F422546

General Info

Members Datasets Scaffolds Average Seq Length
362 229 339 376

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10032738|Ga0081455_100327384
Length 394
Sequence MKRYIQFPKVEGDASRQAHADLPAGTYEREISKEGFFGPAAHLYHRHPPTGWVDFQGPLRPHAFDCTKLPATAYGPWSAVELLNNASVRVSFWRCDAYDPKLARAPEMRALARNADGDELLFVHAGAGHLFCDFGHLEFETGDYILIPRGTMWRVECTQPLAALLIEATNNSYRLPDKGLVGPHAIFDPAMLDTPRIDDAFKAQQGETEWSVAVKRRNAVSTVTYPFNPLDAVGWHGDLSVVRINVRHLRPLMSHRYHLPPSAHTTFLSERFVVCTFVPRPFESDPGAMKVPFFHNNDDYDEVLFYHAGDFFSRDNIKPGVITWHPCGFTHGPHPKALQRMYEAAKPATDEYAVMLDTRDALDAGPEMDGVEMRSYAESWMTPEPVLAPKPRRP

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
3 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
4 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
5 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
6 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
7 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
8 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
9 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
10 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
11 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
12 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
13 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
14 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
15 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
16 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
17 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
18 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
19 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
20 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
142 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
151 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
152 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
228 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
229 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0.28
Rhizoplane 3.04
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000048 3300003215 Bacteria 141500
2 Ga0055530_10002552 3300003791 Bacteria 11586
3 Ga0065707_10081837 3300005295 Bacteria 34625
4 Ga0070690_100016923 3300005330 Bacteria 4376
5 Ga0070677_10016326 3300005333 Bacteria 2642
6 Ga0068869_100052682 3300005334 Bacteria 2955
7 Ga0070682_100013198 3300005337 Bacteria 4748
8 Ga0070682_100139812 3300005337 Bacteria 1649
9 Ga0070689_100002072 3300005340 Bacteria 13018
10 Ga0070668_100003642 3300005347 Bacteria 11366
11 Ga0070669_100060110 3300005353 Bacteria 2791
12 Ga0070669_100065886 3300005353 Bacteria 2669
13 Ga0070675_100057477 3300005354 Bacteria 3207
14 Ga0070674_100003347 3300005356 Bacteria 8977
15 Ga0070674_100003383 3300005356 Bacteria 8941
16 Ga0070674_100127082 3300005356 Bacteria 1895
17 Ga0070674_100155551 3300005356 Bacteria 1730
18 Ga0070673_100020733 3300005364 Bacteria 4745
19 Ga0070688_100099355 3300005365 Bacteria 1916
20 Ga0070667_100000165 3300005367 Bacteria 82440
21 Ga0070667_100021673 3300005367 Bacteria 5332
22 Ga0070714_100098309 3300005435 Bacteria 2575
23 Ga0070701_10009523 3300005438 Bacteria 4258
24 Ga0070705_100195974 3300005440 Bacteria 1381
25 Ga0070700_100015938 3300005441 Bacteria 4272
26 Ga0070678_100028317 3300005456 Bacteria 3819
27 Ga0070678_100082458 3300005456 Bacteria 2441
28 Ga0070681_10248117 3300005458 Bacteria 1693
29 Ga0068867_100037012 3300005459 Bacteria 3546
30 Ga0070685_10051851 3300005466 Bacteria 2372
31 Ga0070685_10077643 3300005466 Bacteria 1983
32 Ga0070706_100048464 3300005467 Bacteria 3921
33 Ga0070707_100310722 3300005468 Bacteria 1532
34 Ga0068853_100154201 3300005539 Bacteria 2069
35 Ga0070686_100022286 3300005544 Bacteria 3771
36 Ga0070696_100078051 3300005546 Bacteria 2341
37 Ga0070665_100000849 3300005548 Bacteria 39827
38 Ga0070665_100013714 3300005548 Bacteria 8155
39 Ga0068855_100003338 3300005563 Bacteria 19637
40 Ga0068855_100110433 3300005563 Unclassified 3157
41 Ga0068856_100025549 3300005614 Bacteria 5759
42 Ga0068856_100403314 3300005614 Bacteria 1387
43 Ga0068859_100008769 3300005617 Bacteria 10212
44 Ga0068864_100023673 3300005618 Bacteria 5159
45 Ga0068861_100002431 3300005719 Bacteria 12144
46 Ga0068861_100032438 3300005719 Bacteria 3845
47 Ga0068861_100032993 3300005719 Bacteria 3817
48 Ga0068870_10001410 3300005840 Bacteria 9699
49 Ga0068863_100226979 3300005841 Bacteria 1800
50 Ga0068863_100513397 3300005841 Bacteria 1181
51 Ga0068858_100220305 3300005842 Bacteria 1797
52 Ga0068860_100108019 3300005843 Bacteria 2659
53 Ga0068862_100006208 3300005844 Bacteria 9953
54 Ga0068862_100068255 3300005844 Bacteria 3067
55 Ga0081455_10032738 3300005937 Bacteria 4681
56 Ga0081538_10020258 3300005981 Bacteria 4906
57 Ga0081539_10000007 3300005985 Bacteria 532790
58 Ga0075366_10043880 3300006195 Bacteria 2649
59 Ga0097621_100025731 3300006237 Bacteria 4607
60 Ga0075370_10057490 3300006353 Bacteria 2211
61 Ga0068871_100016202 3300006358 Bacteria 5604
62 Ga0075433_10143970 3300006852 Bacteria 2119
63 Ga0097620_100008769 3300006931 Bacteria 10212
64 Ga0099826_10112817 3300006948 Bacteria 1616
65 Ga0105250_10026738 3300009092 Bacteria 2325
66 Ga0105240_10125362 3300009093 Bacteria 3087
