F422528

General Info

Members Datasets Scaffolds Average Seq Length
362 220 724 263

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100677142|Ga0068853_1006771421
Length 271
Sequence MSIEALIFDVDGTMADTEEAHRVAFNLAFERQRVGWNWTRSEYRRLLAVTGGKERIASYIESLPVGAPQRQRLLARVPEIHADKTKFYSSAVRDGGVPLRDGVARLLDEALEAGLRLAIASTTTAVNIDALLQSAFGARGVEMFTVIACGDQVAAKKPAPDIYQLALQTLGIGPDRAVAFEDSPNGLRAATGAGLWTVVTPTYWTQDGDYAAAGLVLPRLGEPALPLSGEPGGALRERAWLGIDELLELARPSRRPEPVRALYDPRAPRAA

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
135 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
212 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.44
Nodule 0.83
Rhizoplane 1.38
Rhizosphere 64.64
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100677142 3300005539 Bacteria 983
2 rootL2_10076540 3300003322 Bacteria 2929
3 Ga0055534_1000091 3300003784 Bacteria 71324
4 Ga0055528_1000237 3300003790 Bacteria 46144
5 Ga0055540_1002312 3300003792 Bacteria 10224
6 Ga0065704_10083595 3300005289 Bacteria 3444
7 Ga0070676_10017904 3300005328 Bacteria 3922
8 Ga0070676_10096927 3300005328 Bacteria 1816
9 Ga0068869_100095386 3300005334 Bacteria 2245
10 Ga0068868_100084588 3300005338 Bacteria 2548
11 Ga0070661_100117543 3300005344 Bacteria 1989
12 Ga0070671_100000182 3300005355 Bacteria 41975
13 Ga0070671_100257863 3300005355 Bacteria 1482
14 Ga0070671_100410870 3300005355 Bacteria 1158
15 Ga0070673_100084201 3300005364 Bacteria 2586
16 Ga0070667_100017114 3300005367 Bacteria 6006
17 Ga0070667_100549387 3300005367 Bacteria 1061
18 Ga0070714_100148538 3300005435 Bacteria 2110
19 Ga0070663_100138585 3300005455 Bacteria 1855
20 Ga0070663_100616050 3300005455 Bacteria 914
21 Ga0070662_100174245 3300005457 Bacteria 1691
22 Ga0070662_100208810 3300005457 Bacteria 1553
23 Ga0068867_100072358 3300005459 Bacteria 2580
24 Ga0068867_100346235 3300005459 Bacteria 1239
25 Ga0070706_100001470 3300005467 Bacteria 24759
26 Ga0070706_100015024 3300005467 Bacteria 7149
27 Ga0070707_100035450 3300005468 Bacteria 4759
28 Ga0070707_100046185 3300005468 Bacteria 4168
29 Ga0070679_100020405 3300005530 Bacteria 6461
30 Ga0070679_100033324 3300005530 Bacteria 5100
31 Ga0068853_100759090 3300005539 Bacteria 927
32 Ga0070665_100002017 3300005548 Bacteria 22832
33 Ga0070665_100013533 3300005548 Bacteria 8207
34 Ga0068855_100075508 3300005563 Bacteria 3914
35 Ga0068855_100126153 3300005563 Bacteria 2926
36 Ga0068854_100171234 3300005578 Bacteria 1690
37 Ga0068854_100232251 3300005578 Bacteria 1464
38 Ga0068854_100303857 3300005578 Unclassified 1292
39 Ga0068856_100137991 3300005614 Bacteria 2445
40 Ga0068859_100000520 3300005617 Bacteria 38244
41 Ga0068859_100091045 3300005617 Bacteria 3101
42 Ga0068861_100147600 3300005719 Bacteria 1926
43 Ga0068861_100469761 3300005719 Bacteria 1131
44 Ga0068863_100002040 3300005841 Bacteria 20019
