F422797

General Info

Members Datasets Scaffolds Average Seq Length
362 241 724 205

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_101066|Ga0500562_101066_110_745
Length 211
Sequence MKLYYSPGACSLAGRISLHEAGLAAEFERVDLKTKFTEQGYDFNAINPRGGYVPMLVLDDGDAVTENIAVLELIADREPKLAPGGPLGRTRLLEMLSYLSTELHIAFKPYFHDASEAEKAVAGEAVARRLDVIAERINELYLFGPRFTVADAYLFVMLRWANGFGVRMTPEMHAYFERVAERKTVRRALAEEGLPEARPSPIDTTSFEALT

Samples

Sample ID Description Type Environment
1 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
240 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
241 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.99
Nodule 0
Rhizoplane 2.49
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500562_101066 3300053108 Bacteria 785
2 JGI24741J21665_1008826 3300001915 Bacteria 1882
3 JGI24740J21852_10026641 3300001979 Bacteria 1934
4 JGI24739J22299_10030019 3300001989 Bacteria 1886
5 JGI24737J22298_10050645 3300001990 Bacteria 1262
6 JGI24743J22301_10025163 3300001991 Bacteria 1152
7 JGI24738J21930_10006387 3300002075 Bacteria 2768
8 JGI24742J22300_10011059 3300002244 Bacteria 1496
9 JGI25151J46595_10064022 3300003187 Bacteria 1153
10 JGI25153J46596_10000043 3300003215 Bacteria 156407
11 JGI25153J46596_10001324 3300003215 Bacteria 14825
12 JGI25153J46596_10008045 3300003215 Bacteria 5095
13 rootH2_10105031 3300003320 Bacteria 2167
14 rootL2_10133432 3300003322 Bacteria 2037
15 rootL2_10291916 3300003322 Bacteria 1196
16 Ga0055525_1000076 3300003759 Bacteria 168820
17 Ga0055542_1008121 3300003762 Bacteria 2072
18 Ga0055526_1004195 3300003771 Bacteria 8756
19 Ga0055537_1000993 3300003773 Bacteria 12842
20 Ga0055524_1000380 3300003775 Bacteria 38491
21 Ga0055536_1039819 3300003781 Bacteria 1125
22 Ga0055530_10000043 3300003791 Bacteria 111112
23 Ga0055530_10007410 3300003791 Bacteria 4630
24 Ga0055530_10014709 3300003791 Bacteria 2591
25 Ga0055530_10047668 3300003791 Bacteria 1011
26 Ga0055540_1005974 3300003792 Bacteria 4944
27 Ga0055531_10000008 3300003794 Bacteria 222269
28 Ga0055531_10037816 3300003794 Bacteria 1460
29 Ga0055531_10037827 3300003794 Bacteria 1460
30 Ga0055531_10041614 3300003794 Bacteria 1327
31 Ga0055543_1016526 3300004625 Bacteria 1403
32 Ga0065165_1000597 3300005262 Bacteria 52857
33 Ga0065165_1001549 3300005262 Bacteria 23975
34 Ga0065165_1005474 3300005262 Bacteria 7110
35 Ga0070658_10023800 3300005327 Bacteria 4912
36 Ga0070676_10000871 3300005328 Bacteria 14897
37 Ga0070670_100061878 3300005331 Bacteria 3213
38 Ga0068869_100000163 3300005334 Bacteria 33165
39 Ga0068869_100073395 3300005334 Bacteria 2537
40 Ga0070680_100073601 3300005336 Bacteria 2810
41 Ga0068868_100000342 3300005338 Bacteria 31545
42 Ga0068868_100142299 3300005338 Unclassified 1970
43 Ga0070660_100167358 3300005339 Bacteria 1774
44 Ga0070661_100119477 3300005344 Bacteria 1973
45 Ga0070668_100113163 3300005347 Bacteria 2162
46 Ga0070669_100455437 3300005353 Bacteria 1055
47 Ga0070669_100475552 3300005353 Bacteria 1033
48 Ga0070675_100243134 3300005354 Bacteria 1573
49 Ga0070675_100354711 3300005354 Bacteria 1301
50 Ga0070671_100425907 3300005355 Bacteria 1137
51 Ga0070674_100000246 3300005356 Bacteria 26886
52 Ga0070673_100000011 3300005364 Bacteria 145332
53 Ga0070673_100146063 3300005364 Unclassified 1999
54 Ga0070673_100363562 3300005364 Bacteria 1287
55 Ga0070673_100436994 3300005364 Bacteria 1175
56 Ga0070659_100126851 3300005366 Bacteria 2071
57 Ga0070667_100415076 3300005367 Bacteria 1226
