F422739

General Info

Members Datasets Scaffolds Average Seq Length
362 204 724 166

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0169210|Ga0495670_0169210_493_1062
Length 189
Sequence LERHPAGYAEEQVTQAVQHEATAVSAAALPXXXXTPVSGVGDLAADFELANQFGEPVRLSDFRGRNVVIVFYPFAFSGICTGELCEIRDNLALFEDADAAVLAVSVDSKFAQRAYAEKEGYGFDLLADFWPHGAVASAYGVFDPESGMALRGTFIIDAAGIVRYVVVNPRGQARDLAEYRTALAGLGGN

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
45 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
67 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
68 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
69 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
70 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
71 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
74 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
77 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
90 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
91 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
92 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
174 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
175 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
176 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
177 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
178 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
179 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
180 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
181 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
182 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
183 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
184 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
185 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
186 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
187 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
188 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
189 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
190 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
191 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
192 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
193 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
194 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
195 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
196 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
197 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
198 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
199 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
200 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
201 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
202 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
203 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
204 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.36
Metatranscriptomes 5.8
Isolates 8.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 9.39
Rhizosphere 82.6
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0169210 3300046691 Bacteria 1150
2 JGI25152J39213_1002341 3300002773 Bacteria 7273
3 JGI25406J46586_10090271 3300003203 Bacteria 925
4 rootL2_10221533 3300003322 Bacteria 2641
5 rootL2_10270454 3300003322 Bacteria 2079
6 Ga0006562J51391_1006083 3300003578 Bacteria 2196
7 Ga0065714_10009805 3300005288 Bacteria 2521
8 Ga0065714_10177156 3300005288 Bacteria 915
9 Ga0070676_10113981 3300005328 Bacteria 1687
10 Ga0070666_10013324 3300005335 Bacteria 5214
11 Ga0070675_100091198 3300005354 Bacteria 2552
12 Ga0070674_100157782 3300005356 Bacteria 1718
13 Ga0070667_100223804 3300005367 Bacteria 1675