45 Ga0068863_100005930 3300005841 Bacteria 11981
46 Ga0068858_100000238 3300005842 Bacteria 59573
47 Ga0068858_100001804 3300005842 Bacteria 21820
48 Ga0068860_100000873 3300005843 Bacteria 33457
49 Ga0068862_100004284 3300005844 Bacteria 12070
50 Ga0075365_10035721 3300006038 Bacteria 3217
51 Ga0075368_10056390 3300006042 Bacteria 1568
52 Ga0075363_100026136 3300006048 Bacteria 2984
53 Ga0075363_100106883 3300006048 Bacteria 1552
54 Ga0075364_10013488 3300006051 Bacteria 5025
55 Ga0075432_10045589 3300006058 Bacteria 1538
56 Ga0075362_10005901 3300006177 Bacteria 4522
57 Ga0075362_10009193 3300006177 Bacteria 3810
58 Ga0075362_10042805 3300006177 Bacteria 2003
59 Ga0075362_10123843 3300006177 Bacteria 1225
60 Ga0075367_10054731 3300006178 Bacteria 2366
61 Ga0075366_10006405 3300006195 Bacteria 6451
62 Ga0075366_10026333 3300006195 Bacteria 3406
63 Ga0075366_10066641 3300006195 Bacteria 2142
64 Ga0075366_10070736 3300006195 Bacteria 2078
65 Ga0075366_10072985 3300006195 Bacteria 2045
66 Ga0075366_10103879 3300006195 Bacteria 1707
67 Ga0097621_100126316 3300006237 Bacteria 2173
68 Ga0075370_10000125 3300006353 Bacteria 25536
69 Ga0075370_10002134 3300006353 Bacteria 9037
70 Ga0075370_10002372 3300006353 Bacteria 8718
71 Ga0075370_10013663 3300006353 Bacteria 4321
72 Ga0075370_10070544 3300006353 Bacteria 1998
73 Ga0075370_10088769 3300006353 Bacteria 1782
74 Ga0068871_100035886 3300006358 Bacteria 3943
75 Ga0068871_100375572 3300006358 Bacteria 1262
76 Ga0097620_100000520 3300006931 Bacteria 38244
77 Ga0097620_100091045 3300006931 Bacteria 3101
78 Ga0099826_10019808 3300006948 Bacteria 5054
79 Ga0099826_10138022 3300006948 Bacteria 1413
80 Ga0105250_10057167 3300009092 Bacteria 1566
81 Ga0105240_10001667 3300009093 Bacteria 37697
82 Ga0105240_10015663 3300009093 Bacteria 10296
83 Ga0105240_10038760 3300009093 Bacteria 6110
84 Ga0105240_10135814 3300009093 Bacteria 2946
85 Ga0105245_10176892 3300009098 Bacteria 2036
86 Ga0105247_10000317 3300009101 Bacteria 43370
87 Ga0105247_10036117 3300009101 Bacteria 3013
88 Ga0105243_10074900 3300009148 Bacteria 2746
89 Ga0105248_10057443 3300009177 Bacteria 4368
90 Ga0105248_10100117 3300009177 Bacteria 3265
91 Ga0105248_10505270 3300009177 Bacteria 1363
92 Ga0105237_10075708 3300009545 Bacteria 3356
93 Ga0105237_10650162 3300009545 Unclassified 1061
94 Ga0105238_10001249 3300009551 Bacteria 25597
95 Ga0105238_10067576 3300009551 Bacteria 3575
96 Ga0105238_10304369 3300009551 Bacteria 1578
97 Ga0105238_10913928 3300009551 Bacteria 896
98 Ga0105249_10056668 3300009553 Bacteria 3588
99 Ga0105249_10103499 3300009553 Bacteria 2682
100 Ga0105239_10181823 3300010375 Bacteria 2353
101 Ga0105239_10550447 3300010375 Bacteria 1314
102 Ga0157373_10036040 3300013100 Bacteria 3551
103 Ga0157370_10002946 3300013104 Bacteria 20263
104 Ga0157369_10059385 3300013105 Bacteria 4124