58 Ga0070667_100956287 3300005367 Bacteria 798
59 Ga0070701_10195232 3300005438 Bacteria 1193
60 Ga0070663_100038632 3300005455 Bacteria 3330
61 Ga0070663_100267382 3300005455 Bacteria 1358
62 Ga0070678_100002314 3300005456 Bacteria 10400
63 Ga0070662_100039558 3300005457 Bacteria 3354
64 Ga0070662_100598333 3300005457 Bacteria 927
65 Ga0068867_100000049 3300005459 Bacteria 72604
66 Ga0068867_100011589 3300005459 Bacteria 6224
67 Ga0068853_100464267 3300005539 Bacteria 1192
68 Ga0070665_100521665 3300005548 Bacteria 1200
69 Ga0068855_100175782 3300005563 Bacteria 2423
70 Ga0070664_100384095 3300005564 Bacteria 1282
71 Ga0068857_100019078 3300005577 Bacteria 6018
72 Ga0068854_100000369 3300005578 Bacteria 28777
73 Ga0068854_100757186 3300005578 Bacteria 843
74 Ga0068856_100002529 3300005614 Bacteria 18841
75 Ga0068856_100008056 3300005614 Bacteria 10283
76 Ga0068852_100001922 3300005616 Bacteria 14156
77 Ga0068866_10755405 3300005718 Bacteria 672
78 Ga0068851_10028048 3300005834 Bacteria 2779
79 Ga0068870_10021021 3300005840 Bacteria 3187
80 Ga0068858_100004897 3300005842 Bacteria 13125
81 Ga0068860_100041014 3300005843 Bacteria 4422
82 Ga0068862_100003026 3300005844 Bacteria 14649
83 Ga0081455_10179838 3300005937 Bacteria 1602
84 Ga0081538_10016217 3300005981 Bacteria 5725
85 Ga0081539_10010524 3300005985 Bacteria 7496
86 Ga0081539_10116939 3300005985 Bacteria 1331
87 Ga0075362_10299438 3300006177 Bacteria 798
88 Ga0075366_10062301 3300006195 Bacteria 2217
89 Ga0097621_100001894 3300006237 Bacteria 14287
90 Ga0097621_100039949 3300006237 Bacteria 3770
91 Ga0097621_100124724 3300006237 Unclassified 2187
92 Ga0097621_100254567 3300006237 Bacteria 1538
93 Ga0068871_100001121 3300006358 Bacteria 17970
94 Ga0068871_100252616 3300006358 Unclassified 1536
95 Ga0068871_100460315 3300006358 Bacteria 1141
96 Ga0068871_100948078 3300006358 Bacteria 799
97 Ga0068865_100000012 3300006881 Bacteria 145314
98 Ga0068865_100464827 3300006881 Bacteria 1049
99 Ga0105240_10000080 3300009093 Bacteria 195633
100 Ga0105240_10008714 3300009093 Bacteria 14470
101 Ga0105240_10255706 3300009093 Bacteria 2023
102 Ga0111539_10651396 3300009094 Bacteria 1226
103 Ga0105245_10000620 3300009098 Bacteria 32174
104 Ga0105245_10004665 3300009098 Bacteria 12111
105 Ga0105243_10000108 3300009148 Bacteria 94868
106 Ga0105243_10000297 3300009148 Bacteria 55019
107 Ga0105241_10005712 3300009174 Bacteria 9181
108 Ga0105242_10001179 3300009176 Bacteria 20578
109 Ga0105242_10138168 3300009176 Bacteria 2111
110 Ga0105248_10544406 3300009177 Bacteria 1309
111 Ga0105237_10083305 3300009545 Bacteria 3189
112 Ga0105238_10000677 3300009551 Bacteria 35835
113 Ga0105239_10006778 3300010375 Bacteria 13225
114 Ga0105239_10478142 3300010375 Bacteria 1415
115 Ga0105246_10001967 3300011119 Bacteria 12389
116 Ga0105246_10093987 3300011119 Unclassified 2168
117 Ga0157373_10001489 3300013100 Bacteria 17854
118 Ga0157373_10046447 3300013100 Bacteria 3099
119 Ga0157370_10025617 3300013104 Bacteria 5837
120 Ga0157369_10003145 3300013105 Bacteria 19708
121 Ga0157374_10004792 3300013296 Bacteria 11351
122 Ga0157374_10011238 3300013296 Bacteria 7744
123 Ga0157374_10277241 3300013296 Bacteria 1655
124 Ga0157378_10003274 3300013297 Bacteria 14397
125 Ga0157378_10036404 3300013297 Bacteria 4355
126 Ga0157372_11300386 3300013307 Unclassified 839
127 Ga0157375_10000963 3300013308 Bacteria 24918
128 Ga0157375_10263530 3300013308 Bacteria 1885
129 Ga0157375_10785322 3300013308 Unclassified 1102
