F422923

General Info

Members Datasets Scaffolds Average Seq Length
363 236 726 403

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100263909|Ga0075428_1002639092
Length 453
Sequence MRAGPTQEEIRRHNLGTLLRYVHVRGPTSRAELTASLGLNRSTIGALTADLAAVGLVREEVPRGLGRAGRPSLVVQPEAERAYVYAFSIEVDRVVAARVGLGGVVLDRRELPRPRGDRPPEKVVAPLAEFVRETESTVPADSVCIGSAAAVSAIVRQEDGLVHLGGHIGWVDEPLGLAFAEALGEPGIVPSVRNGADLAALAEHTRGVAVGVDNVIFLHGDAGVGGGIIAAGRAVTGHGGYGGEVGHMAVNPQGRPCNCGSRGCWETEIGEFALVRAAGRDGTGSAAVAAVVDAANRGDAMAQAALRQVGDWLGFGVANLVNLFNPEMIIFGGTLRDVYLASAAQVRGRLNRMCLPAVREHVRLRTPALGNDALLLGAAELAFERLLADPIDVATGNPSDAADTSPLLAARVLPTVEPIGPSTDEGSEDGFDDLDGEGAATGRQVGSQPPAPA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
173 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 2501939600 Micromonospora sp. L5 Isolate Unclassified
177 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
178 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
179 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
180 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
181 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
182 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
183 2643221692 Nocardia sp. Root136 Isolate Unclassified
184 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
185 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
186 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
187 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
188 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
189 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
190 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
191 2855683550 Micromonospora sp. RP3T Isolate Unclassified
192 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
193 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
194 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
195 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
196 2858868258 Micromonospora sp. MH33 Isolate Unclassified
197 2858882152 Micromonospora noduli MED15 Isolate Nodule
198 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
199 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
200 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
201 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
202 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
203 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
204 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
205 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
206 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
207 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
208 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
209 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
210 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
211 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
212 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
213 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
214 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
215 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
216 2891562705 Microbispora tritici MT50 Isolate Unclassified
217 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
218 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
219 2902582711 Micromonospora sp. AP08 Isolate Unclassified
220 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
221 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
222 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
223 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
224 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
225 649633069 Micromonospora sp. L5 Isolate Unclassified
226 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
227 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
228 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