14 Ga0070667_100882186 3300005367 Bacteria 832
15 Ga0070678_100350386 3300005456 Bacteria 1269
16 Ga0068860_101527107 3300005843 Bacteria 689
17 Ga0081539_10011375 3300005985 Bacteria 7043
18 Ga0075432_10012247 3300006058 Bacteria 2915
19 Ga0105251_10027414 3300009011 Bacteria 2888
20 Ga0105244_10036498 3300009036 Bacteria 2574
21 Ga0105243_10024424 3300009148 Bacteria 4610
22 Ga0105242_10196157 3300009176 Bacteria 1791
23 Ga0105248_10289433 3300009177 Bacteria 1845
24 Ga0105246_10000855 3300011119 Bacteria 17421
25 Ga0105246_10464071 3300011119 Bacteria 1067
26 Ga0157371_10081721 3300013102 Bacteria 2288
27 Ga0157369_10054014 3300013105 Bacteria 4338
28 Ga0157369_10217840 3300013105 Bacteria 1999
29 Ga0163162_10275000 3300013306 Bacteria 1816
30 Ga0157375_10272647 3300013308 Bacteria 1854
31 Ga0163161_10079324 3300017792 Bacteria 2414
32 Ga0209129_1000028 3300025258 Bacteria 405451
33 Ga0209025_1000428 3300025294 Bacteria 83354
34 Ga0209051_1010202 3300025303 Bacteria 4771
35 Ga0207697_10021002 3300025315 Bacteria 2673
36 Ga0207655_1041327 3300025728 Bacteria 1977
37 Ga0207655_1064466 3300025728 Bacteria 1397
38 Ga0207710_10117924 3300025900 Bacteria 1265
39 Ga0207680_10010823 3300025903 Bacteria 4580
40 Ga0207645_10035616 3300025907 Bacteria 3196
41 Ga0207681_10097589 3300025923 Bacteria 2112
42 Ga0207687_10568943 3300025927 Bacteria 952
43 Ga0207644_10042299 3300025931 Bacteria 3228
44 Ga0207669_10229735 3300025937 Bacteria 1368
45 Ga0207691_10003664 3300025940 Bacteria 14903
46 Ga0207651_10134044 3300025960 Bacteria 1902
47 Ga0207683_10041664 3300026121 Bacteria 4010
48 Ga0207428_10024310 3300027907 Bacteria 5089
49 Ga0268266_10107450 3300028379 Bacteria 2468
50 Ga0316181_1188391 3300030744 Bacteria 3809
51 Ga0316182_1074270 3300030745 Bacteria 2410
52 Ga0307408_100003107 3300031548 Bacteria 11442
53 Ga0307408_100036164 3300031548 Bacteria 3470
54 Ga0307408_100047790 3300031548 Bacteria 3066
55 Ga0307408_100052558 3300031548 Bacteria 2939
56 Ga0307408_100110869 3300031548 Bacteria 2107
57 Ga0307408_100175231 3300031548 Bacteria 1716
58 Ga0307408_100189315 3300031548 Bacteria 1656
59 Ga0307408_100366924 3300031548 Bacteria 1226
60 Ga0307408_100437875 3300031548 Bacteria 1131
61 Ga0307408_100513628 3300031548 Bacteria 1051
62 Ga0307405_10019135 3300031731 Bacteria 3796
63 Ga0307405_10048822 3300031731 Bacteria 2612
64 Ga0307405_10068253 3300031731 Bacteria 2274
65 Ga0307405_10069304 3300031731 Bacteria 2260
66 Ga0307405_10093871 3300031731 Bacteria 1994
67 Ga0307405_10109497 3300031731 Bacteria 1868
68 Ga0307405_10157299 3300031731 Bacteria 1605
69 Ga0307405_10290238 3300031731 Bacteria 1236
70 Ga0307405_11127958 3300031731 Bacteria 675
71 Ga0307413_10042852 3300031824 Bacteria 2662
72 Ga0307413_10110882 3300031824 Bacteria 1836
73 Ga0307413_10175118 3300031824 Bacteria 1523
74 Ga0307413_10291139 3300031824 Bacteria 1233
75 Ga0307413_10428112 3300031824 Bacteria 1044
76 Ga0307413_10606249 3300031824 Bacteria 897
77 Ga0307410_10005192 3300031852 Bacteria 6860
78 Ga0307410_10107781 3300031852 Bacteria 2010
79 Ga0307410_10146782 3300031852 Bacteria 1751
80 Ga0307410_10152443 3300031852 Bacteria 1722
81 Ga0307410_10247151 3300031852 Bacteria 1385
82 Ga0307410_10509238 3300031852 Bacteria 991
83 Ga0307410_10649985 3300031852 Bacteria 884
84 Ga0307406_10030733 3300031901 Bacteria 3264
85 Ga0307406_10330259 3300031901 Bacteria 1183
86 Ga0307406_10558123 3300031901 Bacteria 938
87 Ga0307407_10005990 3300031903 Bacteria 5348
88 Ga0307407_10012122 3300031903 Bacteria 4133
89 Ga0307407_10095151 3300031903 Bacteria 1835
90 Ga0307407_10182085 3300031903 Bacteria 1393