130 Ga0157375_11890501 3300013308 Bacteria 708
131 Ga0157380_10329848 3300014326 Bacteria 1419
132 Ga0157380_11852455 3300014326 Bacteria 663
133 Ga0157377_10021244 3300014745 Bacteria 3413
134 Ga0157379_10403350 3300014968 Bacteria 1257
135 Ga0157376_10000251 3300014969 Bacteria 37177
136 Ga0209563_100019 3300025230 Bacteria 697828
137 Ga0207425_1000047 3300025245 Bacteria 189158
138 Ga0209026_1001431 3300025250 Bacteria 10561
139 Ga0209148_1000059 3300025254 Bacteria 350224
140 Ga0209129_1000967 3300025258 Bacteria 17263
141 Ga0209233_1004823 3300025261 Bacteria 4540
142 Ga0209565_1000029 3300025263 Bacteria 340335
143 Ga0209565_1000186 3300025263 Bacteria 76097
144 Ga0209455_1025218 3300025272 Bacteria 1086
145 Ga0209673_1003421 3300025273 Bacteria 9389
146 Ga0209675_1014298 3300025291 Bacteria 2423
147 Ga0209676_1008105 3300025292 Bacteria 4765
148 Ga0209676_1017113 3300025292 Bacteria 2580
149 Ga0209025_1000150 3300025294 Bacteria 172834
150 Ga0209564_1000995 3300025295 Bacteria 35399
151 Ga0209564_1016162 3300025295 Bacteria 2988
152 Ga0209564_1045560 3300025295 Bacteria 1127
153 Ga0209758_1000007 3300025297 Bacteria 1270410
154 Ga0209758_1000009 3300025297 Bacteria 1123483
155 Ga0209758_1029125 3300025297 Bacteria 2316
156 Ga0209758_1036855 3300025297 Bacteria 1901
157 Ga0209050_1000005 3300025298 Bacteria 1557793
158 Ga0209050_1000026 3300025298 Bacteria 499134
159 Ga0209050_1004394 3300025298 Bacteria 9558
160 Ga0209050_1020400 3300025298 Bacteria 2468
161 Ga0209256_1000008 3300025299 Bacteria 975723
162 Ga0209051_1000396 3300025303 Bacteria 60690
163 Ga0209257_1000009 3300025304 Bacteria 1205047
164 Ga0209257_1000894 3300025304 Bacteria 41867
165 Ga0209257_1001231 3300025304 Bacteria 31800
166 Ga0209257_1004123 3300025304 Bacteria 11588
167 Ga0209257_1007814 3300025304 Bacteria 6337
168 Ga0207656_10017949 3300025321 Bacteria 2779
169 Ga0207680_10117651 3300025903 Bacteria 1734
170 Ga0207680_10275882 3300025903 Bacteria 1167
171 Ga0207647_10003831 3300025904 Bacteria 11256
172 Ga0207645_10003230 3300025907 Bacteria 12449
173 Ga0207705_10018958 3300025909 Bacteria 4920
174 Ga0207695_10000004 3300025913 Bacteria 1288665
175 Ga0207695_10010552 3300025913 Bacteria 11296
176 Ga0207695_10181245 3300025913 Bacteria 2027
177 Ga0207671_10046803 3300025914 Bacteria 3200
178 Ga0207660_10001085 3300025917 Bacteria 18123
179 Ga0207657_10241582 3300025919 Bacteria 1442
180 Ga0207649_10088276 3300025920 Bacteria 2025
181 Ga0207681_10407010 3300025923 Bacteria 1100
182 Ga0207694_10000014 3300025924 Bacteria 374435
183 Ga0207694_10011185 3300025924 Bacteria 6774
184 Ga0207659_10539589 3300025926 Bacteria 990
185 Ga0207687_10002159 3300025927 Bacteria 13411
186 Ga0207687_10011154 3300025927 Bacteria 5872
187 Ga0207644_10405646 3300025931 Bacteria 1115
188 Ga0207690_10379670 3300025932 Bacteria 1123
189 Ga0207706_10021188 3300025933 Bacteria 5840
190 Ga0207706_10591241 3300025933 Bacteria 954
191 Ga0207709_10000148 3300025935 Bacteria 96435
192 Ga0207709_10000254 3300025935 Bacteria 63973
193 Ga0207669_10000015 3300025937 Bacteria 125492
194 Ga0207669_10011978 3300025937 Bacteria 4245
195 Ga0207704_10000021 3300025938 Bacteria 148508
196 Ga0207691_10157957 3300025940 Bacteria 1990
197 Ga0207711_10278821 3300025941 Bacteria 1539
198 Ga0207689_10000132 3300025942 Bacteria 63321
199 Ga0207689_10536974 3300025942 Bacteria 982
200 Ga0207667_10000202 3300025949 Bacteria 86408
201 Ga0207651_10000012 3300025960 Bacteria 189928