229 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
230 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
231 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
232 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
233 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
234 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
235 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
236 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.76
Metatranscriptomes 0.83
Isolates 23.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 3.03
Rhizoplane 5.51
Rhizosphere 67.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100263909 3300006844 Bacteria 1854
2 Ga0070658_10002689 3300005327 Bacteria 14789
3 Ga0070676_10029880 3300005328 Bacteria 3103
4 Ga0070683_100000178 3300005329 Bacteria 42148
5 Ga0070683_100075019 3300005329 Bacteria 3159
6 Ga0070683_100097539 3300005329 Bacteria 2765
7 Ga0070670_100004660 3300005331 Bacteria 11506
8 Ga0068869_100003684 3300005334 Bacteria 9423
9 Ga0070680_100022765 3300005336 Bacteria 4992
10 Ga0070680_100212808 3300005336 Bacteria 1631
11 Ga0070682_100001902 3300005337 Bacteria 11650
12 Ga0068868_100014790 3300005338 Bacteria 5760
13 Ga0068868_100064744 3300005338 Bacteria 2903
14 Ga0070691_10001852 3300005341 Bacteria 9222
15 Ga0070687_100040375 3300005343 Bacteria 2351
16 Ga0070661_100015369 3300005344 Bacteria 5402
17 Ga0070692_10004227 3300005345 Bacteria 5958
18 Ga0070692_10038023 3300005345 Bacteria 2450
19 Ga0070675_100001457 3300005354 Bacteria 17431
20 Ga0070671_100019887 3300005355 Bacteria 5471
21 Ga0070673_100066262 3300005364 Bacteria 2884
22 Ga0070659_100004227 3300005366 Bacteria 10253
23 Ga0070659_100017689 3300005366 Bacteria 5368
24 Ga0070659_100024505 3300005366 Bacteria 4625
25 Ga0070667_100161117 3300005367 Bacteria 1976
26 Ga0070714_100078582 3300005435 Bacteria 2868
27 Ga0070713_100003753 3300005436 Bacteria 10050
28 Ga0070701_10013629 3300005438 Bacteria 3704
29 Ga0070711_100100759 3300005439 Bacteria 2101
30 Ga0070700_100002400 3300005441 Bacteria 9552
31 Ga0070663_100010651 3300005455 Bacteria 5737
32 Ga0070663_100043171 3300005455 Bacteria 3172
33 Ga0070678_100003592 3300005456 Bacteria 8652
34 Ga0070678_100073837 3300005456 Bacteria 2561
35 Ga0070662_100052192 3300005457 Bacteria 2955
36 Ga0070685_10025691 3300005466 Bacteria 3243
37 Ga0070684_100006847 3300005535 Bacteria 8843
38 Ga0070684_100106897 3300005535 Bacteria 2506
39 Ga0070684_100177262 3300005535 Bacteria 1937
40 Ga0068853_100079557 3300005539 Bacteria 2867
41 Ga0070672_100204188 3300005543 Bacteria 1653
42 Ga0070693_100003997 3300005547 Bacteria 6928
43 Ga0070665_100018609 3300005548 Bacteria 6962
44 Ga0070665_100139510 3300005548 Bacteria 2428
45 Ga0068855_100171322 3300005563 Bacteria 2458
46 Ga0068855_100206325 3300005563 Bacteria 2211
47 Ga0070664_100004461 3300005564 Bacteria 11241
48 Ga0070664_100108658 3300005564 Bacteria 2419
49 Ga0068857_100015216 3300005577 Bacteria 6714
50 Ga0068857_100020522 3300005577 Bacteria 5812
51 Ga0068854_100052205 3300005578 Bacteria 2932
52 Ga0068856_100013838 3300005614 Bacteria 7800
53 Ga0068856_100274316 3300005614 Bacteria 1702
54 Ga0070702_100000119 3300005615 Bacteria 23939
55 Ga0068852_100015013 3300005616 Bacteria 5987
56 Ga0068859_100110540 3300005617 Bacteria 2810
57 Ga0068864_100017545 3300005618 Bacteria 5968
58 Ga0068864_100086129 3300005618 Bacteria 2763
59 Ga0068864_100124039 3300005618 Bacteria 2312
60 Ga0068851_10013244 3300005834 Bacteria 3902
61 Ga0068870_10002831 3300005840 Bacteria 7303
62 Ga0068863_100003025 3300005841 Bacteria 16623
63 Ga0068858_100030545 3300005842 Bacteria 5003
64 Ga0068858_100082932 3300005842 Bacteria 2981
65 Ga0068860_100012692 3300005843 Bacteria 8288
66 Ga0068862_100016023 3300005844 Bacteria 6233
67 Ga0081540_1012406 3300005983 Bacteria 5616