105 Ga0163163_10058000 3300014325 Bacteria 3828
106 Ga0163163_10718003 3300014325 Unclassified 1063
107 Ga0157379_10005758 3300014968 Bacteria 10664
108 Ga0157379_10120981 3300014968 Bacteria 2355
109 Ga0157379_10239764 3300014968 Bacteria 1645
110 Ga0157379_10376821 3300014968 Bacteria 1302
111 Ga0157376_10283019 3300014969 Bacteria 1562
112 Ga0157376_10374457 3300014969 Bacteria 1370
113 Ga0163161_10042446 3300017792 Bacteria 3271
114 Ga0206354_10554487 3300020081 Bacteria 1290
115 Ga0209565_1000087 3300025263 Bacteria 152027
116 Ga0209673_1000145 3300025273 Bacteria 152027
117 Ga0209673_1027543 3300025273 Bacteria 1847
118 Ga0209675_1000085 3300025291 Bacteria 152027
119 Ga0209676_1037613 3300025292 Bacteria 1394
120 Ga0209025_1042389 3300025294 Bacteria 1934
121 Ga0209051_1000275 3300025303 Bacteria 84419
122 Ga0209051_1014399 3300025303 Bacteria 3693
123 Ga0207656_10084180 3300025321 Bacteria 1434
124 Ga0207710_10000323 3300025900 Bacteria 36602
125 Ga0207680_10460631 3300025903 Bacteria 903
126 Ga0207645_10148549 3300025907 Bacteria 1529
127 Ga0207645_10206384 3300025907 Bacteria 1293
128 Ga0207684_10709178 3300025910 Bacteria 855
129 Ga0207707_10000035 3300025912 Bacteria 147299
130 Ga0207695_10021102 3300025913 Bacteria 7440
131 Ga0207695_10061520 3300025913 Bacteria 3880
132 Ga0207695_10094722 3300025913 Bacteria 2992
133 Ga0207695_10325661 3300025913 Bacteria 1426
134 Ga0207671_10074664 3300025914 Bacteria 2534
135 Ga0207671_10106667 3300025914 Bacteria 2127
136 Ga0207671_10402533 3300025914 Unclassified 1088
137 Ga0207671_10457992 3300025914 Bacteria 1016
138 Ga0207652_10001126 3300025921 Bacteria 24078
139 Ga0207652_10160277 3300025921 Bacteria 2017
140 Ga0207646_10079645 3300025922 Bacteria 2929
141 Ga0207646_10123406 3300025922 Bacteria 2328
142 Ga0207694_10031372 3300025924 Bacteria 4059
143 Ga0207694_10599387 3300025924 Bacteria 926
144 Ga0207644_10126332 3300025931 Bacteria 1952
145 Ga0207706_10038916 3300025933 Bacteria 4218
146 Ga0207706_10187713 3300025933 Bacteria 1815
147 Ga0207709_10099210 3300025935 Bacteria 1922
148 Ga0207711_10039083 3300025941 Bacteria 4035
149 Ga0207689_10165900 3300025942 Bacteria 1820
150 Ga0207667_10014596 3300025949 Bacteria 8945
151 Ga0207667_10178462 3300025949 Bacteria 2181
152 Ga0207651_10060843 3300025960 Bacteria 2624
153 Ga0207712_10079720 3300025961 Bacteria 2379
154 Ga0207668_10096580 3300025972 Bacteria 2185
155 Ga0207640_10034134 3300025981 Bacteria 3172
156 Ga0207640_10081666 3300025981 Bacteria 2211
157 Ga0207640_10226423 3300025981 Bacteria 1435
158 Ga0207658_10011569 3300025986 Bacteria 6006
159 Ga0207658_10035895 3300025986 Bacteria 3552
160 Ga0207677_10099091 3300026023 Bacteria 2139
161 Ga0207703_10000777 3300026035 Bacteria 31435
162 Ga0207703_10000911 3300026035 Bacteria 28871
