_0037793 Ga0466958_0037793_615_1634 338
288 3300046471 Ga0495650_0000225 Ga0495650_0000225_24674_25696 338
289 3300046471 Ga0495650_0024378 Ga0495650_0024378_86_1108 338
290 3300046492 Ga0495585_0000074 Ga0495585_0000074_28559_29581 338
291 3300046507 Ga0495606_0000074 Ga0495606_0000074_133954_134976 338
292 3300046507 Ga0495606_0011030 Ga0495606_0011030_5031_6053 338
293 3300046507 Ga0495606_0015802 Ga0495606_0015802_488_1510 338
294 3300046507 Ga0495606_0067679 Ga0495606_0067679_1100_2122 338
295 3300046512 Ga0495610_0001170 Ga0495610_0001170_8434_9456 338
296 3300046513 Ga0495616_0002088 Ga0495616_0002088_3625_4647 338
297 3300046518 Ga0495631_0005662 Ga0495631_0005662_206_1225 338
298 3300046518 Ga0495631_0016589 Ga0495631_0016589_1259_2281 338
299 3300046520 Ga0495637_0053489 Ga0495637_0053489_552_1574 338
300 3300046524 Ga0495648_0031261 Ga0495648_0031261_1256_2278 338
301 3300046538 Ga0495609_0014746 Ga0495609_0014746_450_1472 338
302 3300046557 Ga0495622_0034930 Ga0495622_0034930_375_1397 338
303 3300046558 Ga0495633_0000006 Ga0495633_0000006_299468_300490 338
304 3300046558 Ga0495633_0005495 Ga0495633_0005495_4783_5805 338
305 3300046616 Ga0495668_0000011 Ga0495668_0000011_287286_288308 338
306 3300046660 Ga0495625_0000067 Ga0495625_0000067_71013_72035 338
307 3300046660 Ga0495625_0000660 Ga0495625_0000660_23810_24832 338
308 3300046660 Ga0495625_0002214 Ga0495625_0002214_5230_6252 338
309 3300046660 Ga0495625_0020512 Ga0495625_0020512_1499_2521 338
310 3300046665 Ga0495661_0001183 Ga0495661_0001183_11148_12167 338
311 3300046665 Ga0495661_0003220 Ga0495661_0003220_7585_8607 338
312 3300046694 Ga0495649_0000054 Ga0495649_0000054_71025_72047 338
313 3300047323 Ga0495683_0038971 Ga0495683_0038971_1231_2253 338
314 3300047443 Ga0495687_001083 Ga0495687_001083_8075_9097 338
315 3300047443 Ga0495687_002879 Ga0495687_002879_921_1940 338
316 3300047447 Ga0495685_040045 Ga0495685_040045_241_1260 338
317 3300047469 Ga0495673_0035812 Ga0495673_0035812_924_1946 338
318 3300047472 Ga0495686_0000783 Ga0495686_0000783_5038_6057 338
319 3300047472 Ga0495686_0001252 Ga0495686_0001252_23864_24886 338
320 3300047472 Ga0495686_0108544 Ga0495686_0108544_352_1374 338
321 3300048089 Ga0495614_0072355 Ga0495614_0072355_188_1210 338
322 3300049459 Ga0495678_010512 Ga0495678_010512_302_1324 338
323 3300049571 Ga0501034_0037681 Ga0501034_0037681_2601_3647 338
324 3300049572 Ga0501036_0305702 Ga0501036_0305702_106_1152 338
325 3300049579 Ga0501043_0266503 Ga0501043_0266503_166_1212 338
326 3300049581 Ga0501047_0050690 Ga0501047_0050690_174_1220 338
327 3300049823 Ga0501044_0013100 Ga0501044_0013100_6552_7637 338
328 3300050493 nmdc:mga0k408_106_c1 nmdc:mga0k408_106_c1_18078_19100 338
329 3300050493 nmdc:mga0k408_3774_c1 nmdc:mga0k408_3774_c1_4549_5571 338
330 3300050493 nmdc:mga0k408_626_c1 nmdc:mga0k408_626_c1_5760_6800 338
331 3300053080 Ga0500635_0005805 Ga0500635_0005805_1764_2783 338
332 3300053122 Ga0500608_001805 Ga0500608_001805_3322_4341 338
333 3300053123 Ga0500614_004410 Ga0500614_004410_976_1998 338
334 3300053125 Ga0500618_000006 Ga0500618_000006_216905_217927 338
335 3300053156 Ga0500622_0000891 Ga0500622_0000891_18167_19189 338
336 3300053157 Ga0500624_000514 Ga0500624_000514_5593_6615 338
337 2162886007 SwRhRL2b_contig_1558989 SwRhRL2b_0404.00001450 339
338 3300003320 rootH2_10076019 rootH2_100760197 339
339 3300003323 rootH1_10007323 rootH1_1000732317 339
340 3300003354 JGI25160J50197_1007425 JGI25160J50197_10074252 339
341 3300009148 Ga0105243_10000003 Ga0105243_10000003541 339
342 3300013307 Ga0157372_10019416 Ga0157372_100194163 339
343 3300025284 Ga0209130_1003558 Ga0209130_10035582 339
344 3300025302 Ga0207426_1000415 Ga0207426_100041527 339
345 3300025935 Ga0207709_10000008 Ga0207709_1000000831 339
346 3300031548 Ga0307408_100001869 Ga0307408_10000186910 339
347 3300031548 Ga0307408_100001899 Ga0307408_10000189914 339
348 3300031548 Ga0307408_100013466 Ga0307408_1000134663 339
349 3300031731 Ga0307405_10110649 Ga0307405_101106492 339
350 3300031911 Ga0307412_10000925 Ga0307412_100009256 339
351 3300031911 Ga0307412_10022610 Ga0307412_100226102 339
352 3300032004 Ga0307414_10181002 Ga0307414_101810022 339
353 3300042014 Ga0439457_011387 Ga0439457_011387_286_1335 339
354 3300046558 Ga0495633_0000025 Ga0495633_0000025_125045_126085 339
355 3300048919 Ga0496116_0005899 Ga0496116_0005899_1969_2988 339
356 3300048920 Ga0496117_0005949 Ga0496117_0005949_1467_2486 339
357 3300048921 Ga0496118_0106467 Ga0496118_0106467_261_1280 339
358 3300048925 Ga0496122_0003774 Ga0496122_0003774_11695_12714 339
359 3300048926 Ga0496123_0018910 Ga0496123_0018910_797_1816 339
360 3300048929 Ga0496126_0377907 Ga0496126_0377907_107_1126 339
361 iso_pu_bacteria 2818991460 2819677351 339
362 iso_pu_bacteria 2945977869 2945979616 339
363 iso_pu_bacteria 2946013367 2946014517 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