68 Ga0081540_1018418 3300005983 Bacteria 4284
69 Ga0081539_10000109 3300005985 Bacteria 193696
70 Ga0081539_10002745 3300005985 Bacteria 23743
71 Ga0070717_10105199 3300006028 Bacteria 2402
72 Ga0075364_10060709 3300006051 Bacteria 2479
73 Ga0097621_100008635 3300006237 Bacteria 7350
74 Ga0068871_100017996 3300006358 Bacteria 5361
75 Ga0075428_100016867 3300006844 Bacteria 8065
76 Ga0075428_100022493 3300006844 Bacteria 6981
77 Ga0075428_100255343 3300006844 Bacteria 1888
78 Ga0075430_100035145 3300006846 Bacteria 4253
79 Ga0075431_100011689 3300006847 Bacteria 8857
80 Ga0075431_100012544 3300006847 Bacteria 8553
81 Ga0075434_100010272 3300006871 Bacteria 8773
82 Ga0075429_100006985 3300006880 Bacteria 9809
83 Ga0097620_100110539 3300006931 Bacteria 2810
84 Ga0075435_100002027 3300007076 Bacteria 13255
85 Ga0111539_10001552 3300009094 Bacteria 30584
86 Ga0111539_10035968 3300009094 Bacteria 5991
87 Ga0111539_10318816 3300009094 Bacteria 1809
88 Ga0105245_10006713 3300009098 Bacteria 10095
89 Ga0105247_10069905 3300009101 Bacteria 2192
90 Ga0114129_10000154 3300009147 Bacteria 73220
91 Ga0114129_10022718 3300009147 Bacteria 8895
92 Ga0114129_10182762 3300009147 Bacteria 2852
93 Ga0105243_10198296 3300009148 Bacteria 1759
94 Ga0105241_10011145 3300009174 Bacteria 6591
95 Ga0105248_10043955 3300009177 Bacteria 5010
96 Ga0105248_10274193 3300009177 Bacteria 1899
97 Ga0105239_10041251 3300010375 Bacteria 5058
98 Ga0105246_10005081 3300011119 Bacteria 8007
99 Ga0157370_10014682 3300013104 Bacteria 8000
100 Ga0157369_10011663 3300013105 Bacteria 9981
101 Ga0163163_10068390 3300014325 Bacteria 3534
102 Ga0157377_10004223 3300014745 Bacteria 6579
103 Ga0157376_10309670 3300014969 Bacteria 1498
104 Ga0206354_10551526 3300020081 Bacteria 2247
105 Ga0206353_10153946 3300020082 Bacteria 4983
106 Ga0206353_11017364 3300020082 Bacteria 2749
107 Ga0207710_10025373 3300025900 Bacteria 2557
108 Ga0207688_10005360 3300025901 Bacteria 6963
109 Ga0207643_10000117 3300025908 Bacteria 54338
110 Ga0207705_10006784 3300025909 Bacteria 8464
111 Ga0207705_10025227 3300025909 Bacteria 4244
112 Ga0207654_10056663 3300025911 Bacteria 2274
113 Ga0207707_10005487 3300025912 Bacteria 11087
114 Ga0207707_10012940 3300025912 Bacteria 7263
115 Ga0207660_10005341 3300025917 Bacteria 8345
116 Ga0207660_10194879 3300025917 Bacteria 1580
117 Ga0207662_10036836 3300025918 Bacteria 2861
118 Ga0207657_10007220 3300025919 Bacteria 11410
119 Ga0207649_10005154 3300025920 Bacteria 7062
120 Ga0207649_10013218 3300025920 Bacteria 4607
121 Ga0207652_10023163 3300025921 Bacteria 5142
122 Ga0207652_10027114 3300025921 Bacteria 4773
123 Ga0207694_10107177 3300025924 Bacteria 2220
124 Ga0207650_10000493 3300025925 Bacteria 32882
125 Ga0207650_10091823 3300025925 Bacteria 2321
126 Ga0207659_10002345 3300025926 Bacteria 11276
127 Ga0207659_10006521 3300025926 Bacteria 7157
128 Ga0207687_10008336 3300025927 Bacteria 6782
129 Ga0207687_10009573 3300025927 Bacteria 6337
130 Ga0207687_10192295 3300025927 Bacteria 1589
131 Ga0207644_10006761 3300025931 Bacteria 7474
132 Ga0207690_10006440 3300025932 Bacteria 6959
133 Ga0207691_10057899 3300025940 Bacteria 3526
134 Ga0207691_10164842 3300025940 Bacteria 1942
135 Ga0207711_10014997 3300025941 Bacteria 6436
136 Ga0207689_10075455 3300025942 Bacteria 2771
137 Ga0207661_10002733 3300025944 Bacteria 12142
138 Ga0207661_10004319 3300025944 Bacteria 9947
139 Ga0207661_10005874 3300025944 Bacteria 8661
140 Ga0207661_10066897 3300025944 Bacteria 2920
141 Ga0207679_10002230 3300025945 Bacteria 11971
142 Ga0207679_10015400 3300025945 Bacteria 5051
143 Ga0207679_10025117 3300025945 Bacteria 4094
144 Ga0207679_10064465 3300025945 Bacteria 2739
145 Ga0207668_10002588 3300025972 Bacteria 10573
146 Ga0207668_10065920 3300025972 Bacteria 2565
147 Ga0207677_10005146 3300026023 Bacteria 7077
