F422644

General Info

Members Datasets Scaffolds Average Seq Length
362 234 362 119

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10000005|Ga0265326_1000000570
Length 138
Sequence VTRCYKLPALGAITVHALLTSYGPALVFLAIGLIVAAAFGTAPRLLGPRRASASRESQLSPYECGLPSEVSSSFRFGISFYLIAMLFILFDIEVIFLYPIAVQLRAFGSFALVETVVFVVLLMVAFVYVWRRGALEWK

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 6.08
Rhizosphere 88.12
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1050348 3300000549 Bacteria 500
2 JGI24746J21847_1037162 3300001977 Bacteria 674
3 JGI24738J21930_10006809 3300002075 Bacteria 2655
4 JGI24749J21850_1011056 3300002076 Bacteria 1266
5 JGI24033J26618_1074524 3300002155 Bacteria 514
6 JGI25404J52841_10060358 3300003659 Bacteria 794
7 Ga0070676_10070747 3300005328 Bacteria 2094
8 Ga0070683_100047627 3300005329 Bacteria 3961
9 Ga0070683_100590620 3300005329 Bacteria 1062
10 Ga0070683_100659812 3300005329 Bacteria 1001
11 Ga0070683_101378246 3300005329 Bacteria 678
12 Ga0068869_100039058 3300005334 Bacteria 3387
13 Ga0070680_100474136 3300005336 Bacteria 1070
14 Ga0070680_101794968 3300005336 Bacteria 532
15 Ga0070680_101840450 3300005336 Bacteria 525
16 Ga0070682_100011918 3300005337 Bacteria 4974
17 Ga0070682_100105461 3300005337 Bacteria 1869
18 Ga0068868_100016295 3300005338 Bacteria 5515
19 Ga0068868_100744953 3300005338 Bacteria 880
20 Ga0070660_100333754 3300005339 Bacteria 1247
21 Ga0070689_100291253 3300005340 Bacteria 1357
22 Ga0070691_10205370 3300005341 Bacteria 1037
23 Ga0070661_100211111 3300005344 Bacteria 1486
24 Ga0070692_10163257 3300005345 Bacteria 1278
25 Ga0070669_100007785 3300005353 Bacteria 7654
26 Ga0070675_100109516 3300005354 Bacteria 2334
27 Ga0070671_100470864 3300005355 Bacteria 1079
28 Ga0070688_100145148 3300005365 Bacteria 1616
29 Ga0070659_100078321 3300005366 Bacteria 2637
30 Ga0070667_101335651 3300005367 Bacteria 672
31 Ga0070714_100019766 3300005435 Bacteria 5493
32 Ga0070714_100124993 3300005435 Bacteria 2292
33 Ga0070714_102380497 3300005435 Bacteria 515
34 Ga0070713_100183295 3300005436 Bacteria 1882
35 Ga0070713_100372180 3300005436 Bacteria 1329
36 Ga0070710_10000013 3300005437 Bacteria 117825
37 Ga0070701_10086318 3300005438 Bacteria 1710
38 Ga0070711_100149103 3300005439 Bacteria 1762
39 Ga0070705_100127848 3300005440 Bacteria 1652
40 Ga0070700_100000631 3300005441 Bacteria 17489
41 Ga0070694_101918269 3300005444 Bacteria 506
42 Ga0070663_100025790 3300005455 Bacteria 3973
43 Ga0070663_100943073 3300005455 Bacteria 748
44 Ga0070678_100342048 3300005456 Bacteria 1284
45 Ga0070678_100565855 3300005456 Bacteria 1011
46 Ga0070678_101021184 3300005456 Bacteria 761
47 Ga0070662_100133203 3300005457 Bacteria 1919
48 Ga0070662_101033954 3300005457 Bacteria 704
49 Ga0070681_10317698 3300005458 Bacteria 1467
50 Ga0070685_10076530 3300005466 Bacteria 1996
51 Ga0070679_101140067 3300005530 Bacteria 725
52 Ga0070684_100001176 3300005535 Bacteria 18794
53 Ga0068853_100929970 3300005539 Bacteria 836
54 Ga0070672_100383694 3300005543 Bacteria 1202
55 Ga0070686_100335133 3300005544 Bacteria 1132
56 Ga0070695_100057645 3300005545 Bacteria 2510
57 Ga0070704_100049333 3300005549 Bacteria 2953
58 Ga0070704_100743332 3300005549 Bacteria 873
59 Ga0070664_100019045 3300005564 Bacteria 5644
60 Ga0068857_100069167 3300005577 Bacteria 3144
61 Ga0068854_100038742 3300005578 Bacteria 3354
62 Ga0068854_101374334 3300005578 Bacteria 638
63 Ga0068856_100020258 3300005614 Bacteria 6459
64 Ga0070702_100009653 3300005615 Bacteria 4732
65 Ga0070702_101469324 3300005615 Bacteria 560
66 Ga0068852_100150882 3300005616 Bacteria 2161
67 Ga0068864_100075430 3300005618 Bacteria 2944
68 Ga0068866_10079171 3300005718 Bacteria 1760
69 Ga0068861_100719146 3300005719 Bacteria 930
70 Ga0068863_100385919 3300005841 Bacteria 1368
71 Ga0068860_100611594 3300005843 Bacteria 1096
72 Ga0068862_100188693 3300005844 Bacteria 1854
73 Ga0068862_100353005 3300005844 Bacteria 1365
74 Ga0081455_10007545 3300005937 Bacteria 11439
75 Ga0081540_1000568 3300005983 Bacteria 35821
76 Ga0081540_1303124 3300005983 Bacteria 549
77 Ga0081539_10005444 3300005985 Bacteria 12992
78 Ga0070717_10012631 3300006028 Bacteria 6443
79 Ga0070717_10028271 3300006028 Bacteria 4487
80 Ga0070717_10169961 3300006028 Bacteria 1896
81 Ga0070717_10463887 3300006028 Bacteria 1142
82 Ga0075432_10157572 3300006058 Bacteria 876
83 Ga0075432_10506356 3300006058 Bacteria 539
84 Ga0070715_10952123 3300006163 Bacteria 532
85 Ga0070712_100000013 3300006175 Bacteria 109912
86 Ga0075428_100390072 3300006844 Bacteria 1493
87 Ga0075428_100628582 3300006844 Bacteria 1146
88 Ga0075430_100889289 3300006846 Bacteria 734
89 Ga0075431_100008379 3300006847 Bacteria 10343
90 Ga0075433_10197050 3300006852 Bacteria 1791
91 Ga0075433_11347998 3300006852 Bacteria 618
92 Ga0075434_100922977 3300006871 Bacteria 888
93 Ga0075429_100006922 3300006880 Bacteria 9851
94 Ga0075429_100223155 3300006880 Bacteria 1650
95 Ga0068865_100222057 3300006881 Bacteria 1478