67 Ga0105240_10298378 3300009093 Bacteria 1844
68 Ga0111539_10001056 3300009094 Bacteria 36242
69 Ga0105242_10159188 3300009176 Bacteria 1975
70 Ga0105248_10147520 3300009177 Bacteria 2654
71 Ga0105238_10002527 3300009551 Bacteria 18281
72 Ga0105238_10014921 3300009551 Bacteria 7864
73 Ga0105238_10073965 3300009551 Bacteria 3401
74 Ga0105239_10138045 3300010375 Bacteria 2715
75 Ga0157371_10078769 3300013102 Bacteria 2334
76 Ga0163162_10149541 3300013306 Bacteria 2452
77 Ga0157375_10032034 3300013308 Bacteria 4981
78 Ga0157375_10195709 3300013308 Bacteria 2177
79 Ga0157375_10463127 3300013308 Bacteria 1433
80 Ga0157380_10009401 3300014326 Bacteria 7002
81 Ga0157380_10024714 3300014326 Bacteria 4550
82 Ga0157380_10148126 3300014326 Bacteria 2025
83 Ga0157376_10194810 3300014969 Bacteria 1861
84 Ga0182006_1031713 3300015261 Bacteria 2128
85 Ga0163161_10121228 3300017792 Bacteria 1965
86 Ga0213872_10000095 3300021361 Bacteria 81971
87 Ga0213872_10001801 3300021361 Bacteria 13324
88 Ga0213872_10003801 3300021361 Bacteria 8229
89 Ga0213872_10053226 3300021361 Bacteria 1836
90 Ga0209026_1001591 3300025250 Bacteria 9751
91 Ga0209758_1000048 3300025297 Bacteria 358400
92 Ga0207426_1044971 3300025302 Bacteria 1346
93 Ga0209257_1000237 3300025304 Bacteria 128812
94 Ga0207643_10001457 3300025908 Bacteria 13565
95 Ga0207707_10254649 3300025912 Bacteria 1524
96 Ga0207695_10089240 3300025913 Bacteria 3100
97 Ga0207695_10141474 3300025913 Bacteria 2354
98 Ga0207694_10001241 3300025924 Bacteria 22055
99 Ga0207694_10016498 3300025924 Bacteria 5577
100 Ga0207659_10109234 3300025926 Bacteria 2099
101 Ga0207670_10057046 3300025936 Bacteria 2647
102 Ga0207669_10005071 3300025937 Bacteria 5865
103 Ga0207669_10011560 3300025937 Bacteria 4301
104 Ga0207704_10062160 3300025938 Bacteria 2320
105 Ga0207691_10000807 3300025940 Bacteria 31168
106 Ga0207689_10009198 3300025942 Bacteria 8546
107 Ga0207667_10014559 3300025949 Bacteria 8959
108 Ga0207667_10199474 3300025949 Unclassified 2053
109 Ga0207668_10171351 3300025972 Bacteria 1703
110 Ga0207658_10000035 3300025986 Bacteria 154818
111 Ga0207703_10140424 3300026035 Bacteria 2096
112 Ga0207708_10069075 3300026075 Bacteria 2704
113 Ga0207708_10136155 3300026075 Bacteria 1924
114 Ga0207641_10071428 3300026088 Bacteria 2986
115 Ga0207648_10006521 3300026089 Bacteria 11584
116 Ga0207648_10112424 3300026089 Bacteria 2391
117 Ga0207676_10010260 3300026095 Bacteria 6667
118 Ga0207675_100025867 3300026118 Bacteria 5460
119 Ga0207675_100033699 3300026118 Bacteria 4772
120 Ga0207675_100040145 3300026118 Bacteria 4368
121 Ga0207675_100060574 3300026118 Bacteria 3534
122 Ga0207675_100137666 3300026118 Bacteria 2318
123 Ga0207683_10007605 3300026121 Bacteria 9281
124 Ga0207683_10046868 3300026121 Bacteria 3784
125 Ga0209371_1001305 3300027312 Bacteria 17451
126 Ga0207428_10000564 3300027907 Bacteria 43815
127 Ga0268266_10001644 3300028379 Bacteria 25899
128 Ga0268266_10064349 3300028379 Bacteria 3168
129 Ga0268265_10015383 3300028380 Bacteria 5236
130 Ga0268265_10033537 3300028380 Bacteria 3734
131 Ga0268265_10034744 3300028380 Bacteria 3677
132 Ga0265338_10000043 3300028800 Bacteria 226293
133 Ga0265338_10008908 3300028800 Bacteria 12085
134 Ga0268256_1008861 3300030500 Bacteria 3403
135 Ga0265330_10062755 3300031235 Bacteria 1615
136 Ga0265330_10067591 3300031235 Bacteria 1548
137 Ga0265325_10000002 3300031241 Bacteria 396758
138 Ga0265325_10089201 3300031241 Bacteria 1523
139 Ga0265329_10024524 3300031242 Bacteria 2002
140 Ga0265340_10000057 3300031247 Bacteria 51264
141 Ga0265340_10000681 3300031247 Bacteria 19051
142 Ga0265340_10102778 3300031247 Bacteria 1327
143 Ga0265339_10001460 3300031249 Bacteria 17503
144 Ga0265316_10001355 3300031344 Bacteria 26360
145 Ga0265316_10089788 3300031344 Bacteria 2344
146 Ga0307513_10000053 3300031456 Bacteria 149356
147 Ga0307513_10004863 3300031456 Bacteria 17834
148 Ga0307513_10124132 3300031456 Bacteria 2542
149 Ga0307513_10126034 3300031456 Bacteria 2516
150 Ga0307509_10214947 3300031507 Bacteria 1743
151 Ga0307408_100000027 3300031548 Bacteria 261506
152 Ga0265313_10000565 3300031595 Bacteria 38478
153 Ga0265313_10008061 3300031595 Bacteria 7056
154 Ga0265314_10035494 3300031711 Bacteria 3633
155 Ga0265314_10038129 3300031711 Bacteria 3475
156 Ga0265314_10052672 3300031711 Bacteria 2827
157 Ga0265342_10003874 3300031712 Bacteria 12037
158 Ga0307409_100017174 3300031995 Bacteria 4814
159 Ga0307411_10001689 3300032005 Bacteria 9254
160 Ga0307415_100191510 3300032126 Bacteria 1614
161 Ga0373956_0049817 3300035119 Bacteria 1879
162 Ga0373937_0064479 3300036401 Bacteria 3370
163 Ga0373937_0240569 3300036401 Bacteria 1705
164 Ga0373937_0428614 3300036401 Bacteria 1255
165 Ga0395899_0091906 3300037312 Bacteria 2198
166 Ga0395901_0114324 3300038443 Bacteria 2835
167 Ga0436361_0065571 3300039447 Bacteria 16897
168 Ga0436361_0677619 3300039447 Bacteria 2507
169 Ga0436361_0866516 3300039447 Bacteria 9211
170 Ga0436362_0737366 3300039453 Bacteria 1347
171 Ga0451787_251173 3300041441 Bacteria 1547
172 Ga0451793_0630050 3300041452 Bacteria 1524
173 Ga0451807_1051597 3300041486 Bacteria 1952
174 Ga0439437_001944 3300042000 Bacteria 2196
175 Ga0439445_0060826 3300042004 Bacteria 1033