148 Ga0207703_10013216 3300026035 Bacteria 6431
149 Ga0207703_10014677 3300026035 Bacteria 6113
150 Ga0207703_10135647 3300026035 Bacteria 2130
151 Ga0207639_10056199 3300026041 Bacteria 3016
152 Ga0207678_10039829 3300026067 Bacteria 4076
153 Ga0207708_10004938 3300026075 Bacteria 9832
154 Ga0207702_10002078 3300026078 Bacteria 19339
155 Ga0207702_10011057 3300026078 Bacteria 7534
156 Ga0207641_10021266 3300026088 Bacteria 5333
157 Ga0207641_10137982 3300026088 Bacteria 2197
158 Ga0207676_10001839 3300026095 Bacteria 15547
159 Ga0207676_10044380 3300026095 Bacteria 3429
160 Ga0207676_10108853 3300026095 Bacteria 2314
161 Ga0207674_10015152 3300026116 Bacteria 8484
162 Ga0207674_10021898 3300026116 Bacteria 6876
163 Ga0207674_10064597 3300026116 Bacteria 3691
164 Ga0207674_10194159 3300026116 Bacteria 1980
165 Ga0207675_100045078 3300026118 Bacteria 4120
166 Ga0207683_10001487 3300026121 Bacteria 21129
167 Ga0207683_10151494 3300026121 Bacteria 2093
168 Ga0207698_10006951 3300026142 Bacteria 7080
169 Ga0207698_10027305 3300026142 Bacteria 4051
170 Ga0207428_10008608 3300027907 Bacteria 9211
171 Ga0207428_10017718 3300027907 Bacteria 6109
172 Ga0268266_10189219 3300028379 Bacteria 1878
173 Ga0268266_10240983 3300028379 Bacteria 1669
174 Ga0268265_10009378 3300028380 Bacteria 6614
175 Ga0268265_10101157 3300028380 Bacteria 2328
176 Ga0268264_10105480 3300028381 Bacteria 2458
177 Ga0307517_10042973 3300028786 Bacteria 4828
178 Ga0307515_10000315 3300028794 Bacteria 119286
179 Ga0307515_10004319 3300028794 Bacteria 29492
180 Ga0307515_10016487 3300028794 Bacteria 13517
181 Ga0307515_10027940 3300028794 Bacteria 9612
182 Ga0307515_10187838 3300028794 Bacteria 1989
183 Ga0307512_10004312 3300030522 Bacteria 15691
184 Ga0307512_10004393 3300030522 Bacteria 15496
185 Ga0307513_10017967 3300031456 Bacteria 8467
186 Ga0307513_10020561 3300031456 Bacteria 7826
187 Ga0307513_10026855 3300031456 Bacteria 6623
188 Ga0307408_100113609 3300031548 Bacteria 2085
189 Ga0307508_10006849 3300031616 Bacteria 10662
190 Ga0307508_10044444 3300031616 Bacteria 3974
191 Ga0307508_10057448 3300031616 Bacteria 3443
192 Ga0307508_10079056 3300031616 Bacteria 2869
193 Ga0307516_10003329 3300031730 Bacteria 20796
194 Ga0307516_10009199 3300031730 Bacteria 11057
195 Ga0307516_10074224 3300031730 Bacteria 3257
196 Ga0307516_10179993 3300031730 Bacteria 1848
197 Ga0307405_10000332 3300031731 Bacteria 17545
198 Ga0307405_10011619 3300031731 Bacteria 4627
199 Ga0307413_10011003 3300031824 Bacteria 4422
200 Ga0307413_10058217 3300031824 Bacteria 2367
201 Ga0326468_10000342 3300031889 Bacteria 4926
202 Ga0307406_10015712 3300031901 Bacteria 4387
203 Ga0307406_10026422 3300031901 Bacteria 3486
204 Ga0307406_10117011 3300031901 Bacteria 1846
205 Ga0307409_100004155 3300031995 Bacteria 8061
206 Ga0307409_100004780 3300031995 Bacteria 7680
207 Ga0307409_100018324 3300031995 Bacteria 4703
208 Ga0307416_100004234 3300032002 Bacteria 8614
209 Ga0307416_100216702 3300032002 Bacteria 1832
210 Ga0307411_10087320 3300032005 Bacteria 2166
211 Ga0307415_100000013 3300032126 Bacteria 84168
212 Ga0307415_100010132 3300032126 Bacteria 5321
213 Ga0307415_100029495 3300032126 Bacteria 3507
214 Ga0307415_100052978 3300032126 Bacteria 2762
215 Ga0307415_100096672 3300032126 Bacteria 2153
216 Ga0373951_0000900 3300035091 Bacteria 8007
217 Ga0373953_0003593 3300035117 Bacteria 4851
218 Ga0373943_0010067 3300035170 Bacteria 4240
219 Ga0373942_0000941 3300035207 Bacteria 7950
220 Ga0373935_0001574 3300035692 Bacteria 12720
221 Ga0395901_0109696 3300038443 Bacteria 2897
222 Ga0451791_0506791 3300041451 Bacteria 2291
223 Ga0451853_0980202 3300041512 Bacteria 5904
224 Ga0466966_0008166 3300044684 Bacteria 6938
225 Ga0466961_0015897 3300044693 Bacteria 4830
226 Ga0466961_0094863 3300044693 Bacteria 1882
227 Ga0466971_0012989 3300044719 Bacteria 3654