91 Ga0307407_10396946 3300031903 Bacteria 988
92 Ga0307407_10536993 3300031903 Bacteria 862
93 Ga0307407_10562099 3300031903 Bacteria 845
94 Ga0307407_10943627 3300031903 Bacteria 664
95 Ga0307412_10016035 3300031911 Bacteria 4453
96 Ga0307412_10030048 3300031911 Bacteria 3416
97 Ga0307412_10052931 3300031911 Bacteria 2689
98 Ga0307412_10074400 3300031911 Bacteria 2327
99 Ga0307412_10102164 3300031911 Bacteria 2029
100 Ga0307412_10149724 3300031911 Bacteria 1720
101 Ga0307412_10158103 3300031911 Bacteria 1680
102 Ga0307412_10164275 3300031911 Bacteria 1653
103 Ga0307412_10334232 3300031911 Bacteria 1210
104 Ga0307412_10744347 3300031911 Bacteria 845
105 Ga0307409_100040923 3300031995 Bacteria 3456
106 Ga0307409_100118743 3300031995 Bacteria 2234
107 Ga0307409_100126686 3300031995 Bacteria 2173
108 Ga0307409_100152125 3300031995 Bacteria 2010
109 Ga0307409_100268422 3300031995 Bacteria 1570
110 Ga0307409_100292838 3300031995 Bacteria 1510
111 Ga0307409_100459692 3300031995 Bacteria 1230
112 Ga0307409_100826369 3300031995 Bacteria 936
113 Ga0307409_101010162 3300031995 Bacteria 850
114 Ga0307409_101041836 3300031995 Bacteria 838
115 Ga0307416_100011975 3300032002 Bacteria 5819
116 Ga0307416_100113286 3300032002 Bacteria 2396
117 Ga0307416_100208805 3300032002 Bacteria 1860
118 Ga0307416_100493192 3300032002 Bacteria 1287
119 Ga0307416_100626522 3300032002 Bacteria 1158
120 Ga0307416_100689794 3300032002 Bacteria 1109
121 Ga0307416_100936909 3300032002 Bacteria 967
122 Ga0307416_101011587 3300032002 Bacteria 934
123 Ga0307416_101711120 3300032002 Bacteria 733
124 Ga0307414_10041821 3300032004 Bacteria 3108
125 Ga0307414_10066815 3300032004 Bacteria 2572
126 Ga0307414_10198493 3300032004 Bacteria 1630
127 Ga0307411_10024127 3300032005 Bacteria 3619
128 Ga0307411_10398124 3300032005 Bacteria 1137
129 Ga0307411_10460508 3300032005 Bacteria 1066
130 Ga0307415_100106905 3300032126 Bacteria 2066
131 Ga0307415_100229770 3300032126 Bacteria 1493
132 Ga0307415_100426447 3300032126 Bacteria 1140
133 Ga0307415_100691485 3300032126 Bacteria 919
134 Ga0395899_0018370 3300037312 Bacteria 5315
135 Ga0395899_0114431 3300037312 Bacteria 1937
136 Ga0395899_0177626 3300037312 Bacteria 1496
137 Ga0395900_0133299 3300037418 Bacteria 2545
138 Ga0395900_0310790 3300037418 Bacteria 1559
139 Ga0395900_0397884 3300037418 Bacteria 1342
140 Ga0395898_0082635 3300037466 Bacteria 3096
141 Ga0395898_0220213 3300037466 Bacteria 1810
142 Ga0395905_0416651 3300037471 Bacteria 1239
143 Ga0395901_0028352 3300038443 Bacteria 5757
144 Ga0395901_0058208 3300038443 Bacteria 4020
145 Ga0395901_0137107 3300038443 Bacteria 2571
146 Ga0439436_0015963 3300041404 Bacteria 2255
147 Ga0439438_055504 3300041405 Bacteria 999
148 Ga0439439_0000357 3300041406 Bacteria 7449
149 Ga0439439_0091697 3300041406 Bacteria 830
150 Ga0439447_091615 3300041407 Unclassified 699
151 Ga0439461_0023267 3300041410 Bacteria 1246
152 Ga0439466_0054026 3300041411 Bacteria 1309
153 Ga0439466_0116768 3300041411 Bacteria 825
154 Ga0439466_0148402 3300041411 Bacteria 718
155 Ga0439466_0264105 3300041411 Bacteria 521
156 Ga0439465_0007160 3300041413 Bacteria 3545
157 Ga0439465_0027169 3300041413 Bacteria 1812
158 Ga0439465_0267344 3300041413 Bacteria 635
159 Ga0451793_1069314 3300041452 Bacteria 764
160 Ga0451833_0554634 3300041491 Bacteria 6061
161 Ga0451837_1387237 3300041494 Bacteria 665
162 Ga0451841_0238187 3300041498 Bacteria 1318
163 Ga0451845_0055593 3300041501 Bacteria 999
164 Ga0451853_2783293 3300041512 Bacteria 2334
165 Ga0439431_0051868 3300041997 Bacteria 1065
166 Ga0439433_0000558 3300041999 Bacteria 7065