233

348

0.98

PF00710

Asparaginase

Asparaginase, N-terminal

22

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r6b-assembly1.cif.gz_B crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis 0.935 1 336
5ot0-assembly2.cif.gz_D the thermostable l-asparaginase from thermococcus kodakarensis 0.9333 3 338
3ntx-assembly1.cif.gz_A crystal structure of l-asparaginase i from yersinia pestis 0.9325 2 338
2p2d-assembly1.cif.gz_B crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i 0.9318 1 338
2ocd-assembly1.cif.gz_A crystal structure of l-asparaginase i from vibrio cholerae o1 biovar eltor str. n16961 0.9302 2 337
ID Description Score Start End Superfamily
af_Q86I82_300_429_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9426 210 338 3.40.50.40
af_A4IDM2_236_364_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9374 213 336 3.40.50.40
af_Q4DZN4_253_381_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9362 213 336 3.40.50.40
2p2dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9315 210 338 3.40.50.40
af_Q86I82_300_429_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9289 210 338 3.40.50.40
ID Description Score Start End GO Terms
AF-A0A4R1LW28-F1-model_v4 L-asparaginase 0.9878 1 337 GO:0004067
GO:0006520
AF-A0A3D6ES15-F1-model_v4 L-asparaginase 1 0.9856 2 181 GO:0004067
AF-A0A349QW88-F1-model_v4 Type I asparaginase 0.9816 1 339 GO:0004067
GO:0006520
AF-A0A349D522-F1-model_v4 L-asparaginase 1 0.9814 2 338 GO:0004067
GO:0006520
AF-A0A1G9W9D9-F1-model_v4 L-asparaginase 0.9802 1 338 GO:0004067
GO:0006520

Feature Viewer

pLDDT pTM Quality
87.2 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map