96 Ga0075436_100099373 3300006914 Bacteria 2026
97 Ga0075435_100390750 3300007076 Bacteria 1196
98 Ga0105244_10186649 3300009036 Bacteria 981
99 Ga0105240_10018075 3300009093 Bacteria 9479
100 Ga0111539_10282438 3300009094 Bacteria 1932
101 Ga0111539_10329278 3300009094 Bacteria 1778
102 Ga0105245_10031336 3300009098 Bacteria 4705
103 Ga0105247_10267477 3300009101 Bacteria 1175
104 Ga0114129_10636847 3300009147 Bacteria 1377
105 Ga0114129_10724696 3300009147 Bacteria 1276
106 Ga0105243_10395169 3300009148 Bacteria 1283
107 Ga0105243_10695849 3300009148 Bacteria 990
108 Ga0105243_10933881 3300009148 Bacteria 865
109 Ga0105241_10188855 3300009174 Bacteria 1714
110 Ga0105242_11683795 3300009176 Bacteria 670
111 Ga0105248_10194596 3300009177 Bacteria 2284
112 Ga0105237_11048967 3300009545 Bacteria 822
113 Ga0105249_10083347 3300009553 Bacteria 2976
114 Ga0105249_10149472 3300009553 Bacteria 2247
115 Ga0105239_10130872 3300010375 Bacteria 2791
116 Ga0105246_10148383 3300011119 Bacteria 1772
117 Ga0105246_10242685 3300011119 Bacteria 1425
118 Ga0157369_10357905 3300013105 Bacteria 1515
119 Ga0157369_11238693 3300013105 Bacteria 761
120 Ga0157369_11273423 3300013105 Bacteria 750
121 Ga0157374_10015146 3300013296 Bacteria 6762
122 Ga0163162_10735314 3300013306 Bacteria 1107
123 Ga0157372_10018103 3300013307 Bacteria 7572
124 Ga0157372_11335011 3300013307 Bacteria 827
125 Ga0157375_10615079 3300013308 Bacteria 1245
126 Ga0163163_10210292 3300014325 Bacteria 1994
127 Ga0157380_10301211 3300014326 Bacteria 1477
128 Ga0157380_12383700 3300014326 Bacteria 594
129 Ga0157377_10017745 3300014745 Bacteria 3687
130 Ga0157376_10039932 3300014969 Bacteria 3832
131 Ga0197907_10675038 3300020069 Bacteria 569
132 Ga0213876_10032070 3300021384 Bacteria 2772
133 Ga0207692_10000003 3300025898 Bacteria 431531
134 Ga0207642_10106307 3300025899 Bacteria 1420
135 Ga0207688_10009130 3300025901 Bacteria 5399
136 Ga0207647_10059932 3300025904 Bacteria 2328
137 Ga0207699_10384306 3300025906 Bacteria 997
138 Ga0207645_10079732 3300025907 Bacteria 2098
139 Ga0207643_10484893 3300025908 Bacteria 789
140 Ga0207707_10220994 3300025912 Bacteria 1649
141 Ga0207671_10801051 3300025914 Bacteria 747
142 Ga0207693_10007488 3300025915 Bacteria 8975
143 Ga0207663_10767500 3300025916 Bacteria 766
144 Ga0207660_10595041 3300025917 Bacteria 901
145 Ga0207660_11524890 3300025917 Bacteria 540
146 Ga0207657_10301276 3300025919 Bacteria 1269
147 Ga0207649_10151458 3300025920 Bacteria 1598
148 Ga0207652_10437324 3300025921 Bacteria 1179
149 Ga0207681_10003442 3300025923 Bacteria 9870
150 Ga0207650_10655199 3300025925 Bacteria 885
151 Ga0207659_10142742 3300025926 Bacteria 1860
152 Ga0207687_10018790 3300025927 Bacteria 4569
153 Ga0207700_10053590 3300025928 Bacteria 3023
154 Ga0207664_10002161 3300025929 Bacteria 12930
155 Ga0207664_10032533 3300025929 Bacteria 3998
156 Ga0207664_10043822 3300025929 Bacteria 3502
157 Ga0207664_10484199 3300025929 Bacteria 1107
158 Ga0207644_10383621 3300025931 Bacteria 1146
159 Ga0207690_10364164 3300025932 Bacteria 1146
160 Ga0207706_10135359 3300025933 Bacteria 2167
161 Ga0207709_10267186 3300025935 Bacteria 1257
162 Ga0207709_10380603 3300025935 Bacteria 1074
163 Ga0207670_10058186 3300025936 Bacteria 2625
164 Ga0207704_10041636 3300025938 Bacteria 2696
165 Ga0207665_10358605 3300025939 Bacteria 1102
166 Ga0207691_10388488 3300025940 Bacteria 1191
167 Ga0207711_10423624 3300025941 Bacteria 1238
168 Ga0207661_10265775 3300025944 Bacteria 1529
169 Ga0207679_10014491 3300025945 Bacteria 5186
170 Ga0207679_11520992 3300025945 Bacteria 614
171 Ga0207712_10103444 3300025961 Bacteria 2122
172 Ga0207712_11169000 3300025961 Bacteria 686
173 Ga0207712_11294379 3300025961 Bacteria 651
174 Ga0207640_10069291 3300025981 Bacteria 2368
175 Ga0207677_10039119 3300026023 Bacteria 3115
176 Ga0207678_10329205 3300026067 Bacteria 1315
177 Ga0207708_10033729 3300026075 Bacteria 3891
178 Ga0207708_10484401 3300026075 Bacteria 1035
179 Ga0207708_10678872 3300026075 Bacteria 879
180 Ga0207702_10234415 3300026078 Bacteria 1717
181 Ga0207641_10332476 3300026088 Bacteria 1444
182 Ga0207676_10032249 3300026095 Bacteria 3946
183 Ga0207674_10098701 3300026116 Bacteria 2904
184 Ga0207675_100347375 3300026118 Bacteria 1453
185 Ga0207675_100753609 3300026118 Bacteria 985
186 Ga0207683_10318714 3300026121 Bacteria 1424
187 Ga0207698_10111521 3300026142 Bacteria 2293
188 Ga0207428_10224718 3300027907 Bacteria 1406
189 Ga0207428_10913767 3300027907 Bacteria 620
190 Ga0268266_10533233 3300028379 Bacteria 1123
191 Ga0268265_10531763 3300028380 Bacteria 1113
192 Ga0268264_11780680 3300028381 Bacteria 626
193 Ga0265326_10000005 3300028558 Bacteria 257124
194 Ga0265319_1000756 3300028563 Bacteria 21053
195 Ga0265334_10000024 3300028573 Bacteria 118525
196 Ga0265336_10006532 3300028666 Bacteria 4196
197 Ga0265338_10008060 3300028800 Bacteria 12884
198 Ga0265324_10001235 3300029957 Bacteria 15108
199 Ga0265327_10097556 3300031251 Bacteria 1423
200 Ga0307405_11561903 3300031731 Bacteria 581