167 Ga0439442_000003 3300042002 Bacteria 73601
168 Ga0439442_000415 3300042002 Bacteria 10015
169 Ga0439442_005266 3300042002 Bacteria 2593
170 Ga0439442_009892 3300042002 Bacteria 1929
171 Ga0439445_0050444 3300042004 Bacteria 1122
172 Ga0439445_0179255 3300042004 Bacteria 622
173 Ga0439432_000482 3300042006 Bacteria 14905
174 Ga0439432_040433 3300042006 Bacteria 1479
175 Ga0439449_0001698 3300042007 Bacteria 8660
176 Ga0439449_0005147 3300042007 Bacteria 5026
177 Ga0439449_0041947 3300042007 Bacteria 1701
178 Ga0439449_0104194 3300042007 Bacteria 1049
179 Ga0439449_0119453 3300042007 Bacteria 978
180 Ga0439452_007162 3300042010 Bacteria 3433
181 Ga0439452_064189 3300042010 Bacteria 818
182 Ga0439457_000850 3300042014 Bacteria 9180
183 Ga0439457_005851 3300042014 Bacteria 3051
184 Ga0439457_057931 3300042014 Bacteria 875
185 Ga0439462_0002088 3300042015 Bacteria 4583
186 Ga0439462_0009672 3300042015 Bacteria 2437
187 Ga0439462_0022399 3300042015 Bacteria 1653
188 Ga0439462_0091389 3300042015 Bacteria 835
189 Ga0450919_000504 3300042121 Bacteria 4888
190 Ga0450920_000755 3300042122 Bacteria 5205
191 Ga0450920_001702 3300042122 Bacteria 3682
192 Ga0450920_057427 3300042122 Bacteria 784
193 Ga0450923_114546 3300042125 Bacteria 632
194 Ga0450906_015364 3300042145 Bacteria 1392
195 Ga0450907_002580 3300042146 Bacteria 3405
196 Ga0450907_003043 3300042146 Bacteria 3052
197 Ga0450910_055642 3300042147 Bacteria 660
198 Ga0450908_000677 3300042184 Bacteria 6564
199 Ga0450908_046526 3300042184 Bacteria 754
200 Ga0450909_000955 3300042185 Bacteria 3948
201 Ga0450909_025840 3300042185 Bacteria 884
202 Ga0439434_0000575 3300042435 Bacteria 10613
203 Ga0439434_0015017 3300042435 Bacteria 2306
204 Ga0439434_0071101 3300042435 Bacteria 1096
205 Ga0450918_002816 3300042531 Bacteria 3269
206 Ga0466966_0048252 3300044684 Bacteria 2712
207 Ga0466961_0124305 3300044693 Bacteria 1619
208 Ga0466971_0138351 3300044719 Bacteria 1133
209 Ga0466959_0004347 3300045049 Bacteria 9476
210 Ga0495629_0119634 3300046459 Bacteria 1835
211 Ga0495629_0502602 3300046459 Bacteria 817
212 Ga0495638_0174325 3300046460 Bacteria 1232
213 Ga0495653_0033591 3300046463 Bacteria 4063
214 Ga0495639_0004594 3300046475 Bacteria 5922
215 Ga0495664_0109581 3300046477 Bacteria 1666
216 Ga0495594_0117626 3300046499 Bacteria 1501
217 Ga0495594_0537465 3300046499 Bacteria 663
218 Ga0495606_0219597 3300046507 Bacteria 1072
219 Ga0495610_0058694 3300046512 Bacteria 1840
220 Ga0495643_0032984 3300046522 Bacteria 2869
221 Ga0495642_0064541 3300046528 Bacteria 1523
222 Ga0495642_0410782 3300046528 Bacteria 597
223 Ga0495665_0037148 3300046531 Bacteria 2600
224 Ga0495586_0009769 3300046535 Bacteria 5109
225 Ga0495586_0012691 3300046535 Bacteria 4468
226 Ga0495586_0133347 3300046535 Bacteria 1391
227 Ga0495587_0053404 3300046536 Bacteria 2382
228 Ga0495645_0045868 3300046543 Bacteria 3188
229 Ga0495622_0084098 3300046557 Bacteria 1464
230 Ga0495656_0050696 3300046615 Bacteria 1773
231 Ga0495668_0054321 3300046616 Bacteria 2214
232 Ga0495668_0158763 3300046616 Bacteria 1239
233 Ga0495635_0086040 3300046663 Bacteria 2151
234 Ga0495588_0032358 3300046674 Bacteria 2635
235 Ga0495588_0092747 3300046674 Bacteria 1582
236 Ga0495588_0109672 3300046674 Bacteria 1453
237 Ga0495588_0192721 3300046674 Bacteria 1076
238 Ga0495657_0032981 3300046675 Bacteria 3610
239 Ga0495623_0199502 3300046679 Bacteria 1151
240 Ga0495670_0062521 3300046691 Bacteria 1873
241 Ga0495670_0365603 3300046691 Bacteria 777
242 Ga0495671_0269436 3300046692 Bacteria 821
243 Ga0495600_0029684 3300046809 Bacteria 3541
244 Ga0495600_0047063 3300046809 Bacteria 2813