176 Ga0450911_000007 3300042115 Bacteria 212322
177 Ga0450920_000377 3300042122 Bacteria 6902
178 Ga0450896_000920 3300042133 Bacteria 3397
179 Ga0450904_000067 3300042139 Bacteria 23305
180 Ga0450905_009533 3300042142 Bacteria 1337
181 Ga0450907_008156 3300042146 Bacteria 1743
182 Ga0439446_0001120 3300042156 Bacteria 5934
183 Ga0439446_0002566 3300042156 Bacteria 4375
184 Ga0450908_000456 3300042184 Bacteria 7919
185 Ga0439464_0002038 3300042439 Bacteria 4909
186 Ga0439464_0004293 3300042439 Bacteria 3641
187 Ga0450916_001138 3300042530 Bacteria 2606
188 Ga0450918_001521 3300042531 Bacteria 4579
189 Ga0450893_0004545 3300042532 Bacteria 2209
190 Ga0451577_0067545 3300042876 Bacteria 3188
191 Ga0451576_0013009 3300045051 Bacteria 9321
192 Ga0451576_0014659 3300045051 Bacteria 8713
193 Ga0495638_0051027 3300046460 Bacteria 2582
194 Ga0495606_0002415 3300046507 Bacteria 21778
195 Ga0495616_0004057 3300046513 Bacteria 9302
196 Ga0495643_0002441 3300046522 Bacteria 14750
197 Ga0495586_0099681 3300046535 Bacteria 1611
198 Ga0495645_0112418 3300046543 Bacteria 1926
199 Ga0495656_0000012 3300046615 Bacteria 137678
200 Ga0495659_0001311 3300046664 Bacteria 8538
201 Ga0495659_0005540 3300046664 Bacteria 3973
202 Ga0495671_0009918 3300046692 Bacteria 5299
203 Ga0495649_0001380 3300046694 Bacteria 18369
204 Ga0495649_0009555 3300046694 Bacteria 5751
205 Ga0495672_0058884 3300047320 Bacteria 2225
206 Ga0495672_0145473 3300047320 Bacteria 1234
207 Ga0495675_0014597 3300047444 Bacteria 4966
208 Ga0495686_0000007 3300047472 Bacteria 732622
209 Ga0495686_0001560 3300047472 Bacteria 24428
210 Ga0495686_0026523 3300047472 Bacteria 3790
211 Ga0495686_0035529 3300047472 Bacteria 3203
212 Ga0496101_0061326 3300048904 Unclassified 2731
213 Ga0496105_0130826 3300048908 Bacteria 2069
214 Ga0496112_0059204 3300048915 Bacteria 3774
215 Ga0496113_0048962 3300048916 Bacteria 3146
216 Ga0496114_0329622 3300048917 Bacteria 1349
217 Ga0501031_0037233 3300049568 Bacteria 3174
218 Ga0501032_0005037 3300049569 Bacteria 9877
219 Ga0501032_0059956 3300049569 Bacteria 2553
220 Ga0501033_0221692 3300049570 Bacteria 1346
221 Ga0501034_0003592 3300049571 Bacteria 17610
222 Ga0501034_0025136 3300049571 Bacteria 6062
223 Ga0501036_0000844 3300049572 Bacteria 22816
224 Ga0501036_0005198 3300049572 Bacteria 10526
225 Ga0501036_0087940 3300049572 Bacteria 2626
226 Ga0501037_0029640 3300049573 Bacteria 4043
227 Ga0501037_0050166 3300049573 Bacteria 3055
228 Ga0501037_0126926 3300049573 Bacteria 1831
229 Ga0501038_0014118 3300049574 Bacteria 7277
230 Ga0501038_0049218 3300049574 Bacteria 3645
231 Ga0501038_0065536 3300049574 Bacteria 3094
232 Ga0501039_0026230 3300049575 Bacteria 4479
233 Ga0501040_0006324 3300049576 Bacteria 7688
234 Ga0501040_0011837 3300049576 Bacteria 5707
235 Ga0501040_0077640 3300049576 Bacteria 2297
236 Ga0501041_0001179 3300049577 Bacteria 14230
237 Ga0501041_0007871 3300049577 Bacteria 6261
238 Ga0501041_0018518 3300049577 Bacteria 4148
239 Ga0501041_0083891 3300049577 Bacteria 1964
240 Ga0501042_0012142 3300049578 Bacteria 5828
241 Ga0501042_0018623 3300049578 Bacteria 4810
242 Ga0501042_0137528 3300049578 Bacteria 1761
243 Ga0501042_0211110 3300049578 Bacteria 1400
244 Ga0501043_0031551 3300049579 Bacteria 4165
245 Ga0501043_0073579 3300049579 Bacteria 2684
246 Ga0501043_0079484 3300049579 Bacteria 2577
247 Ga0501043_0151298 3300049579 Bacteria 1816
248 Ga0501046_0014997 3300049580 Bacteria 6518
249 Ga0501046_0174432 3300049580 Bacteria 1611
250 Ga0501047_0007768 3300049581 Bacteria 10099
251 Ga0501047_0009612 3300049581 Bacteria 9143
252 Ga0501067_0000259 3300049583 Bacteria 28905
253 Ga0501067_0067307 3300049583 Bacteria 1983
254 Ga0501068_0002489 3300049584 Bacteria 9784
255 Ga0501068_0005953 3300049584 Bacteria 6692
256 Ga0501068_0103100 3300049584 Bacteria 1769
257 Ga0501070_0199462 3300049586 Bacteria 1644
258 Ga0501070_0298777 3300049586 Bacteria 1312
259 Ga0501071_0061081 3300049587 Bacteria 2729
260 Ga0501071_0075137 3300049587 Bacteria 2467
261 Ga0501071_0209993 3300049587 Bacteria 1464
262 Ga0501072_0027287 3300049588 Bacteria 4455
263 Ga0501072_0059751 3300049588 Bacteria 3006
264 Ga0501072_0087226 3300049588 Bacteria 2476
265 Ga0501073_0000031 3300049589 Bacteria 114348
266 Ga0501073_0000124 3300049589 Bacteria 50139
267 Ga0501073_0027249 3300049589 Bacteria 4089
268 Ga0501073_0069699 3300049589 Bacteria 2450
269 Ga0501074_0014041 3300049590 Bacteria 5823
270 Ga0501074_0108096 3300049590 Bacteria 1991
271 Ga0501074_0133176 3300049590 Bacteria 1778
272 Ga0501075_0001292 3300049591 Bacteria 16229
273 Ga0501075_0005658 3300049591 Bacteria 8553
274 Ga0501075_0021026 3300049591 Bacteria 4754
275 Ga0501076_0004658 3300049592 Bacteria 9779
276 Ga0501076_0005405 3300049592 Bacteria 9183
277 Ga0501076_0038591 3300049592 Bacteria 3749
278 Ga0501076_0060555 3300049592 Bacteria 3012
279 Ga0501077_0001769 3300049593 Bacteria 13042
280 Ga0501077_0005211 3300049593 Bacteria 7898
281 Ga0501077_0007800 3300049593 Bacteria 6608
282 Ga0501077_0036147 3300049593 Bacteria 3146
283 Ga0501079_0001461 3300049741 Bacteria 16718
284 Ga0501079_0058761 3300049741 Bacteria 2967
285 Ga0501080_0000797 3300049742 Bacteria 25770