202 Ga0207651_10489443 3300025960 Bacteria 1061
203 Ga0207651_11493940 3300025960 Bacteria 608
204 Ga0207640_10000511 3300025981 Bacteria 23405
205 Ga0207640_10883753 3300025981 Unclassified 779
206 Ga0207658_10073246 3300025986 Bacteria 2599
207 Ga0207677_10000170 3300026023 Bacteria 51603
208 Ga0207677_10162444 3300026023 Unclassified 1737
209 Ga0207703_10000575 3300026035 Bacteria 37492
210 Ga0207639_10307724 3300026041 Bacteria 1403
211 Ga0207678_10000734 3300026067 Bacteria 30021
212 Ga0207678_10796254 3300026067 Bacteria 834
213 Ga0207702_10002367 3300026078 Bacteria 18005
214 Ga0207648_10000051 3300026089 Bacteria 108363
215 Ga0207648_10024665 3300026089 Bacteria 5364
216 Ga0207674_10063168 3300026116 Bacteria 3738
217 Ga0207683_10000046 3300026121 Bacteria 89256
218 Ga0207683_10027928 3300026121 Bacteria 4876
219 Ga0207698_10204754 3300026142 Bacteria 1770
220 Ga0268265_10001444 3300028380 Bacteria 20029
221 Ga0268264_10004648 3300028381 Bacteria 11665
222 Ga0268264_11470494 3300028381 Unclassified 692
223 Ga0307517_10081141 3300028786 Bacteria 2769
224 Ga0307515_10186894 3300028794 Bacteria 1998
225 Ga0307508_10001321 3300031616 Bacteria 28091
226 Ga0307405_10317117 3300031731 Bacteria 1189
227 Ga0307406_10109904 3300031901 Bacteria 1896
228 Ga0307409_100752950 3300031995 Unclassified 978
229 Ga0307414_10006342 3300032004 Bacteria 6587
230 Ga0395899_0000495 3300037312 Bacteria 43859
231 Ga0395900_0003617 3300037418 Bacteria 16618
232 Ga0395900_0026667 3300037418 Bacteria 5916
233 Ga0395900_0085306 3300037418 Bacteria 3245
234 Ga0395900_0192266 3300037418 Bacteria 2069
235 Ga0395900_0212494 3300037418 Bacteria 1953
236 Ga0395898_0165205 3300037466 Bacteria 2117
237 Ga0395898_0177401 3300037466 Bacteria 2036
238 Ga0395905_0009054 3300037471 Bacteria 9765
239 Ga0395905_0014061 3300037471 Bacteria 7653
240 Ga0395905_0041950 3300037471 Bacteria 4293
241 Ga0395905_0176416 3300037471 Bacteria 2006
242 Ga0395901_0001383 3300038443 Bacteria 25376
243 Ga0395901_0015876 3300038443 Bacteria 7675
244 Ga0395901_0325613 3300038443 Bacteria 1589
245 Ga0439436_0016774 3300041404 Bacteria 2195
246 Ga0439461_0000021 3300041410 Bacteria 20230
247 Ga0439465_0000265 3300041413 Bacteria 14556
248 Ga0439465_0020509 3300041413 Unclassified 2071
249 Ga0451793_0083724 3300041452 Bacteria 940
250 Ga0451800_0219509 3300041459 Bacteria 718
251 Ga0451800_1080249 3300041459 Bacteria 1814
252 Ga0451802_0710298 3300041460 Bacteria 1390
253 Ga0451807_0077015 3300041486 Bacteria 3858
254 Ga0451851_0592581 3300041507 Bacteria 994
255 Ga0439431_0000073 3300041997 Bacteria 16202
256 Ga0439431_0006310 3300041997 Bacteria 2618
257 Ga0439445_0002280 3300042004 Bacteria 4258
258 Ga0439445_0010934 3300042004 Bacteria 2155
259 Ga0439445_0011139 3300042004 Bacteria 2139
260 Ga0439445_0035027 3300042004 Bacteria 1317
261 Ga0439448_0001181 3300042005 Bacteria 6643
262 Ga0439432_000505 3300042006 Bacteria 14481
263 Ga0439452_057118 3300042010 Bacteria 881
264 Ga0439455_0003204 3300042012 Bacteria 3097
265 Ga0439462_0005669 3300042015 Bacteria 3082
266 Ga0439446_0002633 3300042156 Bacteria 4332
267 Ga0439458_0010427 3300042157 Bacteria 2071
268 Ga0450909_005153 3300042185 Bacteria 1880
269 Ga0439434_0000298 3300042435 Bacteria 14232
270 Ga0466972_0010012 3300044658 Bacteria 4761
271 Ga0466961_0267064 3300044693 Bacteria 1049
272 Ga0466964_0003788 3300044706 Bacteria 5545
273 Ga0466968_0002778 3300044735 Bacteria 6470