245 Ga0495581_0023907 3300047315 Bacteria 3541
246 Ga0495581_0034612 3300047315 Bacteria 2922
247 Ga0495581_0071639 3300047315 Bacteria 2005
248 Ga0495581_0152791 3300047315 Bacteria 1348
249 Ga0495581_0260310 3300047315 Bacteria 1014
250 Ga0495636_0005711 3300047318 Bacteria 4877
251 Ga0495680_0250800 3300047322 Bacteria 1254
252 Ga0495675_0026821 3300047444 Bacteria 3672
253 Ga0495685_057485 3300047447 Bacteria 1314
254 Ga0495681_0110620 3300047470 Bacteria 1190
255 Ga0495681_0245538 3300047470 Bacteria 709
256 Ga0495684_0328050 3300047471 Bacteria 1092
257 Ga0495593_0101239 3300047673 Bacteria 1477
258 Ga0495593_0125750 3300047673 Bacteria 1303
259 Ga0496100_0039202 3300048903 Bacteria 3007
260 Ga0496100_0057108 3300048903 Bacteria 2556
261 Ga0496101_0077979 3300048904 Bacteria 2442
262 Ga0496102_0096326 3300048905 Bacteria 2743
263 Ga0496102_0106934 3300048905 Bacteria 2604
264 Ga0496102_0315249 3300048905 Bacteria 1473
265 Ga0496102_0424192 3300048905 Bacteria 1249
266 Ga0496103_0043603 3300048906 Bacteria 2762
267 Ga0496103_0054245 3300048906 Bacteria 2484
268 Ga0496104_0394279 3300048907 Bacteria 1296
269 Ga0496104_0553172 3300048907 Bacteria 1061
270 Ga0496105_0334605 3300048908 Bacteria 1211
271 Ga0496106_0089006 3300048909 Bacteria 2380
272 Ga0496106_0210825 3300048909 Bacteria 1547
273 Ga0496108_0838559 3300048911 Bacteria 791
274 Ga0496109_0116601 3300048912 Bacteria 2485
275 Ga0496109_0878247 3300048912 Bacteria 834
276 Ga0496109_1000792 3300048912 Bacteria 773
277 Ga0496110_0151698 3300048913 Bacteria 2098
278 Ga0496110_0427406 3300048913 Bacteria 1207
279 Ga0496111_0108617 3300048914 Bacteria 2042
280 Ga0496111_0344899 3300048914 Bacteria 1102
281 Ga0496111_0880357 3300048914 Bacteria 645
282 Ga0496112_0137193 3300048915 Bacteria 2416
283 Ga0496112_0194818 3300048915 Bacteria 1987
284 Ga0496113_0328232 3300048916 Bacteria 1227
285 Ga0496113_0398145 3300048916 Bacteria 1105
286 Ga0496113_0498532 3300048916 Bacteria 978
287 Ga0496113_0936161 3300048916 Bacteria 684
288 Ga0496114_0300758 3300048917 Bacteria 1416
289 Ga0496114_0874005 3300048917 Bacteria 780
290 Ga0496115_0170079 3300048918 Bacteria 1802
291 Ga0496115_0185143 3300048918 Bacteria 1721
292 Ga0496119_0063149 3300048922 Bacteria 2204
293 Ga0496124_0115368 3300048927 Bacteria 2155
294 Ga0496126_0665954 3300048929 Bacteria 813
295 Ga0501341_03866 3300049131 Bacteria 859
296 Ga0501307_020039 3300049162 Bacteria 862
297 Ga0501312_072255 3300049528 Bacteria 613
298 Ga0501315_012354 3300049531 Bacteria 1055
299 Ga0501316_007504 3300049532 Bacteria 1186
300 Ga0501317_004290 3300049533 Bacteria 1476
301 Ga0501317_041399 3300049533 Bacteria 705
302 Ga0501317_046757 3300049533 Bacteria 677
303 Ga0501318_007792 3300049534 Bacteria 1129
304 Ga0501321_003401 3300049537 Bacteria 1453
305 Ga0501321_008803 3300049537 Bacteria 1078
306 Ga0501323_008102 3300049539 Bacteria 1213
307 Ga0501324_011066 3300049540 Bacteria 830
308 Ga0501325_000977 3300049541 Bacteria 1617
309 Ga0501325_005371 3300049541 Bacteria 1016
310 Ga0501325_017233 3300049541 Bacteria 729
311 Ga0501330_005243 3300049546 Bacteria 822
312 Ga0501032_0015047 3300049569 Bacteria 5467
313 Ga0501032_0029922 3300049569 Bacteria 3734
314 Ga0501034_0017983 3300049571 Bacteria 7251
315 Ga0501036_0052222 3300049572 Bacteria 3462
316 Ga0501037_0001675 3300049573 Bacteria 16117
317 Ga0501037_0066384 3300049573 Bacteria 2628
318 Ga0501038_0174729 3300049574 Bacteria 1736
319 Ga0501039_0133086 3300049575 Bacteria 1952
320 Ga0501043_0012743 3300049579 Bacteria 6572
321 Ga0501043_0045703 3300049579 Bacteria 3443
322 Ga0501043_0103875 3300049579 Bacteria 2232