163 Ga0207639_10123718 3300026041 Bacteria 2130
164 Ga0207639_10339895 3300026041 Bacteria 1338
165 Ga0207639_10373014 3300026041 Bacteria 1280
166 Ga0207678_10031041 3300026067 Bacteria 4663
167 Ga0207678_10084391 3300026067 Bacteria 2716
168 Ga0207702_10048570 3300026078 Bacteria 3580
169 Ga0207702_10112924 3300026078 Bacteria 2419
170 Ga0207641_10000480 3300026088 Bacteria 45132
171 Ga0207641_10004471 3300026088 Bacteria 12103
172 Ga0207648_10053380 3300026089 Bacteria 3533
173 Ga0207648_10283611 3300026089 Bacteria 1481
174 Ga0207674_10030361 3300026116 Bacteria 5683
175 Ga0207698_10051907 3300026142 Bacteria 3138
176 Ga0207698_10463323 3300026142 Bacteria 1226
177 Ga0209282_1000304 3300027666 Bacteria 24377
178 Ga0209813_10067335 3300027866 Bacteria 1157
179 Ga0209974_10055206 3300027876 Bacteria 1340
180 Ga0268266_10005412 3300028379 Bacteria 11911
181 Ga0268266_10052426 3300028379 Bacteria 3503
182 Ga0268266_10358574 3300028379 Bacteria 1371
183 Ga0268265_10006056 3300028380 Bacteria 8221
184 Ga0268264_10000774 3300028381 Bacteria 35274
185 Ga0268264_10020220 3300028381 Bacteria 5442
186 Ga0268264_10142193 3300028381 Bacteria 2141
187 Ga0307517_10000058 3300028786 Bacteria 148725
188 Ga0307517_10144206 3300028786 Bacteria 1659
189 Ga0307515_10000692 3300028794 Bacteria 77763
190 Ga0307515_10277570 3300028794 Bacteria 1387
191 Ga0307511_10000066 3300030521 Bacteria 87505
192 Ga0307512_10022917 3300030522 Bacteria 5592
193 Ga0316179_1013011 3300030734 Bacteria 3525
194 Ga0316181_1240339 3300030744 Bacteria 1398
195 Ga0307513_10017660 3300031456 Bacteria 8549
196 Ga0307513_10064976 3300031456 Bacteria 3840
197 Ga0307513_10208607 3300031456 Bacteria 1787
198 Ga0307513_10545666 3300031456 Bacteria 872
199 Ga0307509_10000003 3300031507 Bacteria 577578
200 Ga0307509_10000215 3300031507 Bacteria 92190
201 Ga0307509_10005753 3300031507 Bacteria 17062
202 Ga0307509_10049400 3300031507 Bacteria 4510
203 Ga0307509_10098522 3300031507 Bacteria 2968
204 Ga0307408_100134225 3300031548 Bacteria 1934
205 Ga0307508_10000909 3300031616 Bacteria 34527
206 Ga0307508_10045923 3300031616 Bacteria 3901
207 Ga0307508_10095273 3300031616 Bacteria 2567
208 Ga0307508_10160708 3300031616 Bacteria 1850
209 Ga0307514_10012243 3300031649 Bacteria 7140
210 Ga0307514_10113154 3300031649 Bacteria 1916
211 Ga0307514_10148012 3300031649 Bacteria 1582
212 Ga0316575_10011154 3300031665 Bacteria 3320
213 Ga0307516_10238558 3300031730 Bacteria 1518
214 Ga0307516_10238914 3300031730 Bacteria 1516
215 Ga0307406_10341464 3300031901 Bacteria 1166
216 Ga0307407_10433230 3300031903 Bacteria 950
217 Ga0307416_100338194 3300032002 Bacteria 1517
218 Ga0307414_10069198 3300032004 Bacteria 2536
219 Ga0307411_10057394 3300032005 Bacteria 2571
220 Ga0307415_100254688 3300032126 Bacteria 1429
221 Ga0307510_10000001 3300033180 Bacteria 1172244