274 Ga0466960_0078425 3300044901 Bacteria 1658
275 Ga0466959_0024551 3300045049 Bacteria 4466
276 Ga0466958_0012912 3300045836 Bacteria 4744
277 Ga0495627_032140 3300046453 Bacteria 1653
278 Ga0495662_0214050 3300046476 Bacteria 950
279 Ga0495584_0010233 3300046491 Bacteria 4818
280 Ga0495585_0003025 3300046492 Bacteria 11588
281 Ga0495585_0231249 3300046492 Bacteria 929
282 Ga0495596_0009439 3300046500 Bacteria 4290
283 Ga0495583_0007282 3300046506 Bacteria 6994
284 Ga0495583_0017527 3300046506 Bacteria 3798
285 Ga0495583_0029886 3300046506 Bacteria 2661
286 Ga0495606_0000029 3300046507 Bacteria 250473
287 Ga0495616_0016396 3300046513 Bacteria 4102
288 Ga0495631_0028839 3300046518 Bacteria 2530
289 Ga0495643_0005004 3300046522 Bacteria 9086
290 Ga0495648_0000088 3300046524 Bacteria 115109
291 Ga0495663_0000806 3300046525 Bacteria 10708
292 Ga0495663_0104889 3300046525 Bacteria 934
293 Ga0495652_0126878 3300046529 Bacteria 2026
294 Ga0495587_0018882 3300046536 Bacteria 4274
295 Ga0495597_0118297 3300046542 Bacteria 1106
296 Ga0495622_0004600 3300046557 Bacteria 6392
297 Ga0495633_0000298 3300046558 Bacteria 56626
298 Ga0495668_0000013 3300046616 Bacteria 452938
299 Ga0495668_0138898 3300046616 Bacteria 1330
300 Ga0495611_0004847 3300046648 Bacteria 5782
301 Ga0495611_0050532 3300046648 Bacteria 1873
302 Ga0495625_0000221 3300046660 Bacteria 90175
303 Ga0495625_0000758 3300046660 Bacteria 45114
304 Ga0495625_0016897 3300046660 Bacteria 5727
305 Ga0495625_0017754 3300046660 Bacteria 5564
306 Ga0495625_0062936 3300046660 Bacteria 2621
307 Ga0495625_0120118 3300046660 Bacteria 1789
308 Ga0495625_0147255 3300046660 Bacteria 1585
309 Ga0495625_0325580 3300046660 Bacteria 977
310 Ga0495669_0000100 3300046684 Bacteria 53888
311 Ga0495670_0000014 3300046691 Bacteria 138993
312 Ga0495670_0006523 3300046691 Bacteria 5735
313 Ga0495670_0022945 3300046691 Bacteria 3081
314 Ga0495671_0088109 3300046692 Bacteria 1520
315 Ga0495649_0014863 3300046694 Bacteria 4448
316 Ga0495600_0001830 3300046809 Bacteria 11919
317 Ga0495660_0015729 3300046810 Bacteria 4369
318 Ga0495683_0000551 3300047323 Bacteria 28443
319 Ga0495683_0009347 3300047323 Bacteria 5222
320 Ga0495683_0191862 3300047323 Unclassified 926
321 Ga0495687_000084 3300047443 Bacteria 145072
322 Ga0495687_001113 3300047443 Bacteria 26128
323 Ga0495687_032965 3300047443 Bacteria 2357
324 Ga0495677_0079501 3300047445 Unclassified 1228
325 Ga0495681_0007026 3300047470 Bacteria 7272
326 Ga0495681_0124228 3300047470 Bacteria 1104
327 Ga0495686_0039221 3300047472 Bacteria 3026
328 Ga0496102_0453655 3300048905 Bacteria 1203
329 Ga0496112_0352016 3300048915 Bacteria 1415
330 Ga0496115_0000401 3300048918 Bacteria 35652
331 Ga0496115_0117650 3300048918 Bacteria 2186
332 Ga0496121_0029041 3300048924 Bacteria 5128
333 Ga0496122_0016001 3300048925 Bacteria 7131
334 Ga0496123_0008469 3300048926 Bacteria 9442
335 Ga0496124_0024029 3300048927 Bacteria 5549
336 Ga0496125_0001015 3300048928 Bacteria 43638
337 Ga0495682_0048676 3300049460 Unclassified 1545
338 Ga0501069_0464785 3300049585 Bacteria 753
339 nmdc:mga03683_336006_c1 3300050489 Bacteria 713
340 nmdc:mga0k408_211163_c1 3300050493 Bacteria 1159
341 nmdc:mga0k408_96509_c1 3300050493 Bacteria 1740
342 nmdc:mga07m45_11339_c1 3300050496 Bacteria 4680
343 nmdc:mga07m45_96403_c1 3300050496 Bacteria 1697
344 Ga0500610_0000348 3300053079 Bacteria 13969
345 Ga0500555_043129 3300053103 Bacteria 1251
346 Ga0500595_000298 3300053119 Bacteria 32638