323 Ga0501279_004129 3300049775 Bacteria 1903
324 Ga0501044_0044428 3300049823 Bacteria 4610
325 nmdc:mga00v17_10164_c1 3300050491 Bacteria 5128
326 Ga0590071_073001 3300059421 Bacteria 847
327 Ga0587072_002402 3300059643 Bacteria 2496
328 Ga0587072_016346 3300059643 Bacteria 1269
329 Ga0587072_031760 3300059643 Bacteria 989
330 Ga0466962_0026560 3300061719 Bacteria 2779
331 2691514334 2690315906 Bacteria 4517044
332 2775656555 2775506735 Bacteria 4556596
333 2808827418 2808606357 Bacteria 4466944
334 2808852783 2808606360 Bacteria 4404006
335 2808878962 2808606366 Bacteria 4415912
336 2808891652 2808606370 Bacteria 4942454
337 2808896783 2808606371 Bacteria 4251511
338 2812320797 2811994871 Bacteria 4497550
339 2844849246 2844849076 Bacteria 4091819
340 2857743200 2857740372 Bacteria 4782044
341 2904497931 2904497146 Bacteria 4731781
342 2904777285 2904776348 Bacteria 4658726
343 2910811311 2910809715 Bacteria 4982797
344 2919034641 2919034639 Bacteria 4763403
345 2919054631 2919051321 Bacteria 4210889
346 2919062383 2919059106 Bacteria 4991624
347 2919393981 2919391150 Bacteria 4884741
348 2919540125 2919538618 Bacteria 4677069
349 2932427952 2932426870 Bacteria 4547726
350 2933421937 2933418574 Bacteria 4476724
351 2939598391 2939598168 Bacteria 4687164
352 2939648374 2939647034 Bacteria 4681660
353 2939675583 2939674588 Bacteria 4844420
354 2945918558 2945916053 Bacteria 4555517
355 2945921162 2945920336 Bacteria 4501603
356 2945942707 2945941187 Bacteria 4682474
357 2945959563 2945956166 Bacteria 5110334
358 2946026145 2946024296 Bacteria 3508095
359 2946038595 2946037020 Bacteria 4900426
360 2946062420 2946059875 Bacteria 4386623
361 2953999870 2953998280 Bacteria 4812144
362 2974306587 2974302888 Bacteria 4369871
363 Ga0495670_0169210
364 JGI25152J39213_1002341
365 JGI25406J46586_10090271
366 rootL2_10221533
367 rootL2_10270454
368 Ga0006562J51391_1006083
369 Ga0065714_10009805
370 Ga0065714_10177156
371 Ga0070676_10113981
372 Ga0070666_10013324
373 Ga0070675_100091198
374 Ga0070674_100157782
375 Ga0070667_100223804
376 Ga0070667_100882186
377 Ga0070678_100350386
378 Ga0068860_101527107
379 Ga0081539_10011375
380 Ga0075432_10012247
381 Ga0105251_10027414
382 Ga0105244_10036498
383 Ga0105243_10024424
384 Ga0105242_10196157
385 Ga0105248_10289433
386 Ga0105246_10000855
387 Ga0105246_10464071
388 Ga0157371_10081721
389 Ga0157369_10054014
390 Ga0157369_10217840
391 Ga0163162_10275000
392 Ga0157375_10272647
393 Ga0163161_10079324
394 Ga0209129_1000028
395 Ga0209025_1000428
396 Ga0209051_1010202
397 Ga0207697_10021002
398 Ga0207655_1041327
399 Ga0207655_1064466
400 Ga0207710_10117924
401 Ga0207680_10010823
402 Ga0207645_10035616
403 Ga0207681_10097589
404 Ga0207687_10568943
405 Ga0207644_10042299
406 Ga0207669_10229735
407 Ga0207691_10003664
408 Ga0207651_10134044
409 Ga0207683_10041664
410 Ga0207428_10024310
411 Ga0268266_10107450
412 Ga0316181_1188391
413 Ga0316182_1074270
414 Ga0307408_100003107
415 Ga0307408_100036164
416 Ga0307408_100047790
417 Ga0307408_100052558
418 Ga0307408_100110869
419 Ga0307408_100175231
420 Ga0307408_100189315
421 Ga0307408_100366924
422 Ga0307408_100437875
423 Ga0307408_100513628
424 Ga0307405_10019135
425 Ga0307405_10048822
426 Ga0307405_10068253
427 Ga0307405_10069304
428 Ga0307405_10093871
429 Ga0307405_10109497
430 Ga0307405_10157299
431 Ga0307405_10290238
432 Ga0307405_11127958
433 Ga0307413_10042852
434 Ga0307413_10110882
435 Ga0307413_10175118
436 Ga0307413_10291139
437 Ga0307413_10428112
438 Ga0307413_10606249
439 Ga0307410_10005192
440 Ga0307410_10107781
441 Ga0307410_10146782
442 Ga0307410_10152443