222 Ga0307510_10006334 3300033180 Bacteria 14124
223 Ga0307510_10014225 3300033180 Bacteria 9423
224 Ga0307510_10054467 3300033180 Bacteria 4189
225 Ga0373932_0044015 3300035112 Bacteria 1300
226 Ga0373927_0361892 3300035695 Bacteria 956
227 Ga0316582_0005533 3300036647 Bacteria 6519
228 Ga0395900_0095191 3300037418 Bacteria 3060
229 Ga0395898_0017081 3300037466 Bacteria 7411
230 Ga0395898_0030222 3300037466 Bacteria 5422
231 Ga0439436_0012630 3300041404 Bacteria 2564
232 Ga0439466_0016661 3300041411 Bacteria 2654
233 Ga0439432_020962 3300042006 Bacteria 2169
234 Ga0439449_0001524 3300042007 Bacteria 9071
235 Ga0450922_002899 3300042124 Bacteria 1590
236 Ga0450906_019850 3300042145 Bacteria 1203
237 Ga0439458_0066451 3300042157 Bacteria 906
238 Ga0450909_029565 3300042185 Bacteria 830
239 Ga0466959_0010129 3300045049 Bacteria 6724
240 Ga0466959_0018297 3300045049 Bacteria 5144
241 Ga0466959_0116975 3300045049 Bacteria 1898
242 Ga0466958_0267328 3300045836 Bacteria 1095
243 Ga0495592_0000173 3300046454 Bacteria 57219
244 Ga0495590_0021018 3300046457 Bacteria 2316
245 Ga0495638_0158231 3300046460 Bacteria 1309
246 Ga0495650_0007591 3300046471 Bacteria 6484
247 Ga0495650_0026726 3300046471 Bacteria 2678
248 Ga0495605_0041559 3300046474 Bacteria 2290
249 Ga0495620_0101521 3300046515 Bacteria 1146
250 Ga0495632_0014699 3300046519 Bacteria 4418
251 Ga0495648_0114106 3300046524 Bacteria 1464
252 Ga0495597_0006566 3300046542 Bacteria 5999
253 Ga0495625_0000012 3300046660 Bacteria 363006
254 Ga0495625_0064368 3300046660 Bacteria 2586
255 Ga0495671_0161190 3300046692 Bacteria 1091
256 Ga0495649_0011013 3300046694 Bacteria 5327
257 Ga0495660_0024909 3300046810 Bacteria 3403
258 Ga0495687_008714 3300047443 Bacteria 5762
259 Ga0495687_011099 3300047443 Bacteria 4872
260 Ga0495687_014177 3300047443 Bacteria 4119
261 Ga0495687_067387 3300047443 Bacteria 1449
262 Ga0495673_0074751 3300047469 Bacteria 1417
263 Ga0495686_0000902 3300047472 Bacteria 37377
264 Ga0495602_0189005 3300048088 Bacteria 1581
265 Ga0495626_0021502 3300048091 Bacteria 3202
266 Ga0496101_0027018 3300048904 Bacteria 3992
267 Ga0496102_0088067 3300048905 Bacteria 2869
268 Ga0496102_0131595 3300048905 Bacteria 2342
269 Ga0496112_0020656 3300048915 Bacteria 6245
270 Ga0496115_0102487 3300048918 Bacteria 2347
271 Ga0496116_0044013 3300048919 Bacteria 3036
272 Ga0496117_0000155 3300048920 Bacteria 146091
273 Ga0496118_0000066 3300048921 Bacteria 207678
274 Ga0496119_0000499 3300048922 Bacteria 53522
275 Ga0496119_0007750 3300048922 Bacteria 9587
276 Ga0496120_0000370 3300048923 Bacteria 73138
277 Ga0496120_0018632 3300048923 Bacteria 4466
278 Ga0496121_0000619 3300048924 Bacteria 66079
279 Ga0496121_0028740 3300048924 Bacteria 5168
280 Ga0496124_0016299 3300048927 Bacteria 7074
281 Ga0496124_0119914 3300048927 Bacteria 2104