286 Ga0501080_0006326 3300049742 Bacteria 10627
287 Ga0501080_0007274 3300049742 Bacteria 9989
288 Ga0501080_0014368 3300049742 Bacteria 7291
289 Ga0501080_0024223 3300049742 Bacteria 5627
290 Ga0501080_0089379 3300049742 Bacteria 2861
291 Ga0501080_0271198 3300049742 Bacteria 1544
292 Ga0501081_0000501 3300049743 Bacteria 21960
293 Ga0501081_0008000 3300049743 Bacteria 6861
294 Ga0501083_0018038 3300049744 Bacteria 4920
295 Ga0501035_0043666 3300049822 Bacteria 4039
296 Ga0501035_0234326 3300049822 Bacteria 1564
297 Ga0501035_0288875 3300049822 Bacteria 1384
298 Ga0501044_0001042 3300049823 Bacteria 33324
299 Ga0501044_0001081 3300049823 Bacteria 32566
300 Ga0501044_0002801 3300049823 Bacteria 19865
301 Ga0501045_0015531 3300049824 Bacteria 5401
302 Ga0501045_0027222 3300049824 Bacteria 4117
303 Ga0501045_0039639 3300049824 Bacteria 3427
304 Ga0501226_000006 3300049853 Bacteria 259153
305 nmdc:mga0k408_158081_c1 3300050493 Bacteria 1350
306 nmdc:mga0qj67_228407_c1 3300050509 Bacteria 1510
307 nmdc:mga08y16_2495_c1 3300050511 Bacteria 18917
308 nmdc:mga0a205_80135_c1 3300050515 Bacteria 3155
309 Ga0500644_0024879 3300053088 Bacteria 1835
310 Ga0500646_0009443 3300053090 Bacteria 2497
311 Ga0500583_0035036 3300053092 Bacteria 2237
312 Ga0500651_0003441 3300053093 Bacteria 8653
313 Ga0500641_0003594 3300053096 Bacteria 5474
314 Ga0500555_003771 3300053103 Bacteria 4313
315 Ga0500556_0000347 3300053104 Bacteria 34592
316 Ga0500556_0024149 3300053104 Bacteria 1994
317 Ga0500595_000648 3300053119 Bacteria 20943
318 Ga0500595_005175 3300053119 Bacteria 5720
319 Ga0500642_0026595 3300053130 Bacteria 2364
320 Ga0500652_053940 3300053131 Bacteria 1646
321 Ga0500588_0016781 3300053146 Bacteria 1900
322 Ga0500604_0004970 3300053151 Bacteria 3520
323 Ga0500616_0000062 3300053153 Bacteria 245744
324 Ga0500616_0006999 3300053153 Bacteria 7254
325 Ga0500645_004405 3300053730 Bacteria 5411
326 Ga0500609_001176 3300053731 Bacteria 3887
327 Ga0501084_0006074 3300054114 Bacteria 9933
328 Ga0501084_0010508 3300054114 Bacteria 7653
329 Ga0501084_0054859 3300054114 Bacteria 3333
330 Ga0501084_0334701 3300054114 Bacteria 1279
331 Ga0501082_0003445 3300060353 Bacteria 13809
332 Ga0501082_0004011 3300060353 Bacteria 12849
333 Ga0501082_0010476 3300060353 Bacteria 7977
334 Ga0501082_0024795 3300060353 Bacteria 5169
335 Ga0501082_0066844 3300060353 Bacteria 3095
336 Ga0501082_0164620 3300060353 Bacteria 1927
337 Ga0530510_0006862 3300061734 Bacteria 7936
338 Ga0530510_0011905 3300061734 Bacteria 6104
339 Ga0530510_0020567 3300061734 Bacteria 4693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_158081_c1 nmdc:mga0k408_158081_c1_14_973 302
2 3300042004 Ga0439445_0060826 Ga0439445_0060826_22_1020 331
3 3300042142 Ga0450905_009533 Ga0450905_009533_272_1315 347
4 3300046615 Ga0495656_0000012 Ga0495656_0000012_98265_99353 351
5 3300046664 Ga0495659_0001311 Ga0495659_0001311_5221_6309 351
6 3300046664 Ga0495659_0005540 Ga0495659_0005540_834_1922 351
7 3300049573 Ga0501037_0126926 Ga0501037_0126926_68_1141 352
8 3300048904 Ga0496101_0061326 Ga0496101_0061326_1424_2521 353
9 3300048915 Ga0496112_0059204 Ga0496112_0059204_1255_2352 353
10 3300048916 Ga0496113_0048962 Ga0496113_0048962_97_1194 353
11 3300050509 nmdc:mga0qj67_228407_c1 nmdc:mga0qj67_228407_c1_114_1244 358
12 3300005563 Ga0068855_100110433 Ga0068855_1001104333 359
13 3300006195 Ga0075366_10043880 Ga0075366_100438802 359
14 3300025949 Ga0207667_10199474 Ga0207667_101994742 359
15 3300006852 Ga0075433_10143970 Ga0075433_101439702 361
16 3300009094 Ga0111539_10001056 Ga0111539_100010562 361
17 3300027907 Ga0207428_10000564 Ga0207428_1000056431 361
18 3300050511 nmdc:mga08y16_2495_c1 nmdc:mga08y16_2495_c1_1835_2965 361
19 3300050515 nmdc:mga0a205_80135_c1 nmdc:mga0a205_80135_c1_756_1886 361
20 3300005467 Ga0070706_100048464 Ga0070706_1000484643 363
21 3300047320 Ga0495672_0145473 Ga0495672_0145473_76_1173 363
22 3300005563 Ga0068855_100003338 Ga0068855_10000333820 366
23 3300005614 Ga0068856_100025549 Ga0068856_1000255494 366
24 3300009551 Ga0105238_10014921 Ga0105238_100149215 366
25 3300010375 Ga0105239_10138045 Ga0105239_101380452 366
26 3300025924 Ga0207694_10016498 Ga0207694_100164984 366
27 3300025949 Ga0207667_10014559 Ga0207667_100145595 366
28 3300032126 Ga0307415_100191510 Ga0307415_1001915102 368
29 3300005468 Ga0070707_100310722 Ga0070707_1003107222 370
30 3300046535 Ga0495586_0099681 Ga0495586_0099681_64_1191 371
31 3300053096 Ga0500641_0003594 Ga0500641_0003594_28_1149 371
32 3300005466 Ga0070685_10077643 Ga0070685_100776432 373
33 3300013308 Ga0157375_10032034 Ga0157375_100320342 373
34 3300035119 Ga0373956_0049817 Ga0373956_0049817_237_1364 373
35 3300036401 Ga0373937_0240569 Ga0373937_0240569_441_1568 373
36 3300036401 Ga0373937_0428614 Ga0373937_0428614_95_1225 373
37 3300041452 Ga0451793_0630050 Ga0451793_0630050_295_1419 373
38 3300045051 Ga0451576_0013009 Ga0451576_0013009_4883_6010 373
39 3300046543 Ga0495645_0112418 Ga0495645_0112418_158_1288 373
40 3300047444 Ga0495675_0014597 Ga0495675_0014597_1814_2944 373
41 iso_pu_bacteria 2600254954 2600445434 373
42 iso_pu_bacteria 2600255389 2602009833 373
43 iso_pu_bacteria 2823421272 2823424315 373