443 Ga0307410_10247151
444 Ga0307410_10509238
445 Ga0307410_10649985
446 Ga0307406_10030733
447 Ga0307406_10330259
448 Ga0307406_10558123
449 Ga0307407_10005990
450 Ga0307407_10012122
451 Ga0307407_10095151
452 Ga0307407_10182085
453 Ga0307407_10396946
454 Ga0307407_10536993
455 Ga0307407_10562099
456 Ga0307407_10943627
457 Ga0307412_10016035
458 Ga0307412_10030048
459 Ga0307412_10052931
460 Ga0307412_10074400
461 Ga0307412_10102164
462 Ga0307412_10149724
463 Ga0307412_10158103
464 Ga0307412_10164275
465 Ga0307412_10334232
466 Ga0307412_10744347
467 Ga0307409_100040923
468 Ga0307409_100118743
469 Ga0307409_100126686
470 Ga0307409_100152125
471 Ga0307409_100268422
472 Ga0307409_100292838
473 Ga0307409_100459692
474 Ga0307409_100826369
475 Ga0307409_101010162
476 Ga0307409_101041836
477 Ga0307416_100011975
478 Ga0307416_100113286
479 Ga0307416_100208805
480 Ga0307416_100493192
481 Ga0307416_100626522
482 Ga0307416_100689794
483 Ga0307416_100936909
484 Ga0307416_101011587
485 Ga0307416_101711120
486 Ga0307414_10041821
487 Ga0307414_10066815
488 Ga0307414_10198493
489 Ga0307411_10024127
490 Ga0307411_10398124
491 Ga0307411_10460508
492 Ga0307415_100106905
493 Ga0307415_100229770
494 Ga0307415_100426447
495 Ga0307415_100691485
496 Ga0395899_0018370
497 Ga0395899_0114431
498 Ga0395899_0177626
499 Ga0395900_0133299
500 Ga0395900_0310790
501 Ga0395900_0397884
502 Ga0395898_0082635
503 Ga0395898_0220213
504 Ga0395905_0416651
505 Ga0395901_0028352
506 Ga0395901_0058208
507 Ga0395901_0137107
508 Ga0439436_0015963
509 Ga0439438_055504
510 Ga0439439_0000357
511 Ga0439439_0091697
512 Ga0439447_091615
513 Ga0439461_0023267
514 Ga0439466_0054026
515 Ga0439466_0116768
516 Ga0439466_0148402
517 Ga0439466_0264105
518 Ga0439465_0007160
519 Ga0439465_0027169
520 Ga0439465_0267344
521 Ga0451793_1069314
522 Ga0451833_0554634
523 Ga0451837_1387237
524 Ga0451841_0238187
525 Ga0451845_0055593
526 Ga0451853_2783293
527 Ga0439431_0051868
528 Ga0439433_0000558
529 Ga0439442_000003
530 Ga0439442_000415
531 Ga0439442_005266
532 Ga0439442_009892
533 Ga0439445_0050444
534 Ga0439445_0179255
535 Ga0439432_000482
536 Ga0439432_040433
537 Ga0439449_0001698
538 Ga0439449_0005147
539 Ga0439449_0041947
540 Ga0439449_0104194
541 Ga0439449_0119453
542 Ga0439452_007162
543 Ga0439452_064189
544 Ga0439457_000850
545 Ga0439457_005851
546 Ga0439457_057931
547 Ga0439462_0002088
548 Ga0439462_0009672
549 Ga0439462_0022399
550 Ga0439462_0091389
551 Ga0450919_000504
552 Ga0450920_000755
553 Ga0450920_001702
554 Ga0450920_057427
555 Ga0450923_114546
556 Ga0450906_015364
557 Ga0450907_002580
558 Ga0450907_003043
559 Ga0450910_055642
560 Ga0450908_000677
561 Ga0450908_046526
562 Ga0450909_000955
563 Ga0450909_025840
564 Ga0439434_0000575
565 Ga0439434_0015017
566 Ga0439434_0071101
567 Ga0450918_002816
568 Ga0466966_0048252
569 Ga0466961_0124305
570 Ga0466971_0138351
571 Ga0466959_0004347
572 Ga0495629_0119634
573 Ga0495629_0502602
574 Ga0495638_0174325
575 Ga0495653_0033591
576 Ga0495639_0004594
577 Ga0495664_0109581
578 Ga0495594_0117626
579 Ga0495594_0537465
580 Ga0495606_0219597
581 Ga0495610_0058694
582 Ga0495643_0032984
583 Ga0495642_0064541
584 Ga0495642_0410782
585 Ga0495665_0037148
586 Ga0495586_0009769
587 Ga0495586_0012691
588 Ga0495586_0133347
589 Ga0495587_0053404
590 Ga0495645_0045868
591 Ga0495622_0084098
592 Ga0495656_0050696
593 Ga0495668_0054321
594 Ga0495668_0158763
595 Ga0495635_0086040
596 Ga0495588_0032358
597 Ga0495588_0092747
598 Ga0495588_0109672
599 Ga0495588_0192721
600 Ga0495657_0032981
601 Ga0495623_0199502
602 Ga0495670_0062521
603 Ga0495670_0365603
604 Ga0495671_0269436
605 Ga0495600_0029684