282 Ga0496125_0000415 3300048928 Bacteria 79627
283 Ga0496125_0004890 3300048928 Bacteria 15196
284 Ga0496125_0017602 3300048928 Bacteria 6808
285 Ga0496125_0081371 3300048928 Bacteria 2475
286 Ga0496126_0010810 3300048929 Bacteria 9526
287 Ga0501036_0035889 3300049572 Bacteria 4195
288 Ga0501036_0182169 3300049572 Bacteria 1768
289 Ga0501038_0079175 3300049574 Bacteria 2772
290 Ga0501038_0088568 3300049574 Bacteria 2598
291 Ga0501039_0100000 3300049575 Bacteria 2263
292 Ga0501039_0382018 3300049575 Bacteria 1106
293 Ga0501040_0007523 3300049576 Bacteria 7043
294 Ga0501041_0042512 3300049577 Bacteria 2762
295 Ga0501042_0012635 3300049578 Bacteria 5728
296 Ga0501046_0020786 3300049580 Bacteria 5423
297 Ga0501048_0012708 3300049582 Bacteria 6260
298 Ga0501072_0014610 3300049588 Bacteria 6019
299 Ga0501074_0066551 3300049590 Bacteria 2592
300 Ga0501075_0000093 3300049591 Bacteria 41092
301 Ga0501076_0065653 3300049592 Bacteria 2894
302 Ga0501076_0147000 3300049592 Bacteria 1916
303 Ga0501077_0219530 3300049593 Bacteria 1208
304 Ga0501249_001312 3300049679 Bacteria 5177
305 Ga0501225_0047046 3300049705 Bacteria 1196
306 Ga0501079_0013896 3300049741 Bacteria 6142
307 Ga0501080_0028481 3300049742 Bacteria 5197
308 Ga0501080_0302619 3300049742 Bacteria 1450
309 Ga0501081_0117152 3300049743 Bacteria 1894
310 Ga0501081_0434918 3300049743 Bacteria 974
311 Ga0501083_0016637 3300049744 Bacteria 5143
312 Ga0501262_000301 3300049759 Bacteria 6024
313 Ga0501280_000280 3300049776 Bacteria 13016
314 Ga0501282_000721 3300049778 Bacteria 3805
315 Ga0501035_0318160 3300049822 Bacteria 1308
316 Ga0501045_0037217 3300049824 Bacteria 3536
317 nmdc:mga03683_14463_c1 3300050489 Bacteria 2921
318 nmdc:mga03683_269302_c1 3300050489 Bacteria 794
319 nmdc:mga03683_2859_c1 3300050489 Bacteria 5445
320 nmdc:mga03683_39240_c1 3300050489 Bacteria 1938
321 nmdc:mga03683_78835_c1 3300050489 Bacteria 1419
322 nmdc:mga03n38_10351_c1 3300050490 Bacteria 3426
323 nmdc:mga00v17_109066_c1 3300050491 Bacteria 1755
324 nmdc:mga0yw44_6645_c1 3300050492 Bacteria 5608
325 nmdc:mga0k408_21239_c1 3300050493 Bacteria 3645
326 nmdc:mga0k408_22223_c1 3300050493 Bacteria 3571
327 nmdc:mga0k408_236918_c1 3300050493 Bacteria 1090
328 nmdc:mga0k408_321291_c1 3300050493 Bacteria 924
329 nmdc:mga0k408_35328_c1 3300050493 Bacteria 2866
330 nmdc:mga0k408_3923_c1 3300050493 Bacteria 7887
331 nmdc:mga0k408_63319_c1 3300050493 Bacteria 2151
332 nmdc:mga06z11_48814_c1 3300050494 Bacteria 2156
333 nmdc:mga04h51_17737_c1 3300050495 Bacteria 2087
334 nmdc:mga07m45_106668_c1 3300050496 Bacteria 1612
335 nmdc:mga07m45_201465_c1 3300050496 Bacteria 1158
336 nmdc:mga07m45_2210_c1 3300050496 Bacteria 9083
337 nmdc:mga07m45_22994_c1 3300050496 Bacteria 3405
338 nmdc:mga07m45_304562_c1 3300050496 Bacteria 927
339 nmdc:mga07m45_33315_c2 3300050496 Bacteria 2524