44 iso_pu_bacteria 8034962539 8034965658 373
45 3300005330 Ga0070690_100016923 Ga0070690_1000169233 374
46 3300005333 Ga0070677_10016326 Ga0070677_100163262 374
47 3300005334 Ga0068869_100052682 Ga0068869_1000526822 374
48 3300005337 Ga0070682_100013198 Ga0070682_1000131982 374
49 3300005337 Ga0070682_100139812 Ga0070682_1001398122 374
50 3300005340 Ga0070689_100002072 Ga0070689_10000207211 374
51 3300005353 Ga0070669_100060110 Ga0070669_1000601102 374
52 3300005354 Ga0070675_100057477 Ga0070675_1000574772 374
53 3300005356 Ga0070674_100003383 Ga0070674_1000033831 374
54 3300005356 Ga0070674_100127082 Ga0070674_1001270821 374
55 3300005356 Ga0070674_100155551 Ga0070674_1001555512 374
56 3300005364 Ga0070673_100020733 Ga0070673_1000207334 374
57 3300005365 Ga0070688_100099355 Ga0070688_1000993551 374
58 3300005438 Ga0070701_10009523 Ga0070701_100095233 374
59 3300005440 Ga0070705_100195974 Ga0070705_1001959741 374
60 3300005441 Ga0070700_100015938 Ga0070700_1000159382 374
61 3300005456 Ga0070678_100028317 Ga0070678_1000283171 374
62 3300005456 Ga0070678_100082458 Ga0070678_1000824582 374
63 3300005459 Ga0068867_100037012 Ga0068867_1000370121 374
64 3300005544 Ga0070686_100022286 Ga0070686_1000222862 374
65 3300005546 Ga0070696_100078051 Ga0070696_1000780512 374
66 3300005548 Ga0070665_100000849 Ga0070665_10000084912 374
67 3300005617 Ga0068859_100008769 Ga0068859_1000087697 374
68 3300005618 Ga0068864_100023673 Ga0068864_1000236732 374
69 3300005719 Ga0068861_100002431 Ga0068861_1000024312 374
70 3300005719 Ga0068861_100032993 Ga0068861_1000329932 374
71 3300005840 Ga0068870_10001410 Ga0068870_100014102 374
72 3300005841 Ga0068863_100226979 Ga0068863_1002269792 374
73 3300005841 Ga0068863_100513397 Ga0068863_1005133971 374
74 3300005842 Ga0068858_100220305 Ga0068858_1002203052 374
75 3300005843 Ga0068860_100108019 Ga0068860_1001080192 374
76 3300006237 Ga0097621_100025731 Ga0097621_1000257314 374
77 3300006358 Ga0068871_100016202 Ga0068871_1000162024 374
78 3300006931 Ga0097620_100008769 Ga0097620_1000087697 374
79 3300006948 Ga0099826_10112817 Ga0099826_101128172 374
80 3300009093 Ga0105240_10125362 Ga0105240_101253623 374
81 3300009176 Ga0105242_10159188 Ga0105242_101591882 374
82 3300009551 Ga0105238_10002527 Ga0105238_100025277 374
83 3300013306 Ga0163162_10149541 Ga0163162_101495412 374
84 3300013308 Ga0157375_10195709 Ga0157375_101957092 374
85 3300013308 Ga0157375_10463127 Ga0157375_104631272 374
86 3300014326 Ga0157380_10009401 Ga0157380_100094011 374
87 3300014326 Ga0157380_10148126 Ga0157380_101481262 374
88 3300014969 Ga0157376_10194810 Ga0157376_101948102 374
89 3300017792 Ga0163161_10121228 Ga0163161_101212282 374
90 3300025908 Ga0207643_10001457 Ga0207643_100014576 374
91 3300025913 Ga0207695_10089240 Ga0207695_100892404 374
92 3300025913 Ga0207695_10141474 Ga0207695_101414742 374
93 3300025924 Ga0207694_10001241 Ga0207694_1000124120 374
94 3300025926 Ga0207659_10109234 Ga0207659_101092342 374
95 3300025936 Ga0207670_10057046 Ga0207670_100570462 374
96 3300025937 Ga0207669_10011560 Ga0207669_100115602 374
97 3300025938 Ga0207704_10062160 Ga0207704_100621602 374
98 3300025940 Ga0207691_10000807 Ga0207691_1000080718 374
99 3300025942 Ga0207689_10009198 Ga0207689_100091982 374
100 3300025972 Ga0207668_10171351 Ga0207668_101713511 374
101 3300026035 Ga0207703_10140424 Ga0207703_101404242 374
102 3300026075 Ga0207708_10069075 Ga0207708_100690752 374
103 3300026075 Ga0207708_10136155 Ga0207708_101361552 374
104 3300026088 Ga0207641_10071428 Ga0207641_100714281 374
105 3300026089 Ga0207648_10006521 Ga0207648_100065219 374
106 3300026089 Ga0207648_10112424 Ga0207648_101124242 374
107 3300026095 Ga0207676_10010260 Ga0207676_100102607 374
108 3300026118 Ga0207675_100025867 Ga0207675_1000258673 374
109 3300026118 Ga0207675_100040145 Ga0207675_1000401455 374
110 3300026118 Ga0207675_100060574 Ga0207675_1000605741 374
111 3300026118 Ga0207675_100137666 Ga0207675_1001376662 374
112 3300026121 Ga0207683_10007605 Ga0207683_100076055 374
113 3300026121 Ga0207683_10046868 Ga0207683_100468684 374
114 3300028379 Ga0268266_10001644 Ga0268266_1000164424 374
115 3300028379 Ga0268266_10064349 Ga0268266_100643492 374
116 3300028380 Ga0268265_10015383 Ga0268265_100153834 374
117 3300028800 Ga0265338_10000043 Ga0265338_100000437 374
118 3300031235 Ga0265330_10062755 Ga0265330_100627552 374
119 3300031235 Ga0265330_10067591 Ga0265330_100675912 374
120 3300031241 Ga0265325_10000002 Ga0265325_10000002380 374
121 3300031242 Ga0265329_10024524 Ga0265329_100245242 374
122 3300031247 Ga0265340_10000057 Ga0265340_1000005720 374
123 3300031247 Ga0265340_10000681 Ga0265340_100006816 374
124 3300031247 Ga0265340_10102778 Ga0265340_101027781 374
125 3300031249 Ga0265339_10001460 Ga0265339_100014605 374
126 3300031344 Ga0265316_10001355 Ga0265316_100013555 374
127 3300031344 Ga0265316_10089788 Ga0265316_100897881 374
128 3300031456 Ga0307513_10004863 Ga0307513_1000486310 374
129 3300031456 Ga0307513_10124132 Ga0307513_101241322 374
130 3300031456 Ga0307513_10126034 Ga0307513_101260342 374
131 3300031595 Ga0265313_10000565 Ga0265313_1000056526 374
132 3300031595 Ga0265313_10008061 Ga0265313_100080617 374