347 Ga0500595_079860 3300053119 Unclassified 959
348 Ga0500642_0000007 3300053130 Bacteria 294238
349 Ga0500658_0001662 3300053134 Bacteria 8845
350 Ga0500658_0002042 3300053134 Bacteria 7868
351 Ga0500658_0052519 3300053134 Bacteria 1669
352 Ga0500559_0014394 3300053136 Bacteria 3343
353 Ga0500604_0049858 3300053151 Bacteria 1288
354 Ga0500622_0000491 3300053156 Bacteria 36964
355 Ga0500636_0002805 3300053177 Bacteria 9727
356 Ga0500645_000192 3300053730 Bacteria 47665
357 Ga0500661_007024 3300055283 Bacteria 2089
358 Ga0466962_0134235 3300061719 Bacteria 1197
359 2643949170 2643221588 Bacteria 3692460
360 2644126734 2643221622 Bacteria 4212502
361 8057102212 8057101203 Bacteria 5034064
362 8057104648 8057101203 Bacteria 5034064
363 Ga0500562_101066
364 JGI24741J21665_1008826
365 JGI24740J21852_10026641
366 JGI24739J22299_10030019
367 JGI24737J22298_10050645
368 JGI24743J22301_10025163
369 JGI24738J21930_10006387
370 JGI24742J22300_10011059
371 JGI25151J46595_10064022
372 JGI25153J46596_10000043
373 JGI25153J46596_10001324
374 JGI25153J46596_10008045
375 rootH2_10105031
376 rootL2_10133432
377 rootL2_10291916
378 Ga0055525_1000076
379 Ga0055542_1008121
380 Ga0055526_1004195
381 Ga0055537_1000993
382 Ga0055524_1000380
383 Ga0055536_1039819
384 Ga0055530_10000043
385 Ga0055530_10007410
386 Ga0055530_10014709
387 Ga0055530_10047668
388 Ga0055540_1005974
389 Ga0055531_10000008
390 Ga0055531_10037816
391 Ga0055531_10037827
392 Ga0055531_10041614
393 Ga0055543_1016526
394 Ga0065165_1000597
395 Ga0065165_1001549
396 Ga0065165_1005474
397 Ga0070658_10023800
398 Ga0070676_10000871
399 Ga0070670_100061878
400 Ga0068869_100000163
401 Ga0068869_100073395
402 Ga0070680_100073601
403 Ga0068868_100000342
404 Ga0068868_100142299
405 Ga0070660_100167358
406 Ga0070661_100119477
407 Ga0070668_100113163
408 Ga0070669_100455437
409 Ga0070669_100475552
410 Ga0070675_100243134
411 Ga0070675_100354711
412 Ga0070671_100425907
413 Ga0070674_100000246
414 Ga0070673_100000011
415 Ga0070673_100146063
416 Ga0070673_100363562
417 Ga0070673_100436994
418 Ga0070659_100126851
419 Ga0070667_100415076
420 Ga0070667_100956287
421 Ga0070701_10195232
422 Ga0070663_100038632
423 Ga0070663_100267382
424 Ga0070678_100002314
425 Ga0070662_100039558
426 Ga0070662_100598333
427 Ga0068867_100000049
428 Ga0068867_100011589
429 Ga0068853_100464267
430 Ga0070665_100521665
431 Ga0068855_100175782
432 Ga0070664_100384095
433 Ga0068857_100019078
434 Ga0068854_100000369
435 Ga0068854_100757186
436 Ga0068856_100002529
437 Ga0068856_100008056
438 Ga0068852_100001922
439 Ga0068866_10755405
440 Ga0068851_10028048
441 Ga0068870_10021021
442 Ga0068858_100004897
443 Ga0068860_100041014
444 Ga0068862_100003026
445 Ga0081455_10179838
446 Ga0081538_10016217
447 Ga0081539_10010524
448 Ga0081539_10116939
449 Ga0075362_10299438
450 Ga0075366_10062301
451 Ga0097621_100001894
452 Ga0097621_100039949
453 Ga0097621_100124724
454 Ga0097621_100254567
455 Ga0068871_100001121
456 Ga0068871_100252616
457 Ga0068871_100460315
458 Ga0068871_100948078
459 Ga0068865_100000012
460 Ga0068865_100464827
461 Ga0105240_10000080
462 Ga0105240_10008714
463 Ga0105240_10255706
464 Ga0111539_10651396
465 Ga0105245_10000620
466 Ga0105245_10004665
467 Ga0105243_10000108
468 Ga0105243_10000297
469 Ga0105241_10005712
470 Ga0105242_10001179
471 Ga0105242_10138168
472 Ga0105248_10544406
473 Ga0105237_10083305
474 Ga0105238_10000677
475 Ga0105239_10006778
476 Ga0105239_10478142
477 Ga0105246_10001967