228 Ga0466959_0104193 3300045049 Bacteria 2029
229 Ga0466958_0015200 3300045836 Bacteria 4406
230 Ga0495594_0022838 3300046499 Bacteria 3349
231 Ga0495594_0032131 3300046499 Bacteria 2848
232 Ga0495632_0060242 3300046519 Bacteria 1845
233 Ga0495625_0000956 3300046660 Bacteria 38568
234 Ga0495626_0000148 3300048091 Bacteria 86787
235 Ga0496104_0006768 3300048907 Bacteria 10095
236 Ga0496104_0008768 3300048907 Bacteria 8991
237 Ga0496104_0124786 3300048907 Bacteria 2472
238 Ga0496105_0004191 3300048908 Bacteria 10828
239 Ga0496105_0099485 3300048908 Bacteria 2402
240 Ga0496106_0060002 3300048909 Bacteria 2883
241 Ga0496108_0000043 3300048911 Bacteria 146005
242 Ga0496108_0001459 3300048911 Bacteria 18696
243 Ga0496108_0017542 3300048911 Bacteria 5858
244 Ga0496109_0045788 3300048912 Bacteria 3971
245 Ga0496110_0042836 3300048913 Bacteria 3951
246 Ga0496110_0050907 3300048913 Bacteria 3639
247 Ga0496111_0003674 3300048914 Bacteria 9529
248 Ga0496112_0016117 3300048915 Bacteria 6988
249 Ga0496112_0064133 3300048915 Bacteria 3624
250 Ga0496113_0001314 3300048916 Bacteria 13737
251 Ga0496113_0036021 3300048916 Bacteria 3623
252 Ga0496113_0130342 3300048916 Bacteria 1973
253 Ga0496115_0056311 3300048918 Bacteria 3160
254 Ga0501047_0012435 3300049581 Bacteria 8058
255 Ga0501047_0092887 3300049581 Bacteria 2896
256 nmdc:mga00v17_90680_c1 3300050491 Bacteria 1919
257 nmdc:mga05p37_379565_c1 3300050507 Bacteria 1657
258 nmdc:mga05p37_46892_c1 3300050507 Bacteria 5314
259 nmdc:mga05p37_79512_c1 3300050507 Bacteria 4037
260 nmdc:mga09592_317757_c1 3300050508 Bacteria 1349
261 nmdc:mga09592_5888_c1 3300050508 Bacteria 10006
262 nmdc:mga0qj67_18395_c1 3300050509 Bacteria 5325
263 nmdc:mga06r32_14548_c1 3300050510 Bacteria 7141
264 nmdc:mga06r32_455711_c1 3300050510 Bacteria 1258
265 nmdc:mga06r32_55332_c1 3300050510 Bacteria 3806
266 nmdc:mga0rr50_1772_c1 3300050513 Bacteria 11923
267 nmdc:mga08x19_16537_c1 3300050514 Bacteria 4500
268 Ga0495601_0017260 3300053077 Bacteria 4380
269 Ga0495612_0015274 3300053078 Bacteria 3079
270 Ga0500644_0002652 3300053088 Bacteria 4467
271 Ga0500583_0032204 3300053092 Bacteria 2311
272 Ga0500641_0007143 3300053096 Bacteria 3977
273 Ga0500594_0007116 3300053118 Bacteria 2528
274 Ga0500652_044381 3300053131 Bacteria 1799
275 Ga0500573_0031644 3300053140 Bacteria 3054
276 Ga0500588_0018339 3300053146 Bacteria 1842
277 Ga0501084_0113168 3300054114 Bacteria 2281
278 Ga0466962_0010899 3300061719 Bacteria 4371
279 2501943302 2501939600 Bacteria 6907073
280 2515496624 2515154088 Bacteria 5526283
281 2515718374 2515154129 Bacteria 5584369
282 2515756863 2515154137 Bacteria 5711575
283 2516089401 2515154203 Bacteria 5458536
284 2552106321 2551306166 Bacteria 9731570
285 2623584953 2622736626 Bacteria 7181580
286 2644518328 2643221692 Bacteria 7282860
287 2676490760 2675903060 Bacteria 10051191
288 2753265235 2751185782 Bacteria 11227053
289 2772644612 2772190715 Bacteria 6959372
290 2772644973 2772190715 Bacteria 6959372
291 2831941033 2831935698 Bacteria 5963223
292 2832006129 2832004796 Bacteria 6538017
293 2855672896 2855670206 Bacteria 7120389
294 2855674503 2855670206 Bacteria 7120389
295 2855678201 2855676851 Bacteria 7063653
296 2855680222 2855676851 Bacteria 7063653
297 2855685908 2855683550 Bacteria 7134265
298 2856745024 2856741275 Bacteria 8096094
299 2856858784 2856858025 Bacteria 7255264
300 2857291243 2857288857 Bacteria 7189066
301 2857291712 2857288857 Bacteria 7189066
302 2858849737 2858848962 Bacteria 6963058
303 2858855128 2858848962 Bacteria 6963058
304 2858868975 2858868258 Bacteria 7683772
305 2858885642 2858882152 Bacteria 7230291
306 2858886068 2858882152 Bacteria 7230291
307 2858889375 2858888857 Bacteria 7060307
308 2858890059 2858888857 Bacteria 7060307
309 2858897711 2858895516 Bacteria 7378898