133 3300031711 Ga0265314_10035494 Ga0265314_100354942 374
134 3300031711 Ga0265314_10052672 Ga0265314_100526722 374
135 3300031712 Ga0265342_10003874 Ga0265342_100038746 374
136 3300031995 Ga0307409_100017174 Ga0307409_1000171743 374
137 3300032005 Ga0307411_10001689 Ga0307411_100016895 374
138 3300037312 Ga0395899_0091906 Ga0395899_0091906_71_1204 374
139 3300038443 Ga0395901_0114324 Ga0395901_0114324_1266_2399 374
140 3300041441 Ga0451787_251173 Ga0451787_251173_390_1517 374
141 3300041486 Ga0451807_1051597 Ga0451807_1051597_789_1916 374
142 3300042122 Ga0450920_000377 Ga0450920_000377_2246_3373 374
143 3300042133 Ga0450896_000920 Ga0450896_000920_1099_2226 374
144 3300042146 Ga0450907_008156 Ga0450907_008156_40_1167 374
145 3300042184 Ga0450908_000456 Ga0450908_000456_3431_4558 374
146 3300042531 Ga0450918_001521 Ga0450918_001521_3304_4431 374
147 3300046460 Ga0495638_0051027 Ga0495638_0051027_69_1196 374
148 3300046513 Ga0495616_0004057 Ga0495616_0004057_8074_9201 374
149 3300046692 Ga0495671_0009918 Ga0495671_0009918_875_2008 374
150 3300049569 Ga0501032_0005037 Ga0501032_0005037_6809_7933 374
151 3300049572 Ga0501036_0087940 Ga0501036_0087940_1090_2214 374
152 3300049577 Ga0501041_0083891 Ga0501041_0083891_711_1838 374
153 3300049579 Ga0501043_0031551 Ga0501043_0031551_1663_2787 374
154 3300049583 Ga0501067_0000259 Ga0501067_0000259_22917_24041 374
155 3300049584 Ga0501068_0002489 Ga0501068_0002489_7331_8455 374
156 3300049589 Ga0501073_0000031 Ga0501073_0000031_27936_29060 374
157 3300049593 Ga0501077_0001769 Ga0501077_0001769_9069_10193 374
158 3300049742 Ga0501080_0006326 Ga0501080_0006326_7289_8413 374
159 3300049823 Ga0501044_0001081 Ga0501044_0001081_19816_20940 374
160 3300053119 Ga0500595_005175 Ga0500595_005175_2909_4042 374
161 3300060353 Ga0501082_0164620 Ga0501082_0164620_228_1355 374
162 iso_pu_bacteria 2651869818 2652974840 374
163 iso_pu_bacteria 2738543020 2739287940 374
164 iso_pu_bacteria 2738543021 2739293252 374
165 iso_pu_bacteria 2842805378 2842808658 374
166 3300005295 Ga0065707_10081837 Ga0065707_1008183726 375
167 3300005353 Ga0070669_100065886 Ga0070669_1000658865 375
168 3300005356 Ga0070674_100003347 Ga0070674_1000033477 375
169 3300005367 Ga0070667_100000165 Ga0070667_10000016566 375
170 3300005435 Ga0070714_100098309 Ga0070714_1000983092 375
171 3300005539 Ga0068853_100154201 Ga0068853_1001542012 375
172 3300005614 Ga0068856_100403314 Ga0068856_1004033142 375
173 3300005719 Ga0068861_100032438 Ga0068861_1000324382 375
174 3300005844 Ga0068862_100068255 Ga0068862_1000682552 375
175 3300005981 Ga0081538_10020258 Ga0081538_100202586 375
176 3300009092 Ga0105250_10026738 Ga0105250_100267382 375
177 3300009093 Ga0105240_10298378 Ga0105240_102983782 375
178 3300009177 Ga0105248_10147520 Ga0105248_101475203 375
179 3300014326 Ga0157380_10024714 Ga0157380_100247142 375
180 3300025937 Ga0207669_10005071 Ga0207669_100050717 375
181 3300025986 Ga0207658_10000035 Ga0207658_10000035128 375
182 3300026118 Ga0207675_100033699 Ga0207675_1000336994 375
183 3300028380 Ga0268265_10034744 Ga0268265_100347442 375
184 3300028800 Ga0265338_10008908 Ga0265338_1000890810 375
185 3300031711 Ga0265314_10038129 Ga0265314_100381294 375
186 3300036401 Ga0373937_0064479 Ga0373937_0064479_1238_2365 375
187 3300047472 Ga0495686_0000007 Ga0495686_0000007_439486_440634 375
188 3300049571 Ga0501034_0003592 Ga0501034_0003592_15342_16484 375
189 3300049574 Ga0501038_0014118 Ga0501038_0014118_3765_4907 375
190 3300049576 Ga0501040_0011837 Ga0501040_0011837_3023_4153 375
191 3300049577 Ga0501041_0018518 Ga0501041_0018518_1256_2386 375
192 3300049578 Ga0501042_0018623 Ga0501042_0018623_2871_4001 375
193 3300049579 Ga0501043_0073579 Ga0501043_0073579_1407_2549 375
194 3300049580 Ga0501046_0174432 Ga0501046_0174432_448_1590 375
195 3300049581 Ga0501047_0009612 Ga0501047_0009612_7435_8577 375
196 3300049584 Ga0501068_0005953 Ga0501068_0005953_5421_6551 375
197 3300049588 Ga0501072_0087226 Ga0501072_0087226_153_1283 375
198 3300049589 Ga0501073_0000124 Ga0501073_0000124_19355_20497 375
199 3300049590 Ga0501074_0014041 Ga0501074_0014041_1256_2386 375
200 3300049590 Ga0501074_0133176 Ga0501074_0133176_10_1152 375
201 3300049591 Ga0501075_0005658 Ga0501075_0005658_6048_7178 375
202 3300049592 Ga0501076_0004658 Ga0501076_0004658_6608_7738 375
203 3300049593 Ga0501077_0036147 Ga0501077_0036147_844_1974 375
204 3300049742 Ga0501080_0000797 Ga0501080_0000797_17150_18292 375
205 3300049742 Ga0501080_0014368 Ga0501080_0014368_4873_6003 375
206 3300049743 Ga0501081_0008000 Ga0501081_0008000_779_1909 375
207 3300049822 Ga0501035_0288875 Ga0501035_0288875_55_1197 375
208 3300049823 Ga0501044_0001042 Ga0501044_0001042_24741_25883 375
209 3300054114 Ga0501084_0010508 Ga0501084_0010508_2087_3217 375
210 3300060353 Ga0501082_0003445 Ga0501082_0003445_1340_2482 375
211 3300060353 Ga0501082_0066844 Ga0501082_0066844_1471_2601 375
212 3300061734 Ga0530510_0011905 Ga0530510_0011905_3218_4348 375
213 iso_pu_bacteria 2728369097 2729145657 375
214 iso_pu_bacteria 2808606373 2808907471 375
215 iso_pu_bacteria 2808606379 2808941493 375
216 iso_pu_bacteria 2919501602 2919504044 375
217 iso_pu_bacteria 2919534386 2919537624 375