478 Ga0105246_10093987
479 Ga0157373_10001489
480 Ga0157373_10046447
481 Ga0157370_10025617
482 Ga0157369_10003145
483 Ga0157374_10004792
484 Ga0157374_10011238
485 Ga0157374_10277241
486 Ga0157378_10003274
487 Ga0157378_10036404
488 Ga0157372_11300386
489 Ga0157375_10000963
490 Ga0157375_10263530
491 Ga0157375_10785322
492 Ga0157375_11890501
493 Ga0157380_10329848
494 Ga0157380_11852455
495 Ga0157377_10021244
496 Ga0157379_10403350
497 Ga0157376_10000251
498 Ga0209563_100019
499 Ga0207425_1000047
500 Ga0209026_1001431
501 Ga0209148_1000059
502 Ga0209129_1000967
503 Ga0209233_1004823
504 Ga0209565_1000029
505 Ga0209565_1000186
506 Ga0209455_1025218
507 Ga0209673_1003421
508 Ga0209675_1014298
509 Ga0209676_1008105
510 Ga0209676_1017113
511 Ga0209025_1000150
512 Ga0209564_1000995
513 Ga0209564_1016162
514 Ga0209564_1045560
515 Ga0209758_1000007
516 Ga0209758_1000009
517 Ga0209758_1029125
518 Ga0209758_1036855
519 Ga0209050_1000005
520 Ga0209050_1000026
521 Ga0209050_1004394
522 Ga0209050_1020400
523 Ga0209256_1000008
524 Ga0209051_1000396
525 Ga0209257_1000009
526 Ga0209257_1000894
527 Ga0209257_1001231
528 Ga0209257_1004123
529 Ga0209257_1007814
530 Ga0207656_10017949
531 Ga0207680_10117651
532 Ga0207680_10275882
533 Ga0207647_10003831
534 Ga0207645_10003230
535 Ga0207705_10018958
536 Ga0207695_10000004
537 Ga0207695_10010552
538 Ga0207695_10181245
539 Ga0207671_10046803
540 Ga0207660_10001085
541 Ga0207657_10241582
542 Ga0207649_10088276
543 Ga0207681_10407010
544 Ga0207694_10000014
545 Ga0207694_10011185
546 Ga0207659_10539589
547 Ga0207687_10002159
548 Ga0207687_10011154
549 Ga0207644_10405646
550 Ga0207690_10379670
551 Ga0207706_10021188
552 Ga0207706_10591241
553 Ga0207709_10000148
554 Ga0207709_10000254
555 Ga0207669_10000015
556 Ga0207669_10011978
557 Ga0207704_10000021
558 Ga0207691_10157957
559 Ga0207711_10278821
560 Ga0207689_10000132
561 Ga0207689_10536974
562 Ga0207667_10000202
563 Ga0207651_10000012
564 Ga0207651_10489443
565 Ga0207651_11493940
566 Ga0207640_10000511
567 Ga0207640_10883753
568 Ga0207658_10073246
569 Ga0207677_10000170
570 Ga0207677_10162444
571 Ga0207703_10000575
572 Ga0207639_10307724
573 Ga0207678_10000734
574 Ga0207678_10796254
575 Ga0207702_10002367
576 Ga0207648_10000051
577 Ga0207648_10024665
578 Ga0207674_10063168
579 Ga0207683_10000046
580 Ga0207683_10027928
581 Ga0207698_10204754
582 Ga0268265_10001444
583 Ga0268264_10004648
584 Ga0268264_11470494
585 Ga0307517_10081141
586 Ga0307515_10186894
587 Ga0307508_10001321
588 Ga0307405_10317117
589 Ga0307406_10109904
590 Ga0307409_100752950
591 Ga0307414_10006342
592 Ga0395899_0000495
593 Ga0395900_0003617
594 Ga0395900_0026667
595 Ga0395900_0085306
596 Ga0395900_0192266
597 Ga0395900_0212494
598 Ga0395898_0165205
599 Ga0395898_0177401
600 Ga0395905_0009054
601 Ga0395905_0014061
602 Ga0395905_0041950
603 Ga0395905_0176416
604 Ga0395901_0001383
605 Ga0395901_0015876
606 Ga0395901_0325613
607 Ga0439436_0016774
608 Ga0439461_0000021
609 Ga0439465_0000265
610 Ga0439465_0020509
611 Ga0451793_0083724
612 Ga0451800_0219509
613 Ga0451800_1080249
614 Ga0451802_0710298
615 Ga0451807_0077015
616 Ga0451851_0592581
617 Ga0439431_0000073
618 Ga0439431_0006310
619 Ga0439445_0002280
620 Ga0439445_0010934
621 Ga0439445_0011139
622 Ga0439445_0035027
623 Ga0439448_0001181
624 Ga0439432_000505
625 Ga0439452_057118
626 Ga0439455_0003204
627 Ga0439462_0005669
628 Ga0439446_0002633
629 Ga0439458_0010427
630 Ga0450909_005153
631 Ga0439434_0000298