310 2858900586 2858895516 Bacteria 7378898
311 2858903012 2858902515 Bacteria 7086037
312 2858906765 2858902515 Bacteria 7086037
313 2861525148 2861520306 Bacteria 8348283
314 2866067385 2866065130 Bacteria 6518152
315 2867302700 2867302475 Bacteria 7087181
316 2867307087 2867302475 Bacteria 7087181
317 2867314390 2867312974 Bacteria 7058875
318 2867316525 2867312974 Bacteria 7058875
319 2867321719 2867319477 Bacteria 7069771
320 2867323218 2867319477 Bacteria 7069771
321 2867512002 2867507094 Bacteria 6506033
322 2869048722 2869048445 Bacteria 6875584
323 2869052857 2869048445 Bacteria 6875584
324 2869064448 2869061728 Bacteria 7112407
325 2869065448 2869061728 Bacteria 7112407
326 2869069811 2869068681 Bacteria 7205615
327 2869074437 2869068681 Bacteria 7205615
328 2880492455 2880489317 Bacteria 7096270
329 2880495310 2880489317 Bacteria 7096270
330 2880497041 2880495981 Bacteria 7340502
331 2880499843 2880495981 Bacteria 7340502
332 2884701377 2884693830 Bacteria 11273186
333 2887485762 2887478801 Bacteria 8972725
334 2891403341 2891395885 Bacteria 9251614
335 2891556901 2891554331 Bacteria 8812224
336 2891569227 2891562705 Bacteria 8039471
337 2895437194 2895427314 Bacteria 13147766
338 2895442733 2895442618 Bacteria 11027144
339 2902583675 2902582711 Bacteria 6187705
340 2929221743 2929219909 Bacteria 6984360
341 2929225637 2929219909 Bacteria 6984360
342 2929228409 2929226422 Bacteria 7248583
343 2929231385 2929226422 Bacteria 7248583
344 2996223791 2996221748 Bacteria 6799777
345 2996224046 2996221748 Bacteria 6799777
346 3003003194 3002998708 Bacteria 11715108
347 3006429450 3006425503 Bacteria 6491253
348 649810694 649633069 Bacteria 6962533
349 8001785101 8001781756 Bacteria 9586736
350 8003835850 8003830390 Bacteria 6541657
351 8003862605 8003856774 Bacteria 7675274
352 8003871049 8003870546 Bacteria 7396674
353 8003876976 8003870546 Bacteria 7396674
354 8053946852 8053945823 Bacteria 8962862
355 8054706625 8054704163 Bacteria 7247792
356 8054707277 8054704163 Bacteria 7247792
357 8054728706 8054727385 Bacteria 7558670
358 8054733769 8054727385 Bacteria 7558670
359 8054738529 8054734606 Bacteria 6947278
360 8054740671 8054734606 Bacteria 6947278
361 8055073474 8055066027 Bacteria 9479577
362 8055174351 8055172936 Bacteria 9305943
363 8055414007 8055412473 Bacteria 6257500
364 Ga0075428_100263909
365 Ga0070658_10002689
366 Ga0070676_10029880
367 Ga0070683_100000178
368 Ga0070683_100075019
369 Ga0070683_100097539
370 Ga0070670_100004660
371 Ga0068869_100003684
372 Ga0070680_100022765
373 Ga0070680_100212808
374 Ga0070682_100001902
375 Ga0068868_100014790
376 Ga0068868_100064744
377 Ga0070691_10001852
378 Ga0070687_100040375
379 Ga0070661_100015369
380 Ga0070692_10004227
381 Ga0070692_10038023
382 Ga0070675_100001457
383 Ga0070671_100019887
384 Ga0070673_100066262
385 Ga0070659_100004227
386 Ga0070659_100017689
387 Ga0070659_100024505
388 Ga0070667_100161117
389 Ga0070714_100078582
390 Ga0070713_100003753
391 Ga0070701_10013629
392 Ga0070711_100100759
393 Ga0070700_100002400
394 Ga0070663_100010651
395 Ga0070663_100043171
396 Ga0070678_100003592
397 Ga0070678_100073837
398 Ga0070662_100052192
399 Ga0070685_10025691
400 Ga0070684_100006847
401 Ga0070684_100106897
402 Ga0070684_100177262
403 Ga0068853_100079557
404 Ga0070672_100204188
405 Ga0070693_100003997
406 Ga0070665_100018609
407 Ga0070665_100139510
408 Ga0068855_100171322
409 Ga0068855_100206325
410 Ga0070664_100004461
411 Ga0070664_100108658
412 Ga0068857_100015216
413 Ga0068857_100020522
414 Ga0068854_100052205
415 Ga0068856_100013838
416 Ga0068856_100274316
417 Ga0070702_100000119
418 Ga0068852_100015013
419 Ga0068859_100110540
420 Ga0068864_100017545
421 Ga0068864_100086129
422 Ga0068864_100124039
423 Ga0068851_10013244
424 Ga0068870_10002831
425 Ga0068863_100003025
426 Ga0068858_100030545
427 Ga0068858_100082932