606 Ga0495600_0047063
607 Ga0495581_0023907
608 Ga0495581_0034612
609 Ga0495581_0071639
610 Ga0495581_0152791
611 Ga0495581_0260310
612 Ga0495636_0005711
613 Ga0495680_0250800
614 Ga0495675_0026821
615 Ga0495685_057485
616 Ga0495681_0110620
617 Ga0495681_0245538
618 Ga0495684_0328050
619 Ga0495593_0101239
620 Ga0495593_0125750
621 Ga0496100_0039202
622 Ga0496100_0057108
623 Ga0496101_0077979
624 Ga0496102_0096326
625 Ga0496102_0106934
626 Ga0496102_0315249
627 Ga0496102_0424192
628 Ga0496103_0043603
629 Ga0496103_0054245
630 Ga0496104_0394279
631 Ga0496104_0553172
632 Ga0496105_0334605
633 Ga0496106_0089006
634 Ga0496106_0210825
635 Ga0496108_0838559
636 Ga0496109_0116601
637 Ga0496109_0878247
638 Ga0496109_1000792
639 Ga0496110_0151698
640 Ga0496110_0427406
641 Ga0496111_0108617
642 Ga0496111_0344899
643 Ga0496111_0880357
644 Ga0496112_0137193
645 Ga0496112_0194818
646 Ga0496113_0328232
647 Ga0496113_0398145
648 Ga0496113_0498532
649 Ga0496113_0936161
650 Ga0496114_0300758
651 Ga0496114_0874005
652 Ga0496115_0170079
653 Ga0496115_0185143
654 Ga0496119_0063149
655 Ga0496124_0115368
656 Ga0496126_0665954
657 Ga0501341_03866
658 Ga0501307_020039
659 Ga0501312_072255
660 Ga0501315_012354
661 Ga0501316_007504
662 Ga0501317_004290
663 Ga0501317_041399
664 Ga0501317_046757
665 Ga0501318_007792
666 Ga0501321_003401
667 Ga0501321_008803
668 Ga0501323_008102
669 Ga0501324_011066
670 Ga0501325_000977
671 Ga0501325_005371
672 Ga0501325_017233
673 Ga0501330_005243
674 Ga0501032_0015047
675 Ga0501032_0029922
676 Ga0501034_0017983
677 Ga0501036_0052222
678 Ga0501037_0001675
679 Ga0501037_0066384
680 Ga0501038_0174729
681 Ga0501039_0133086
682 Ga0501043_0012743
683 Ga0501043_0045703
684 Ga0501043_0103875
685 Ga0501279_004129
686 Ga0501044_0044428
687 nmdc:mga00v17_10164_c1
688 Ga0590071_073001
689 Ga0587072_002402
690 Ga0587072_016346
691 Ga0587072_031760
692 Ga0466962_0026560
693 2691514334
694 2775656555
695 2808827418
696 2808852783
697 2808878962
698 2808891652
699 2808896783
700 2812320797
701 2844849246
702 2857743200
703 2904497931
704 2904777285
705 2910811311
706 2919034641
707 2919054631
708 2919062383
709 2919393981
710 2919540125
711 2932427952
712 2933421937
713 2939598391
714 2939648374
715 2939675583
716 2945918558
717 2945921162
718 2945942707
719 2945959563
720 2946026145
721 2946038595
722 2946062420
723 2953999870
724 2974306587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

40

165

0.99

PF08534

Redoxin

Redoxin

39

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9529 14 163
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9437 14 163
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9417 14 163
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9406 14 163
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9288 14 163
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9437 14 163 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9131 16 163 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 17 163 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9018 17 163 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9008 16 163 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Y3NGE8-F1-model_v4 Peroxiredoxin 0.9775 14 163 GO:0016209
GO:0016491
AF-A0A0Q9N4E7-F1-model_v4 Peroxiredoxin 0.9775 14 163 GO:0016209
GO:0016491
AF-A0A4Y6QRH6-F1-model_v4 deleted 0.9759 14 163
AF-A0A0A0C2W7-F1-model_v4 Thioredoxin domain-containing protein 0.9729 14 163 GO:0016020
GO:0016209
GO:0016491
AF-A0A6G2VNS9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9728 14 163 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map