201 Ga0307409_101679151 3300031995 Bacteria 664
202 Ga0307416_100072698 3300032002 Bacteria 2864
203 Ga0307414_10209494 3300032004 Bacteria 1592
204 Ga0307411_10453752 3300032005 Bacteria 1073
205 Ga0307411_11514487 3300032005 Bacteria 617
206 Ga0307415_100331012 3300032126 Bacteria 1274
207 Ga0373956_0264491 3300035119 Bacteria 818
208 Ga0373943_0092874 3300035170 Bacteria 1566
209 Ga0373955_0937153 3300035172 Bacteria 533
210 Ga0373947_0210142 3300035725 Bacteria 1276
211 Ga0373947_1004552 3300035725 Bacteria 569
212 Ga0395899_0726287 3300037312 Bacteria 621
213 Ga0395900_1343336 3300037418 Bacteria 628
214 Ga0395898_0160077 3300037466 Bacteria 2153
215 Ga0395898_0350362 3300037466 Bacteria 1408
216 Ga0395898_1182728 3300037466 Bacteria 696
217 Ga0395905_0646894 3300037471 Bacteria 959
218 Ga0395905_1576583 3300037471 Bacteria 561
219 Ga0436364_0174186 3300037853 Bacteria 2505
220 Ga0436364_0614834 3300037853 Bacteria 2707
221 Ga0436364_0726202 3300037853 Bacteria 1211
222 Ga0436364_0895093 3300037853 Bacteria 754
223 Ga0436364_1503518 3300037853 Bacteria 1026
224 Ga0395901_0394674 3300038443 Bacteria 1422
225 Ga0395901_0573896 3300038443 Bacteria 1140
226 Ga0395901_0739062 3300038443 Bacteria 978
227 Ga0436365_0257436 3300039437 Bacteria 684
228 Ga0436365_0274890 3300039437 Bacteria 1782
229 Ga0436365_0589336 3300039437 Bacteria 4971
230 Ga0436365_1054191 3300039437 Bacteria 2219
231 Ga0436365_1102108 3300039437 Bacteria 21525
232 Ga0436365_1610717 3300039437 Bacteria 3247
233 Ga0436363_0007777 3300039450 Bacteria 1225
234 Ga0436363_0393160 3300039450 Bacteria 994
235 Ga0436363_0860590 3300039450 Bacteria 597
236 Ga0436363_1252399 3300039450 Bacteria 745
237 Ga0436362_0009240 3300039453 Bacteria 549
238 Ga0436362_0239758 3300039453 Bacteria 2799
239 Ga0436362_0481547 3300039453 Bacteria 1426
240 Ga0436362_0525860 3300039453 Bacteria 799
241 Ga0436362_0643297 3300039453 Bacteria 639
242 Ga0451802_2061761 3300041460 Bacteria 1151
243 Ga0451835_0562988 3300041492 Bacteria 913
244 Ga0451849_0716068 3300041505 Bacteria 935
245 Ga0451853_0845112 3300041512 Bacteria 589
246 Ga0451853_3335020 3300041512 Bacteria 790
247 Ga0439459_0036793 3300042438 Bacteria 1023
248 Ga0466965_0056854 3300044683 Bacteria 1949
249 Ga0466965_0378468 3300044683 Bacteria 779
250 Ga0466966_0039313 3300044684 Bacteria 3047
251 Ga0466966_0071244 3300044684 Bacteria 2178
252 Ga0466966_0711112 3300044684 Bacteria 605
253 Ga0466961_0007593 3300044693 Bacteria 6907
254 Ga0466961_0018168 3300044693 Bacteria 4521
255 Ga0466961_0131965 3300044693 Bacteria 1565
256 Ga0466961_0141732 3300044693 Bacteria 1504
257 Ga0466961_0703271 3300044693 Bacteria 605
258 Ga0466963_0006643 3300044694 Bacteria 6867
259 Ga0466963_0010004 3300044694 Bacteria 5732
260 Ga0466963_0033878 3300044694 Bacteria 3320
261 Ga0466963_0040185 3300044694 Bacteria 3066
262 Ga0466963_0556709 3300044694 Bacteria 810
263 Ga0466964_0181741 3300044706 Bacteria 998
264 Ga0466964_0295907 3300044706 Bacteria 814
265 Ga0466971_0015389 3300044719 Bacteria 3366
266 Ga0466971_0030125 3300044719 Bacteria 2428
267 Ga0466968_0063199 3300044735 Bacteria 1600
268 Ga0466968_0155875 3300044735 Bacteria 1052
269 Ga0466968_0386106 3300044735 Bacteria 685
270 Ga0466968_0460140 3300044735 Bacteria 630
271 Ga0466968_0460712 3300044735 Bacteria 629
272 Ga0466970_0189844 3300044765 Bacteria 1141
273 Ga0466970_0340545 3300044765 Bacteria 850
274 Ga0466970_0412817 3300044765 Bacteria 771
275 Ga0466970_0795072 3300044765 Bacteria 554
276 Ga0466957_0045760 3300044842 Bacteria 2654
277 Ga0466957_0094223 3300044842 Bacteria 1880
278 Ga0466957_0324798 3300044842 Bacteria 1039
279 Ga0466957_1023607 3300044842 Bacteria 594
280 Ga0466960_0297859 3300044901 Bacteria 908
281 Ga0466960_0467256 3300044901 Bacteria 735
282 Ga0466960_0645907 3300044901 Bacteria 631
283 Ga0466959_0000694 3300045049 Bacteria 19701
284 Ga0466959_0006901 3300045049 Bacteria 7927
285 Ga0466959_0032890 3300045049 Bacteria 3838
286 Ga0466959_0046460 3300045049 Bacteria 3194
287 Ga0466959_0201448 3300045049 Bacteria 1386
288 Ga0466959_0216798 3300045049 Bacteria 1328
289 Ga0466959_0254894 3300045049 Bacteria 1209
290 Ga0466959_0825359 3300045049 Bacteria 619
291 Ga0466958_0008346 3300045836 Bacteria 5740
292 Ga0466958_0022019 3300045836 Bacteria 3728
293 Ga0466958_0031870 3300045836 Bacteria 3133
294 Ga0466958_0047986 3300045836 Bacteria 2579
295 Ga0466958_0076611 3300045836 Bacteria 2053
296 Ga0466958_0117468 3300045836 Bacteria 1663
297 Ga0466958_0434396 3300045836 Bacteria 849
298 Ga0466967_0006851 3300045976 Bacteria 8130
299 Ga0466967_0117594 3300045976 Bacteria 2451
300 Ga0466967_0203286 3300045976 Bacteria 1877
301 Ga0466967_0655828 3300045976 Bacteria 1038
302 Ga0466967_0829965 3300045976 Bacteria 918
303 Ga0495629_0659233 3300046459 Bacteria 697
304 Ga0495641_0034868 3300046461 Bacteria 2376
305 Ga0495641_0421897 3300046461 Bacteria 606
306 Ga0495651_0872048 3300046462 Bacteria 552
307 Ga0495582_0128505 3300046473 Bacteria 1431