428 Ga0068860_100012692
429 Ga0068862_100016023
430 Ga0081540_1012406
431 Ga0081540_1018418
432 Ga0081539_10000109
433 Ga0081539_10002745
434 Ga0070717_10105199
435 Ga0075364_10060709
436 Ga0097621_100008635
437 Ga0068871_100017996
438 Ga0075428_100016867
439 Ga0075428_100022493
440 Ga0075428_100255343
441 Ga0075430_100035145
442 Ga0075431_100011689
443 Ga0075431_100012544
444 Ga0075434_100010272
445 Ga0075429_100006985
446 Ga0097620_100110539
447 Ga0075435_100002027
448 Ga0111539_10001552
449 Ga0111539_10035968
450 Ga0111539_10318816
451 Ga0105245_10006713
452 Ga0105247_10069905
453 Ga0114129_10000154
454 Ga0114129_10022718
455 Ga0114129_10182762
456 Ga0105243_10198296
457 Ga0105241_10011145
458 Ga0105248_10043955
459 Ga0105248_10274193
460 Ga0105239_10041251
461 Ga0105246_10005081
462 Ga0157370_10014682
463 Ga0157369_10011663
464 Ga0163163_10068390
465 Ga0157377_10004223
466 Ga0157376_10309670
467 Ga0206354_10551526
468 Ga0206353_10153946
469 Ga0206353_11017364
470 Ga0207710_10025373
471 Ga0207688_10005360
472 Ga0207643_10000117
473 Ga0207705_10006784
474 Ga0207705_10025227
475 Ga0207654_10056663
476 Ga0207707_10005487
477 Ga0207707_10012940
478 Ga0207660_10005341
479 Ga0207660_10194879
480 Ga0207662_10036836
481 Ga0207657_10007220
482 Ga0207649_10005154
483 Ga0207649_10013218
484 Ga0207652_10023163
485 Ga0207652_10027114
486 Ga0207694_10107177
487 Ga0207650_10000493
488 Ga0207650_10091823
489 Ga0207659_10002345
490 Ga0207659_10006521
491 Ga0207687_10008336
492 Ga0207687_10009573
493 Ga0207687_10192295
494 Ga0207644_10006761
495 Ga0207690_10006440
496 Ga0207691_10057899
497 Ga0207691_10164842
498 Ga0207711_10014997
499 Ga0207689_10075455
500 Ga0207661_10002733
501 Ga0207661_10004319
502 Ga0207661_10005874
503 Ga0207661_10066897
504 Ga0207679_10002230
505 Ga0207679_10015400
506 Ga0207679_10025117
507 Ga0207679_10064465
508 Ga0207668_10002588
509 Ga0207668_10065920
510 Ga0207677_10005146
511 Ga0207703_10013216
512 Ga0207703_10014677
513 Ga0207703_10135647
514 Ga0207639_10056199
515 Ga0207678_10039829
516 Ga0207708_10004938
517 Ga0207702_10002078
518 Ga0207702_10011057
519 Ga0207641_10021266
520 Ga0207641_10137982
521 Ga0207676_10001839
522 Ga0207676_10044380
523 Ga0207676_10108853
524 Ga0207674_10015152
525 Ga0207674_10021898
526 Ga0207674_10064597
527 Ga0207674_10194159
528 Ga0207675_100045078
529 Ga0207683_10001487
530 Ga0207683_10151494
531 Ga0207698_10006951
532 Ga0207698_10027305
533 Ga0207428_10008608
534 Ga0207428_10017718
535 Ga0268266_10189219
536 Ga0268266_10240983
537 Ga0268265_10009378
538 Ga0268265_10101157
539 Ga0268264_10105480
540 Ga0307517_10042973
541 Ga0307515_10000315
542 Ga0307515_10004319
543 Ga0307515_10016487
544 Ga0307515_10027940
545 Ga0307515_10187838
546 Ga0307512_10004312
547 Ga0307512_10004393
548 Ga0307513_10017967
549 Ga0307513_10020561
550 Ga0307513_10026855
551 Ga0307408_100113609
552 Ga0307508_10006849
553 Ga0307508_10044444
554 Ga0307508_10057448
555 Ga0307508_10079056
556 Ga0307516_10003329
557 Ga0307516_10009199
558 Ga0307516_10074224
559 Ga0307516_10179993
560 Ga0307405_10000332
561 Ga0307405_10011619
562 Ga0307413_10011003
563 Ga0307413_10058217
564 Ga0326468_10000342
565 Ga0307406_10015712
566 Ga0307406_10026422
567 Ga0307406_10117011
568 Ga0307409_100004155
569 Ga0307409_100004780
570 Ga0307409_100018324
571 Ga0307416_100004234
572 Ga0307416_100216702
573 Ga0307411_10087320
574 Ga0307415_100000013
575 Ga0307415_100010132
576 Ga0307415_100029495
577 Ga0307415_100052978
578 Ga0307415_100096672
579 Ga0373951_0000900
580 Ga0373953_0003593
581 Ga0373943_0010067
582 Ga0373942_0000941
583 Ga0373935_0001574
584 Ga0395901_0109696
585 Ga0451791_0506791
586 Ga0451853_0980202
587 Ga0466966_0008166
588 Ga0466961_0015897
589 Ga0466961_0094863
590 Ga0466971_0012989
591 Ga0466959_0104193
592 Ga0466958_0015200
593 Ga0495594_0022838