218 iso_pu_bacteria 2923525760 2923528918 375
219 iso_pu_bacteria 2926063275 2926065383 375
220 iso_pu_bacteria 3007252601 3007253207 375
221 iso_pu_bacteria 3007315729 3007318000 375
222 iso_pu_bacteria 640427133 640486828 375
223 iso_pu_bacteria 651053060 651174682 375
224 3300003791 Ga0055530_10002552 Ga0055530_100025522 376
225 3300005466 Ga0070685_10051851 Ga0070685_100518511 376
226 3300005985 Ga0081539_10000007 Ga0081539_10000007327 376
227 3300006353 Ga0075370_10057490 Ga0075370_100574903 376
228 3300009551 Ga0105238_10073965 Ga0105238_100739655 376
229 3300021361 Ga0213872_10053226 Ga0213872_100532262 376
230 3300025250 Ga0209026_1001591 Ga0209026_100159112 376
231 3300028380 Ga0268265_10033537 Ga0268265_100335373 376
232 3300031507 Ga0307509_10214947 Ga0307509_102149472 376
233 3300039447 Ga0436361_0866516 Ga0436361_0866516_6600_7733 376
234 3300039453 Ga0436362_0737366 Ga0436362_0737366_151_1284 376
235 3300042876 Ga0451577_0067545 Ga0451577_0067545_110_1264 376
236 3300045051 Ga0451576_0014659 Ga0451576_0014659_176_1330 376
237 3300047320 Ga0495672_0058884 Ga0495672_0058884_76_1209 376
238 3300047472 Ga0495686_0001560 Ga0495686_0001560_14027_15160 376
239 3300047472 Ga0495686_0035529 Ga0495686_0035529_25_1158 376
240 3300048908 Ga0496105_0130826 Ga0496105_0130826_529_1671 376
241 3300048917 Ga0496114_0329622 Ga0496114_0329622_146_1288 376
242 3300049568 Ga0501031_0037233 Ga0501031_0037233_721_1857 376
243 3300049570 Ga0501033_0221692 Ga0501033_0221692_190_1326 376
244 3300049572 Ga0501036_0000844 Ga0501036_0000844_16758_17894 376
245 3300049572 Ga0501036_0005198 Ga0501036_0005198_8211_9347 376
246 3300049573 Ga0501037_0029640 Ga0501037_0029640_473_1609 376
247 3300049573 Ga0501037_0050166 Ga0501037_0050166_297_1433 376
248 3300049574 Ga0501038_0049218 Ga0501038_0049218_1060_2196 376
249 3300049574 Ga0501038_0065536 Ga0501038_0065536_1713_2849 376
250 3300049575 Ga0501039_0026230 Ga0501039_0026230_2078_3211 376
251 3300049576 Ga0501040_0006324 Ga0501040_0006324_5422_6558 376
252 3300049577 Ga0501041_0001179 Ga0501041_0001179_12966_14102 376
253 3300049577 Ga0501041_0007871 Ga0501041_0007871_1252_2388 376
254 3300049578 Ga0501042_0012142 Ga0501042_0012142_1685_2821 376
255 3300049578 Ga0501042_0137528 Ga0501042_0137528_60_1193 376
256 3300049578 Ga0501042_0211110 Ga0501042_0211110_73_1209 376
257 3300049580 Ga0501046_0014997 Ga0501046_0014997_1442_2578 376
258 3300049586 Ga0501070_0199462 Ga0501070_0199462_431_1564 376
259 3300049586 Ga0501070_0298777 Ga0501070_0298777_135_1271 376
260 3300049587 Ga0501071_0061081 Ga0501071_0061081_999_2135 376
261 3300049587 Ga0501071_0075137 Ga0501071_0075137_70_1203 376
262 3300049587 Ga0501071_0209993 Ga0501071_0209993_28_1164 376
263 3300049588 Ga0501072_0027287 Ga0501072_0027287_3228_4364 376
264 3300049590 Ga0501074_0108096 Ga0501074_0108096_487_1623 376
265 3300049591 Ga0501075_0001292 Ga0501075_0001292_2501_3637 376
266 3300049591 Ga0501075_0021026 Ga0501075_0021026_167_1303 376
267 3300049592 Ga0501076_0005405 Ga0501076_0005405_280_1416 376
268 3300049592 Ga0501076_0038591 Ga0501076_0038591_2061_3197 376
269 3300049592 Ga0501076_0060555 Ga0501076_0060555_1465_2601 376
270 3300049593 Ga0501077_0005211 Ga0501077_0005211_3534_4670 376
271 3300049593 Ga0501077_0007800 Ga0501077_0007800_496_1632 376
272 3300049741 Ga0501079_0001461 Ga0501079_0001461_310_1446 376
273 3300049741 Ga0501079_0058761 Ga0501079_0058761_1231_2367 376
274 3300049742 Ga0501080_0007274 Ga0501080_0007274_8804_9940 376
275 3300049742 Ga0501080_0024223 Ga0501080_0024223_864_2000 376
276 3300049743 Ga0501081_0000501 Ga0501081_0000501_1677_2813 376
277 3300049822 Ga0501035_0043666 Ga0501035_0043666_1958_3094 376
278 3300049822 Ga0501035_0234326 Ga0501035_0234326_21_1154 376
279 3300049824 Ga0501045_0015531 Ga0501045_0015531_3126_4262 376
280 3300049824 Ga0501045_0027222 Ga0501045_0027222_192_1328 376
281 3300053130 Ga0500642_0026595 Ga0500642_0026595_508_1647 376
282 3300053131 Ga0500652_053940 Ga0500652_053940_228_1367 376
283 3300053730 Ga0500645_004405 Ga0500645_004405_3216_4349 376
284 3300054114 Ga0501084_0006074 Ga0501084_0006074_148_1284 376
285 3300054114 Ga0501084_0054859 Ga0501084_0054859_1165_2301 376
286 3300054114 Ga0501084_0334701 Ga0501084_0334701_39_1175 376
287 3300060353 Ga0501082_0010476 Ga0501082_0010476_3834_4970 376
288 3300060353 Ga0501082_0024795 Ga0501082_0024795_1187_2323 376
289 3300061734 Ga0530510_0006862 Ga0530510_0006862_5148_6284 376
290 3300061734 Ga0530510_0020567 Ga0530510_0020567_2506_3642 376
291 iso_pu_bacteria 2522572158 2523106249 376
292 3300005347 Ga0070668_100003642 Ga0070668_10000364214 377
293 3300005367 Ga0070667_100021673 Ga0070667_1000216732 377
294 3300005548 Ga0070665_100013714 Ga0070665_1000137149 377
295 3300031456 Ga0307513_10000053 Ga0307513_10000053132 377
296 3300039447 Ga0436361_0677619 Ga0436361_0677619_637_1773 377
297 3300042439 Ga0439464_0004293 Ga0439464_0004293_852_1985 377
298 3300046522 Ga0495643_0002441 Ga0495643_0002441_10215_11348 377
299 3300042000 Ga0439437_001944 Ga0439437_001944_472_1608 378
300 3300042115 Ga0450911_000007 Ga0450911_000007_160848_161984 378
301 3300042156 Ga0439446_0002566 Ga0439446_0002566_3004_4140 378