308 Ga0495662_0654152 3300046476 Bacteria 513
309 Ga0495664_0374771 3300046477 Bacteria 856
310 Ga0495665_0105355 3300046531 Bacteria 1480
311 Ga0495640_0272136 3300046533 Bacteria 1056
312 Ga0495645_0666950 3300046543 Bacteria 634
313 Ga0495588_0312619 3300046674 Bacteria 827
314 Ga0495658_0396026 3300046683 Bacteria 880
315 Ga0495581_0270603 3300047315 Bacteria 993
316 Ga0495674_0667891 3300047319 Bacteria 818
317 Ga0495672_0052078 3300047320 Bacteria 2406
318 Ga0495680_0564944 3300047322 Bacteria 765
319 Ga0495602_0244325 3300048088 Bacteria 1341
320 Ga0496100_0000450 3300048903 Bacteria 19877
321 Ga0496100_1432678 3300048903 Bacteria 545
322 Ga0496101_0011341 3300048904 Bacteria 5911
323 Ga0496102_0008194 3300048905 Bacteria 8941
324 Ga0496104_0018185 3300048907 Bacteria 6410
325 Ga0496105_0014697 3300048908 Bacteria 6232
326 Ga0496106_0042998 3300048909 Bacteria 3389
327 Ga0496107_0101434 3300048910 Bacteria 2110
328 Ga0496108_0012091 3300048911 Bacteria 7018
329 Ga0496109_0002676 3300048912 Bacteria 14960
330 Ga0496110_0038804 3300048913 Bacteria 4145
331 Ga0496111_0012371 3300048914 Bacteria 5775
332 Ga0496112_0000095 3300048915 Bacteria 57431
333 Ga0496112_0066430 3300048915 Bacteria 3558
334 Ga0496112_0097313 3300048915 Bacteria 2913
335 Ga0496112_0923676 3300048915 Bacteria 794
336 Ga0496113_0050824 3300048916 Bacteria 3092
337 Ga0496113_0113703 3300048916 Bacteria 2110
338 Ga0496113_0781296 3300048916 Bacteria 759
339 Ga0496114_0175803 3300048917 Bacteria 1868
340 Ga0496115_0229016 3300048918 Bacteria 1533
341 Ga0501048_0588048 3300049582 Bacteria 799
342 nmdc:mga05p37_1055197_c1 3300050507 Bacteria 856
343 nmdc:mga09592_304326_c1 3300050508 Bacteria 1382
344 nmdc:mga0qj67_823275_c1 3300050509 Bacteria 734
345 nmdc:mga06r32_7689_c1 3300050510 Bacteria 9695
346 nmdc:mga08y16_167466_c1 3300050511 Bacteria 2283
347 nmdc:mga08y16_357143_c1 3300050511 Bacteria 1500
348 nmdc:mga08y16_866498_c1 3300050511 Bacteria 891
349 nmdc:mga0n895_137233_c1 3300050512 Bacteria 2473
350 nmdc:mga0n895_271514_c1 3300050512 Bacteria 1720
351 nmdc:mga0rr50_1126788_c1 3300050513 Bacteria 667
352 nmdc:mga08x19_70212_c1 3300050514 Bacteria 2282
353 nmdc:mga0a205_164574_c1 3300050515 Bacteria 2114
354 Ga0495601_0318935 3300053077 Bacteria 1012
355 Ga0495601_0486909 3300053077 Bacteria 797
356 Ga0495612_0420569 3300053078 Bacteria 609
357 Ga0500616_0004560 3300053153 Bacteria 9808
358 Ga0587111_0240683 3300060346 Bacteria 531
359 Ga0466962_0016871 3300061719 Bacteria 3519
360 Ga0466962_0038772 3300061719 Bacteria 2282
361 Ga0466962_0054680 3300061719 Bacteria 1907
362 Ga0466962_0415930 3300061719 Bacteria 674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0646894 Ga0395905_0646894_287_652 109
2 3300038443 Ga0395901_0573896 Ga0395901_0573896_590_955 109
3 3300041512 Ga0451853_3335020 Ga0451853_3335020_191_547 111
4 3300013105 Ga0157369_11238693 Ga0157369_112386932 113
5 3300035119 Ga0373956_0264491 Ga0373956_0264491_246_587 113
6 3300035170 Ga0373943_0092874 Ga0373943_0092874_980_1321 113
7 3300035172 Ga0373955_0937153 Ga0373955_0937153_92_433 113
8 3300035725 Ga0373947_1004552 Ga0373947_1004552_157_498 113
9 3300037853 Ga0436364_0174186 Ga0436364_0174186_1718_2059 113
10 3300041512 Ga0451853_0845112 Ga0451853_0845112_83_424 113
11 3300046459 Ga0495629_0659233 Ga0495629_0659233_125_466 113
12 3300046461 Ga0495641_0034868 Ga0495641_0034868_468_809 113
13 3300046461 Ga0495641_0421897 Ga0495641_0421897_52_393 113
14 3300046473 Ga0495582_0128505 Ga0495582_0128505_930_1271 113
15 3300046476 Ga0495662_0654152 Ga0495662_0654152_73_414 113
16 3300046531 Ga0495665_0105355 Ga0495665_0105355_926_1267 113
17 3300046533 Ga0495640_0272136 Ga0495640_0272136_587_928 113
18 3300047315 Ga0495581_0270603 Ga0495581_0270603_450_791 113
19 3300047319 Ga0495674_0667891 Ga0495674_0667891_46_387 113
20 3300047322 Ga0495680_0564944 Ga0495680_0564944_50_391 113
21 3300048916 Ga0496113_0113703 Ga0496113_0113703_1011_1352 113
22 3300005367 Ga0070667_101335651 Ga0070667_1013356511 117
23 3300005457 Ga0070662_101033954 Ga0070662_1010339542 117
24 3300005544 Ga0070686_100335133 Ga0070686_1003351331 117
25 3300005844 Ga0068862_100353005 Ga0068862_1003530052 117
26 3300026075 Ga0207708_10484401 Ga0207708_104844012 117
27 3300039453 Ga0436362_0525860 Ga0436362_0525860_420_773 117
28 3300044684 Ga0466966_0039313 Ga0466966_0039313_2590_2943 117
29 3300044706 Ga0466964_0181741 Ga0466964_0181741_90_443 117
30 3300044735 Ga0466968_0155875 Ga0466968_0155875_147_500 117
31 3300044765 Ga0466970_0340545 Ga0466970_0340545_452_805 117
32 3300045049 Ga0466959_0201448 Ga0466959_0201448_700_1059 117
33 3300045836 Ga0466958_0434396 Ga0466958_0434396_226_579 117
34 3300046674 Ga0495588_0312619 Ga0495588_0312619_161_520 117
35 3300053077 Ga0495601_0318935 Ga0495601_0318935_272_625 117
36 3300000549 LJQas_1050348 LJQas_10503482 118
37 3300001977 JGI24746J21847_1037162 JGI24746J21847_10371622 118
38 3300002075 JGI24738J21930_10006809 JGI24738J21930_100068092 118