594 Ga0495594_0032131
595 Ga0495632_0060242
596 Ga0495625_0000956
597 Ga0495626_0000148
598 Ga0496104_0006768
599 Ga0496104_0008768
600 Ga0496104_0124786
601 Ga0496105_0004191
602 Ga0496105_0099485
603 Ga0496106_0060002
604 Ga0496108_0000043
605 Ga0496108_0001459
606 Ga0496108_0017542
607 Ga0496109_0045788
608 Ga0496110_0042836
609 Ga0496110_0050907
610 Ga0496111_0003674
611 Ga0496112_0016117
612 Ga0496112_0064133
613 Ga0496113_0001314
614 Ga0496113_0036021
615 Ga0496113_0130342
616 Ga0496115_0056311
617 Ga0501047_0012435
618 Ga0501047_0092887
619 nmdc:mga00v17_90680_c1
620 nmdc:mga05p37_379565_c1
621 nmdc:mga05p37_46892_c1
622 nmdc:mga05p37_79512_c1
623 nmdc:mga09592_317757_c1
624 nmdc:mga09592_5888_c1
625 nmdc:mga0qj67_18395_c1
626 nmdc:mga06r32_14548_c1
627 nmdc:mga06r32_455711_c1
628 nmdc:mga06r32_55332_c1
629 nmdc:mga0rr50_1772_c1
630 nmdc:mga08x19_16537_c1
631 Ga0495601_0017260
632 Ga0495612_0015274
633 Ga0500644_0002652
634 Ga0500583_0032204
635 Ga0500641_0007143
636 Ga0500594_0007116
637 Ga0500652_044381
638 Ga0500573_0031644
639 Ga0500588_0018339
640 Ga0501084_0113168
641 Ga0466962_0010899
642 2501943302
643 2515496624
644 2515718374
645 2515756863
646 2516089401
647 2552106321
648 2623584953
649 2644518328
650 2676490760
651 2753265235
652 2772644612
653 2772644973
654 2831941033
655 2832006129
656 2855672896
657 2855674503
658 2855678201
659 2855680222
660 2855685908
661 2856745024
662 2856858784
663 2857291243
664 2857291712
665 2858849737
666 2858855128
667 2858868975
668 2858885642
669 2858886068
670 2858889375
671 2858890059
672 2858897711
673 2858900586
674 2858903012
675 2858906765
676 2861525148
677 2866067385
678 2867302700
679 2867307087
680 2867314390
681 2867316525
682 2867321719
683 2867323218
684 2867512002
685 2869048722
686 2869052857
687 2869064448
688 2869065448
689 2869069811
690 2869074437
691 2880492455
692 2880495310
693 2880497041
694 2880499843
695 2884701377
696 2887485762
697 2891403341
698 2891556901
699 2891569227
700 2895437194
701 2895442733
702 2902583675
703 2929221743
704 2929225637
705 2929228409
706 2929231385
707 2996223791
708 2996224046
709 3003003194
710 3006429450
711 649810694
712 8001785101
713 8003835850
714 8003862605
715 8003871049
716 8003876976
717 8053946852
718 8054706625
719 8054707277
720 8054728706
721 8054733769
722 8054738529
723 8054740671
724 8055073474
725 8055174351
726 8055414007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

85

385

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rdp-assembly1.cif.gz_A-2 the structure of a marr family protein from bacillus stearothermophilus 0.9206 15 77
3f3x-assembly1.cif.gz_A-2 crystal structure of the transcriptional regulator bldr from sulfolobus solfataricus 0.9192 14 77
4g9y-assembly1.cif.gz_A-2 crystal structure of the pcav transcriptional regulator from streptomyces coelicolor 0.9179 14 77
5yhz-assembly1.cif.gz_A-2 structure of lactococcus lactis zitr, e41a mutant 0.9175 14 77
2qww-assembly3.cif.gz_F crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9138 14 78
ID Description Score Start End Superfamily
3bddD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9879 14 58 1.10.10.10
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9315 14 78 1.10.10.10
5tjjB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9245 10 60 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9211 14 77 1.10.10.10
1z91A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9205 14 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A662E800-F1-model_v4 ROK family protein 0.9336 10 392 GO:0003824
AF-A0A358DD38-F1-model_v4 Transcriptional regulator 0.9332 5 113
AF-A0A1J4XIT4-F1-model_v4 Glucokinase 0.9202 172 380 GO:0003824
AF-A0A6H1W267-F1-model_v4 ROK family protein 0.9157 1 389 GO:0003824
AF-G8S9D4-F1-model_v4 ROK family protein 0.9132 15 387 GO:0003824

Map