302 3300042530 Ga0450916_001138 Ga0450916_001138_30_1166 378
303 3300046694 Ga0495649_0009555 Ga0495649_0009555_1223_2359 378
304 3300053104 Ga0500556_0000347 Ga0500556_0000347_21693_22832 378
305 iso_pu_bacteria 2919493220 2919493633 378
306 iso_pu_bacteria 2919543075 2919544968 378
307 3300005458 Ga0070681_10248117 Ga0070681_102481172 379
308 3300013102 Ga0157371_10078769 Ga0157371_100787692 379
309 3300015261 Ga0182006_1031713 Ga0182006_10317132 379
310 3300021361 Ga0213872_10001801 Ga0213872_100018012 379
311 3300025912 Ga0207707_10254649 Ga0207707_102546492 379
312 3300027312 Ga0209371_1001305 Ga0209371_100130518 379
313 3300030500 Ga0268256_1008861 Ga0268256_10088612 379
314 3300031548 Ga0307408_100000027 Ga0307408_100000027221 379
315 3300042139 Ga0450904_000067 Ga0450904_000067_20140_21279 379
316 3300042439 Ga0439464_0002038 Ga0439464_0002038_953_2092 379
317 3300042532 Ga0450893_0004545 Ga0450893_0004545_342_1484 379
318 3300046507 Ga0495606_0002415 Ga0495606_0002415_8657_9796 379
319 3300046694 Ga0495649_0001380 Ga0495649_0001380_8872_10011 379
320 3300049853 Ga0501226_000006 Ga0501226_000006_53263_54402 379
321 3300053092 Ga0500583_0035036 Ga0500583_0035036_979_2130 379
322 3300053153 Ga0500616_0000062 Ga0500616_0000062_206138_207289 379
323 iso_pu_bacteria 2648501241 2649119280 379
324 3300031241 Ga0265325_10089201 Ga0265325_100892012 380
325 3300021361 Ga0213872_10000095 Ga0213872_100000958 381
326 3300021361 Ga0213872_10003801 Ga0213872_100038012 381
327 3300039447 Ga0436361_0065571 Ga0436361_0065571_9359_10507 381
328 3300042156 Ga0439446_0001120 Ga0439446_0001120_1428_2573 381
329 3300005937 Ga0081455_10032738 Ga0081455_100327384 382
330 3300049576 Ga0501040_0077640 Ga0501040_0077640_1022_2179 383
331 3300049588 Ga0501072_0059751 Ga0501072_0059751_889_2046 383
332 3300049824 Ga0501045_0039639 Ga0501045_0039639_1373_2530 383
333 3300003215 JGI25153J46596_10000048 JGI25153J46596_1000004868 385
334 3300005844 Ga0068862_100006208 Ga0068862_1000062083 385
335 3300025297 Ga0209758_1000048 Ga0209758_1000048278 385
336 3300025302 Ga0207426_1044971 Ga0207426_10449711 385
337 3300025304 Ga0209257_1000237 Ga0209257_100023720 385
338 3300047472 Ga0495686_0026523 Ga0495686_0026523_1965_3128 385
339 3300049569 Ga0501032_0059956 Ga0501032_0059956_88_1245 385
340 3300049571 Ga0501034_0025136 Ga0501034_0025136_3902_5059 385
341 3300049579 Ga0501043_0079484 Ga0501043_0079484_264_1424 385
342 3300049579 Ga0501043_0151298 Ga0501043_0151298_578_1735 385
343 3300049581 Ga0501047_0007768 Ga0501047_0007768_552_1709 385
344 3300049583 Ga0501067_0067307 Ga0501067_0067307_215_1372 385
345 3300049584 Ga0501068_0103100 Ga0501068_0103100_385_1542 385
346 3300049589 Ga0501073_0027249 Ga0501073_0027249_1647_2804 385
347 3300049589 Ga0501073_0069699 Ga0501073_0069699_907_2064 385
348 3300049742 Ga0501080_0089379 Ga0501080_0089379_645_1802 385
349 3300049742 Ga0501080_0271198 Ga0501080_0271198_10_1167 385
350 3300049744 Ga0501083_0018038 Ga0501083_0018038_2689_3846 385
351 3300049823 Ga0501044_0002801 Ga0501044_0002801_2993_4150 385
352 3300053088 Ga0500644_0024879 Ga0500644_0024879_317_1474 385
353 3300053090 Ga0500646_0009443 Ga0500646_0009443_310_1467 385
354 3300053093 Ga0500651_0003441 Ga0500651_0003441_3138_4313 385
355 3300053103 Ga0500555_003771 Ga0500555_003771_2384_3547 385
356 3300053104 Ga0500556_0024149 Ga0500556_0024149_239_1414 385
357 3300053119 Ga0500595_000648 Ga0500595_000648_7845_9020 385
358 3300053146 Ga0500588_0016781 Ga0500588_0016781_47_1210 385
359 3300053151 Ga0500604_0004970 Ga0500604_0004970_755_1912 385
360 3300053153 Ga0500616_0006999 Ga0500616_0006999_1223_2386 385
361 3300053731 Ga0500609_001176 Ga0500609_001176_263_1420 385
362 3300060353 Ga0501082_0004011 Ga0501082_0004011_753_1910 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

102

245

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.8969 88 162
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8942 86 162
5onn-assembly1.cif.gz_A crystal structure of ectoine synthase from p. lautus 0.8864 89 162
5onm-assembly1.cif.gz_A crystal structure of ectoine synthase from p. lautus 0.885 89 162
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8752 86 162
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9011 81 162 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8926 82 162 2.60.120.10
5cadA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8922 90 161 2.60.120.10
af_I1M4N3_280_453_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8916 88 163 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8894 89 162 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D7ZH39-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9562 1 305 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A656SGD2-F1-model_v4 deleted 0.9561 17 293
AF-A0A849AMX7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9502 92 162 GO:0003700
GO:0043565
AF-A0A2D7ZH39-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9471 1 305 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A6L7VIB7-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9418 5 377 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map