39 3300002076 JGI24749J21850_1011056 JGI24749J21850_10110562 118
40 3300002155 JGI24033J26618_1074524 JGI24033J26618_10745242 118
41 3300003659 JGI25404J52841_10060358 JGI25404J52841_100603582 118
42 3300005328 Ga0070676_10070747 Ga0070676_100707472 118
43 3300005329 Ga0070683_100047627 Ga0070683_1000476275 118
44 3300005329 Ga0070683_100590620 Ga0070683_1005906202 118
45 3300005329 Ga0070683_100659812 Ga0070683_1006598121 118
46 3300005329 Ga0070683_101378246 Ga0070683_1013782461 118
47 3300005334 Ga0068869_100039058 Ga0068869_1000390584 118
48 3300005336 Ga0070680_100474136 Ga0070680_1004741361 118
49 3300005336 Ga0070680_101794968 Ga0070680_1017949681 118
50 3300005336 Ga0070680_101840450 Ga0070680_1018404501 118
51 3300005337 Ga0070682_100011918 Ga0070682_1000119183 118
52 3300005337 Ga0070682_100105461 Ga0070682_1001054613 118
53 3300005338 Ga0068868_100016295 Ga0068868_1000162956 118
54 3300005338 Ga0068868_100744953 Ga0068868_1007449531 118
55 3300005339 Ga0070660_100333754 Ga0070660_1003337542 118
56 3300005340 Ga0070689_100291253 Ga0070689_1002912533 118
57 3300005341 Ga0070691_10205370 Ga0070691_102053702 118
58 3300005344 Ga0070661_100211111 Ga0070661_1002111113 118
59 3300005345 Ga0070692_10163257 Ga0070692_101632572 118
60 3300005353 Ga0070669_100007785 Ga0070669_1000077855 118
61 3300005354 Ga0070675_100109516 Ga0070675_1001095163 118
62 3300005355 Ga0070671_100470864 Ga0070671_1004708642 118
63 3300005365 Ga0070688_100145148 Ga0070688_1001451482 118
64 3300005366 Ga0070659_100078321 Ga0070659_1000783214 118
65 3300005435 Ga0070714_100019766 Ga0070714_1000197662 118
66 3300005435 Ga0070714_100124993 Ga0070714_1001249934 118
67 3300005435 Ga0070714_102380497 Ga0070714_1023804971 118
68 3300005436 Ga0070713_100183295 Ga0070713_1001832953 118
69 3300005436 Ga0070713_100372180 Ga0070713_1003721802 118
70 3300005437 Ga0070710_10000013 Ga0070710_1000001327 118
71 3300005438 Ga0070701_10086318 Ga0070701_100863182 118
72 3300005439 Ga0070711_100149103 Ga0070711_1001491033 118
73 3300005440 Ga0070705_100127848 Ga0070705_1001278482 118
74 3300005441 Ga0070700_100000631 Ga0070700_10000063115 118
75 3300005444 Ga0070694_101918269 Ga0070694_1019182691 118
76 3300005455 Ga0070663_100025790 Ga0070663_1000257903 118
77 3300005455 Ga0070663_100943073 Ga0070663_1009430732 118
78 3300005456 Ga0070678_100342048 Ga0070678_1003420482 118
79 3300005456 Ga0070678_100565855 Ga0070678_1005658552 118
80 3300005456 Ga0070678_101021184 Ga0070678_1010211841 118
81 3300005457 Ga0070662_100133203 Ga0070662_1001332033 118
82 3300005458 Ga0070681_10317698 Ga0070681_103176982 118
83 3300005466 Ga0070685_10076530 Ga0070685_100765303 118
84 3300005530 Ga0070679_101140067 Ga0070679_1011400672 118
85 3300005535 Ga0070684_100001176 Ga0070684_10000117617 118
86 3300005539 Ga0068853_100929970 Ga0068853_1009299702 118
87 3300005543 Ga0070672_100383694 Ga0070672_1003836942 118
88 3300005545 Ga0070695_100057645 Ga0070695_1000576453 118
89 3300005549 Ga0070704_100049333 Ga0070704_1000493333 118
90 3300005549 Ga0070704_100743332 Ga0070704_1007433321 118
91 3300005564 Ga0070664_100019045 Ga0070664_1000190457 118
92 3300005577 Ga0068857_100069167 Ga0068857_1000691674 118
93 3300005578 Ga0068854_100038742 Ga0068854_1000387423 118
94 3300005578 Ga0068854_101374334 Ga0068854_1013743341 118
95 3300005614 Ga0068856_100020258 Ga0068856_1000202586 118
96 3300005615 Ga0070702_100009653 Ga0070702_1000096533 118
97 3300005615 Ga0070702_101469324 Ga0070702_1014693241 118
98 3300005616 Ga0068852_100150882 Ga0068852_1001508824 118
99 3300005618 Ga0068864_100075430 Ga0068864_1000754302 118
100 3300005718 Ga0068866_10079171 Ga0068866_100791713 118
101 3300005719 Ga0068861_100719146 Ga0068861_1007191462 118
102 3300005841 Ga0068863_100385919 Ga0068863_1003859192 118
103 3300005843 Ga0068860_100611594 Ga0068860_1006115942 118
104 3300005844 Ga0068862_100188693 Ga0068862_1001886932 118
105 3300005937 Ga0081455_10007545 Ga0081455_100075457 118
106 3300005983 Ga0081540_1000568 Ga0081540_100056815 118
107 3300005983 Ga0081540_1303124 Ga0081540_13031242 118
108 3300005985 Ga0081539_10005444 Ga0081539_1000544413 118
109 3300006028 Ga0070717_10012631 Ga0070717_100126314 118
110 3300006028 Ga0070717_10028271 Ga0070717_100282713 118
111 3300006028 Ga0070717_10169961 Ga0070717_101699613 118
112 3300006028 Ga0070717_10463887 Ga0070717_104638872 118
113 3300006058 Ga0075432_10157572 Ga0075432_101575722 118
114 3300006058 Ga0075432_10506356 Ga0075432_105063562 118
115 3300006163 Ga0070715_10952123 Ga0070715_109521231 118
116 3300006175 Ga0070712_100000013 Ga0070712_100000013110 118
117 3300006844 Ga0075428_100390072 Ga0075428_1003900722 118
118 3300006844 Ga0075428_100628582 Ga0075428_1006285822 118
119 3300006846 Ga0075430_100889289 Ga0075430_1008892892 118
120 3300006847 Ga0075431_100008379 Ga0075431_1000083797 118
121 3300006852 Ga0075433_10197050 Ga0075433_101970502 118
122 3300006852 Ga0075433_11347998 Ga0075433_113479982 118