632 Ga0466972_0010012
633 Ga0466961_0267064
634 Ga0466964_0003788
635 Ga0466968_0002778
636 Ga0466960_0078425
637 Ga0466959_0024551
638 Ga0466958_0012912
639 Ga0495627_032140
640 Ga0495662_0214050
641 Ga0495584_0010233
642 Ga0495585_0003025
643 Ga0495585_0231249
644 Ga0495596_0009439
645 Ga0495583_0007282
646 Ga0495583_0017527
647 Ga0495583_0029886
648 Ga0495606_0000029
649 Ga0495616_0016396
650 Ga0495631_0028839
651 Ga0495643_0005004
652 Ga0495648_0000088
653 Ga0495663_0000806
654 Ga0495663_0104889
655 Ga0495652_0126878
656 Ga0495587_0018882
657 Ga0495597_0118297
658 Ga0495622_0004600
659 Ga0495633_0000298
660 Ga0495668_0000013
661 Ga0495668_0138898
662 Ga0495611_0004847
663 Ga0495611_0050532
664 Ga0495625_0000221
665 Ga0495625_0000758
666 Ga0495625_0016897
667 Ga0495625_0017754
668 Ga0495625_0062936
669 Ga0495625_0120118
670 Ga0495625_0147255
671 Ga0495625_0325580
672 Ga0495669_0000100
673 Ga0495670_0000014
674 Ga0495670_0006523
675 Ga0495670_0022945
676 Ga0495671_0088109
677 Ga0495649_0014863
678 Ga0495600_0001830
679 Ga0495660_0015729
680 Ga0495683_0000551
681 Ga0495683_0009347
682 Ga0495683_0191862
683 Ga0495687_000084
684 Ga0495687_001113
685 Ga0495687_032965
686 Ga0495677_0079501
687 Ga0495681_0007026
688 Ga0495681_0124228
689 Ga0495686_0039221
690 Ga0496102_0453655
691 Ga0496112_0352016
692 Ga0496115_0000401
693 Ga0496115_0117650
694 Ga0496121_0029041
695 Ga0496122_0016001
696 Ga0496123_0008469
697 Ga0496124_0024029
698 Ga0496125_0001015
699 Ga0495682_0048676
700 Ga0501069_0464785
701 nmdc:mga03683_336006_c1
702 nmdc:mga0k408_211163_c1
703 nmdc:mga0k408_96509_c1
704 nmdc:mga07m45_11339_c1
705 nmdc:mga07m45_96403_c1
706 Ga0500610_0000348
707 Ga0500555_043129
708 Ga0500595_000298
709 Ga0500595_079860
710 Ga0500642_0000007
711 Ga0500658_0001662
712 Ga0500658_0002042
713 Ga0500658_0052519
714 Ga0500559_0014394
715 Ga0500604_0049858
716 Ga0500622_0000491
717 Ga0500636_0002805
718 Ga0500645_000192
719 Ga0500661_007024
720 Ga0466962_0134235
721 2643949170
722 2644126734
723 8057102212
724 8057104648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

98

183

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

8

77

0.91

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

76

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.8973 1 193
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.8939 1 193
4kgi-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site 0.8924 1 193
1f2e-assembly1.cif.gz_A structure of sphingomonad, glutathione s-transferase complexed with glutathione 0.891 1 193
1n2a-assembly1.cif.gz_A crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.8884 1 193
ID Description Score Start End Superfamily
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 1 78 3.40.30.10
2dsaC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9622 1 78 3.40.30.10
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9294 1 78 3.40.30.10
4gf0B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9221 1 79 3.40.30.10
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8956 2 75 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A447PIA8-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9768 1 76 GO:0004364
AF-G5SC88-F1-model_v4 Glutathionine S-transferase 0.9766 1 78 GO:0016740
AF-A0A0F4FYY1-F1-model_v4 deleted 0.9761 18 78
AF-A0A3S1F4Q9-F1-model_v4 Glutathione S-transferase 0.9748 1 110 GO:0016740
AF-A0A531KG92-F1-model_v4 Glutathione S-transferase 0.9727 1 68 GO:0016740

Map