123 3300006871 Ga0075434_100922977 Ga0075434_1009229772 118
124 3300006880 Ga0075429_100006922 Ga0075429_10000692212 118
125 3300006880 Ga0075429_100223155 Ga0075429_1002231553 118
126 3300006881 Ga0068865_100222057 Ga0068865_1002220572 118
127 3300006914 Ga0075436_100099373 Ga0075436_1000993732 118
128 3300007076 Ga0075435_100390750 Ga0075435_1003907502 118
129 3300009036 Ga0105244_10186649 Ga0105244_101866492 118
130 3300009093 Ga0105240_10018075 Ga0105240_1001807511 118
131 3300009094 Ga0111539_10282438 Ga0111539_102824384 118
132 3300009094 Ga0111539_10329278 Ga0111539_103292782 118
133 3300009098 Ga0105245_10031336 Ga0105245_100313363 118
134 3300009101 Ga0105247_10267477 Ga0105247_102674772 118
135 3300009147 Ga0114129_10636847 Ga0114129_106368472 118
136 3300009147 Ga0114129_10724696 Ga0114129_107246963 118
137 3300009148 Ga0105243_10395169 Ga0105243_103951692 118
138 3300009148 Ga0105243_10695849 Ga0105243_106958492 118
139 3300009148 Ga0105243_10933881 Ga0105243_109338812 118
140 3300009174 Ga0105241_10188855 Ga0105241_101888553 118
141 3300009176 Ga0105242_11683795 Ga0105242_116837951 118
142 3300009177 Ga0105248_10194596 Ga0105248_101945963 118
143 3300009545 Ga0105237_11048967 Ga0105237_110489672 118
144 3300009553 Ga0105249_10083347 Ga0105249_100833474 118
145 3300009553 Ga0105249_10149472 Ga0105249_101494724 118
146 3300010375 Ga0105239_10130872 Ga0105239_101308724 118
147 3300011119 Ga0105246_10148383 Ga0105246_101483832 118
148 3300011119 Ga0105246_10242685 Ga0105246_102426852 118
149 3300013105 Ga0157369_10357905 Ga0157369_103579052 118
150 3300013105 Ga0157369_11273423 Ga0157369_112734231 118
151 3300013296 Ga0157374_10015146 Ga0157374_100151467 118
152 3300013306 Ga0163162_10735314 Ga0163162_107353142 118
153 3300013307 Ga0157372_10018103 Ga0157372_100181037 118
154 3300013307 Ga0157372_11335011 Ga0157372_113350112 118
155 3300013308 Ga0157375_10615079 Ga0157375_106150792 118
156 3300014325 Ga0163163_10210292 Ga0163163_102102922 118
157 3300014326 Ga0157380_10301211 Ga0157380_103012113 118
158 3300014326 Ga0157380_12383700 Ga0157380_123837001 118
159 3300014745 Ga0157377_10017745 Ga0157377_100177454 118
160 3300014969 Ga0157376_10039932 Ga0157376_100399323 118
161 3300020069 Ga0197907_10675038 Ga0197907_106750382 118
162 3300021384 Ga0213876_10032070 Ga0213876_100320703 118
163 3300025898 Ga0207692_10000003 Ga0207692_10000003151 118
164 3300025899 Ga0207642_10106307 Ga0207642_101063073 118
165 3300025901 Ga0207688_10009130 Ga0207688_100091302 118
166 3300025904 Ga0207647_10059932 Ga0207647_100599322 118
167 3300025906 Ga0207699_10384306 Ga0207699_103843061 118
168 3300025907 Ga0207645_10079732 Ga0207645_100797323 118
169 3300025908 Ga0207643_10484893 Ga0207643_104848932 118
170 3300025912 Ga0207707_10220994 Ga0207707_102209943 118
171 3300025914 Ga0207671_10801051 Ga0207671_108010512 118
172 3300025915 Ga0207693_10007488 Ga0207693_100074886 118
173 3300025916 Ga0207663_10767500 Ga0207663_107675002 118
174 3300025917 Ga0207660_10595041 Ga0207660_105950412 118
175 3300025917 Ga0207660_11524890 Ga0207660_115248901 118
176 3300025919 Ga0207657_10301276 Ga0207657_103012762 118
177 3300025920 Ga0207649_10151458 Ga0207649_101514583 118
178 3300025921 Ga0207652_10437324 Ga0207652_104373242 118
179 3300025923 Ga0207681_10003442 Ga0207681_100034425 118
180 3300025925 Ga0207650_10655199 Ga0207650_106551992 118
181 3300025926 Ga0207659_10142742 Ga0207659_101427422 118
182 3300025927 Ga0207687_10018790 Ga0207687_100187902 118
183 3300025928 Ga0207700_10053590 Ga0207700_100535903 118
184 3300025929 Ga0207664_10002161 Ga0207664_1000216112 118
185 3300025929 Ga0207664_10032533 Ga0207664_100325331 118
186 3300025929 Ga0207664_10043822 Ga0207664_100438223 118
187 3300025929 Ga0207664_10484199 Ga0207664_104841992 118
188 3300025931 Ga0207644_10383621 Ga0207644_103836212 118
189 3300025932 Ga0207690_10364164 Ga0207690_103641642 118
190 3300025933 Ga0207706_10135359 Ga0207706_101353593 118
191 3300025935 Ga0207709_10267186 Ga0207709_102671863 118
192 3300025935 Ga0207709_10380603 Ga0207709_103806032 118
193 3300025936 Ga0207670_10058186 Ga0207670_100581864 118
194 3300025938 Ga0207704_10041636 Ga0207704_100416363 118
195 3300025939 Ga0207665_10358605 Ga0207665_103586052 118
196 3300025940 Ga0207691_10388488 Ga0207691_103884882 118
197 3300025941 Ga0207711_10423624 Ga0207711_104236242 118
198 3300025944 Ga0207661_10265775 Ga0207661_102657751 118
199 3300025945 Ga0207679_10014491 Ga0207679_100144916 118
200 3300025945 Ga0207679_11520992 Ga0207679_115209922 118
201 3300025961 Ga0207712_10103444 Ga0207712_101034444 118
202 3300025961 Ga0207712_11169000 Ga0207712_111690002 118
203 3300025961 Ga0207712_11294379 Ga0207712_112943792 118
204 3300025981 Ga0207640_10069291 Ga0207640_100692912 118
205 3300026023 Ga0207677_10039119 Ga0207677_100391194 118
206 3300026067 Ga0207678_10329205 Ga0207678_103292053 118
207 3300026075 Ga0207708_10033729 Ga0207708_100337294 118
208 3300026075 Ga0207708_10678872 Ga0207708_106788721 118
209 3300026078 Ga0207702_10234415 Ga0207702_102344153 118
210 3300026088 Ga0207641_10332476 Ga0207641_103324762 118
211 3300026095 Ga0207676_10032249 Ga0207676_100322496 118
212 3300026116 Ga0207674_10098701 Ga0207674_100987014 118
213 3300026118 Ga0207675_100347375 Ga0207675_1003473753 118
214 3300026118 Ga0207675_100753609 Ga0207675_1007536092 118
215 3300026121 Ga0207683_10318714 Ga0207683_103187142 118
216 3300026142 Ga0207698_10111521 Ga0207698_101115212 118
217 3300027907 Ga0207428_10224718 Ga0207428_102247183 118
218 3300027907 Ga0207428_10913767 Ga0207428_109137671 118
219 3300028379 Ga0268266_10533233 Ga0268266_105332332 118
220 3300028380 Ga0268265_10531763 Ga0268265_105317632 118
221 3300028381 Ga0268264_11780680 Ga0268264_117806801 118
222 3300028558 Ga0265326_10000005 Ga0265326_1000000570 118
223 3300028563 Ga0265319_1000756 Ga0265319_10007567 118
224 3300028573 Ga0265334_10000024 Ga0265334_1000002482 118
225 3300028666 Ga0265336_10006532 Ga0265336_100065321 118
226 3300028800 Ga0265338_10008060 Ga0265338_100080607 118
227 3300029957 Ga0265324_10001235 Ga0265324_100012359 118
228 3300031251 Ga0265327_10097556 Ga0265327_100975562 118
229 3300031731 Ga0307405_11561903 Ga0307405_115619032 118
230 3300031995 Ga0307409_101679151 Ga0307409_1016791512 118
231 3300032002 Ga0307416_100072698 Ga0307416_1000726982 118
232 3300032004 Ga0307414_10209494 Ga0307414_102094943 118
233 3300032005 Ga0307411_10453752 Ga0307411_104537522 118
234 3300032005 Ga0307411_11514487 Ga0307411_115144872 118
235 3300032126 Ga0307415_100331012 Ga0307415_1003310122 118
236 3300035725 Ga0373947_0210142 Ga0373947_0210142_597_953 118
237 3300037312 Ga0395899_0726287 Ga0395899_0726287_94_450 118
238 3300037418 Ga0395900_1343336 Ga0395900_1343336_246_608 118
239 3300037466 Ga0395898_0160077 Ga0395898_0160077_1521_1883 118
240 3300037466 Ga0395898_0350362 Ga0395898_0350362_844_1200 118
241 3300037466 Ga0395898_1182728 Ga0395898_1182728_277_633 118
242 3300037471 Ga0395905_1576583 Ga0395905_1576583_119_475 118
243 3300037853 Ga0436364_0614834 Ga0436364_0614834_1030_1386 118
244 3300037853 Ga0436364_0726202 Ga0436364_0726202_314_670 118
245 3300037853 Ga0436364_0895093 Ga0436364_0895093_102_458 118
246 3300037853 Ga0436364_1503518 Ga0436364_1503518_373_729 118
247 3300038443 Ga0395901_0394674 Ga0395901_0394674_1051_1407 118
248 3300038443 Ga0395901_0739062 Ga0395901_0739062_600_962 118
249 3300039437 Ga0436365_0257436 Ga0436365_0257436_46_402 118
250 3300039437 Ga0436365_0274890 Ga0436365_0274890_713_1069 118
251 3300039437 Ga0436365_0589336 Ga0436365_0589336_1918_2274 118
252 3300039437 Ga0436365_1054191 Ga0436365_1054191_1534_1896 118
253 3300039437 Ga0436365_1102108 Ga0436365_1102108_17123_17479 118
254 3300039437 Ga0436365_1610717 Ga0436365_1610717_1491_1847 118
255 3300039450 Ga0436363_0007777 Ga0436363_0007777_337_696 118
256 3300039450 Ga0436363_0393160 Ga0436363_0393160_427_783 118
257 3300039450 Ga0436363_0860590 Ga0436363_0860590_158_514 118
258 3300039450 Ga0436363_1252399 Ga0436363_1252399_358_714 118
259 3300039453 Ga0436362_0009240 Ga0436362_0009240_109_465 118
260 3300039453 Ga0436362_0239758 Ga0436362_0239758_1615_1971 118
261 3300039453 Ga0436362_0481547 Ga0436362_0481547_245_601 118
262 3300039453 Ga0436362_0643297 Ga0436362_0643297_160_516 118
263 3300041460 Ga0451802_2061761 Ga0451802_2061761_419_781 118
264 3300041492 Ga0451835_0562988 Ga0451835_0562988_267_629 118
265 3300041505 Ga0451849_0716068 Ga0451849_0716068_81_455 118
266 3300042438 Ga0439459_0036793 Ga0439459_0036793_178_537 118
267 3300044683 Ga0466965_0056854 Ga0466965_0056854_959_1321 118
268 3300044683 Ga0466965_0378468 Ga0466965_0378468_263_622 118
269 3300044684 Ga0466966_0071244 Ga0466966_0071244_1289_1648 118
270 3300044684 Ga0466966_0711112 Ga0466966_0711112_124_483 118
271 3300044693 Ga0466961_0007593 Ga0466961_0007593_1366_1728 118
272 3300044693 Ga0466961_0018168 Ga0466961_0018168_703_1062 118
273 3300044693 Ga0466961_0131965 Ga0466961_0131965_253_609 118
274 3300044693 Ga0466961_0141732 Ga0466961_0141732_670_1032 118
275 3300044693 Ga0466961_0703271 Ga0466961_0703271_16_372 118
276 3300044694 Ga0466963_0006643 Ga0466963_0006643_4209_4571 118
277 3300044694 Ga0466963_0010004 Ga0466963_0010004_1091_1453 118
278 3300044694 Ga0466963_0033878 Ga0466963_0033878_475_834 118
279 3300044694 Ga0466963_0040185 Ga0466963_0040185_2535_2891 118
280 3300044694 Ga0466963_0556709 Ga0466963_0556709_295_651 118
281 3300044706 Ga0466964_0295907 Ga0466964_0295907_250_612 118
282 3300044719 Ga0466971_0015389 Ga0466971_0015389_919_1275 118
283 3300044719 Ga0466971_0030125 Ga0466971_0030125_751_1113 118
284 3300044735 Ga0466968_0063199 Ga0466968_0063199_924_1286 118
285 3300044735 Ga0466968_0386106 Ga0466968_0386106_211_573 118
286 3300044735 Ga0466968_0460140 Ga0466968_0460140_205_564 118
287 3300044735 Ga0466968_0460712 Ga0466968_0460712_214_576 118
288 3300044765 Ga0466970_0189844 Ga0466970_0189844_171_527 118
289 3300044765 Ga0466970_0412817 Ga0466970_0412817_200_556 118
290 3300044765 Ga0466970_0795072 Ga0466970_0795072_19_381 118
291 3300044842 Ga0466957_0045760 Ga0466957_0045760_1821_2183 118
292 3300044842 Ga0466957_0094223 Ga0466957_0094223_549_905 118
293 3300044842 Ga0466957_0324798 Ga0466957_0324798_202_564 118
294 3300044842 Ga0466957_1023607 Ga0466957_1023607_60_416 118
295 3300044901 Ga0466960_0297859 Ga0466960_0297859_473_835 118
296 3300044901 Ga0466960_0467256 Ga0466960_0467256_58_420 118
297 3300044901 Ga0466960_0645907 Ga0466960_0645907_149_511 118
298 3300045049 Ga0466959_0000694 Ga0466959_0000694_17698_18060 118
299 3300045049 Ga0466959_0006901 Ga0466959_0006901_843_1199 118
300 3300045049 Ga0466959_0032890 Ga0466959_0032890_2183_2545 118
301 3300045049 Ga0466959_0046460 Ga0466959_0046460_1420_1779 118
302 3300045049 Ga0466959_0216798 Ga0466959_0216798_541_900 118
303 3300045049 Ga0466959_0254894 Ga0466959_0254894_351_716 118
304 3300045049 Ga0466959_0825359 Ga0466959_0825359_49_405 118
305 3300045836 Ga0466958_0008346 Ga0466958_0008346_264_626 118
306 3300045836 Ga0466958_0022019 Ga0466958_0022019_1144_1506 118
307 3300045836 Ga0466958_0031870 Ga0466958_0031870_1429_1785 118
308 3300045836 Ga0466958_0047986 Ga0466958_0047986_308_667 118
309 3300045836 Ga0466958_0076611 Ga0466958_0076611_629_985 118
310 3300045836 Ga0466958_0117468 Ga0466958_0117468_1184_1543 118
311 3300045976 Ga0466967_0006851 Ga0466967_0006851_5999_6361 118
312 3300045976 Ga0466967_0117594 Ga0466967_0117594_1591_1953 118
313 3300045976 Ga0466967_0203286 Ga0466967_0203286_589_948 118
314 3300045976 Ga0466967_0655828 Ga0466967_0655828_61_423 118
315 3300045976 Ga0466967_0829965 Ga0466967_0829965_155_517 118
316 3300046462 Ga0495651_0872048 Ga0495651_0872048_171_533 118
317 3300046477 Ga0495664_0374771 Ga0495664_0374771_450_812 118
318 3300046543 Ga0495645_0666950 Ga0495645_0666950_102_464 118
319 3300046683 Ga0495658_0396026 Ga0495658_0396026_384_743 118
320 3300047320 Ga0495672_0052078 Ga0495672_0052078_1633_1998 118
321 3300048088 Ga0495602_0244325 Ga0495602_0244325_612_974 118
322 3300048903 Ga0496100_0000450 Ga0496100_0000450_13739_14104 118
323 3300048903 Ga0496100_1432678 Ga0496100_1432678_153_509 118
324 3300048904 Ga0496101_0011341 Ga0496101_0011341_4658_5014 118
325 3300048905 Ga0496102_0008194 Ga0496102_0008194_8191_8547 118
326 3300048907 Ga0496104_0018185 Ga0496104_0018185_5369_5725 118
327 3300048908 Ga0496105_0014697 Ga0496105_0014697_763_1119 118
328 3300048909 Ga0496106_0042998 Ga0496106_0042998_1483_1839 118
329 3300048910 Ga0496107_0101434 Ga0496107_0101434_880_1236 118
330 3300048911 Ga0496108_0012091 Ga0496108_0012091_3618_3974 118
331 3300048912 Ga0496109_0002676 Ga0496109_0002676_2533_2889 118
332 3300048913 Ga0496110_0038804 Ga0496110_0038804_3130_3486 118
333 3300048914 Ga0496111_0012371 Ga0496111_0012371_3618_3974 118
334 3300048915 Ga0496112_0000095 Ga0496112_0000095_16811_17176 118
335 3300048915 Ga0496112_0066430 Ga0496112_0066430_1969_2325 118
336 3300048915 Ga0496112_0097313 Ga0496112_0097313_649_1011 118
337 3300048915 Ga0496112_0923676 Ga0496112_0923676_269_634 118
338 3300048916 Ga0496113_0050824 Ga0496113_0050824_563_928 118
339 3300048916 Ga0496113_0781296 Ga0496113_0781296_289_645 118
340 3300048917 Ga0496114_0175803 Ga0496114_0175803_1151_1507 118
341 3300048918 Ga0496115_0229016 Ga0496115_0229016_583_939 118
342 3300049582 Ga0501048_0588048 Ga0501048_0588048_185_547 118
343 3300050507 nmdc:mga05p37_1055197_c1 nmdc:mga05p37_1055197_c1_390_746 118
344 3300050508 nmdc:mga09592_304326_c1 nmdc:mga09592_304326_c1_856_1221 118
345 3300050509 nmdc:mga0qj67_823275_c1 nmdc:mga0qj67_823275_c1_102_458 118
346 3300050510 nmdc:mga06r32_7689_c1 nmdc:mga06r32_7689_c1_2509_2865 118
347 3300050511 nmdc:mga08y16_167466_c1 nmdc:mga08y16_167466_c1_1539_1895 118
348 3300050511 nmdc:mga08y16_357143_c1 nmdc:mga08y16_357143_c1_1067_1429 118
349 3300050511 nmdc:mga08y16_866498_c1 nmdc:mga08y16_866498_c1_193_549 118
350 3300050512 nmdc:mga0n895_137233_c1 nmdc:mga0n895_137233_c1_1575_1931 118
351 3300050512 nmdc:mga0n895_271514_c1 nmdc:mga0n895_271514_c1_96_452 118
352 3300050513 nmdc:mga0rr50_1126788_c1 nmdc:mga0rr50_1126788_c1_46_402 118
353 3300050514 nmdc:mga08x19_70212_c1 nmdc:mga08x19_70212_c1_1462_1818 118
354 3300050515 nmdc:mga0a205_164574_c1 nmdc:mga0a205_164574_c1_56_412 118
355 3300053077 Ga0495601_0486909 Ga0495601_0486909_336_698 118
356 3300053078 Ga0495612_0420569 Ga0495612_0420569_150_512 118
357 3300053153 Ga0500616_0004560 Ga0500616_0004560_5015_5377 118
358 3300060346 Ga0587111_0240683 Ga0587111_0240683_157_519 118
359 3300061719 Ga0466962_0016871 Ga0466962_0016871_882_1244 118
360 3300061719 Ga0466962_0038772 Ga0466962_0038772_1703_2065 118
361 3300061719 Ga0466962_0054680 Ga0466962_0054680_1083_1439 118
362 3300061719 Ga0466962_0415930 Ga0466962_0415930_283_642 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

35

137

0.92

Feature Viewer

pLDDT pTM Quality
76.18 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map