340 nmdc:mga07m45_566_c1 3300050496 Bacteria 15704
341 nmdc:mga07m45_6640_c1 3300050496 Bacteria 5865
342 nmdc:mga07m45_7307_c1 3300050496 Bacteria 5636
343 nmdc:mga0n895_159012_c1 3300050512 Bacteria 2290
344 Ga0500578_0347200 3300053086 Bacteria 868
345 Ga0500644_0002809 3300053088 Bacteria 4336
346 Ga0500583_0203791 3300053092 Bacteria 983
347 Ga0500651_0048287 3300053093 Bacteria 2674
348 Ga0500651_0324249 3300053093 Bacteria 879
349 Ga0500594_0016090 3300053118 Bacteria 1813
350 Ga0500658_0004673 3300053134 Bacteria 5109
351 Ga0500559_0000109 3300053136 Bacteria 65246
352 Ga0500604_0088105 3300053151 Bacteria 1011
353 Ga0500619_000098 3300053154 Bacteria 23339
354 Ga0500622_0004240 3300053156 Bacteria 9119
355 Ga0500633_0051675 3300053160 Bacteria 1420
356 Ga0500637_0086683 3300053178 Bacteria 1810
357 Ga0500637_0250994 3300053178 Bacteria 987
358 Ga0501084_0135975 3300054114 Bacteria 2069
359 Ga0501082_0012625 3300060353 Bacteria 7261
360 Ga0466962_0202151 3300061719 Bacteria 971
361 Ga0530510_0000686 3300061734 Bacteria 21870
362 2644455605 2643221681 Bacteria 3707866
363 Ga0068853_100677142
364 rootL2_10076540
365 Ga0055534_1000091
366 Ga0055528_1000237
367 Ga0055540_1002312
368 Ga0065704_10083595
369 Ga0070676_10017904
370 Ga0070676_10096927
371 Ga0068869_100095386
372 Ga0068868_100084588
373 Ga0070661_100117543
374 Ga0070671_100000182
375 Ga0070671_100257863
376 Ga0070671_100410870
377 Ga0070673_100084201
378 Ga0070667_100017114
379 Ga0070667_100549387
380 Ga0070714_100148538
381 Ga0070663_100138585
382 Ga0070663_100616050
383 Ga0070662_100174245
384 Ga0070662_100208810
385 Ga0068867_100072358
386 Ga0068867_100346235
387 Ga0070706_100001470
388 Ga0070706_100015024
389 Ga0070707_100035450
390 Ga0070707_100046185
391 Ga0070679_100020405
392 Ga0070679_100033324
393 Ga0068853_100759090
394 Ga0070665_100002017
395 Ga0070665_100013533
396 Ga0068855_100075508
397 Ga0068855_100126153
398 Ga0068854_100171234
399 Ga0068854_100232251
400 Ga0068854_100303857
401 Ga0068856_100137991
402 Ga0068859_100000520
403 Ga0068859_100091045
404 Ga0068861_100147600
405 Ga0068861_100469761
406 Ga0068863_100002040
407 Ga0068863_100005930
408 Ga0068858_100000238
409 Ga0068858_100001804
410 Ga0068860_100000873
411 Ga0068862_100004284
412 Ga0075365_10035721
413 Ga0075368_10056390
414 Ga0075363_100026136
415 Ga0075363_100106883
416 Ga0075364_10013488
417 Ga0075432_10045589
418 Ga0075362_10005901
419 Ga0075362_10009193
420 Ga0075362_10042805
421 Ga0075362_10123843
422 Ga0075367_10054731
423 Ga0075366_10006405
424 Ga0075366_10026333
425 Ga0075366_10066641
426 Ga0075366_10070736
427 Ga0075366_10072985
428 Ga0075366_10103879
429 Ga0097621_100126316
430 Ga0075370_10000125
431 Ga0075370_10002134
432 Ga0075370_10002372
433 Ga0075370_10013663
434 Ga0075370_10070544
435 Ga0075370_10088769
436 Ga0068871_100035886
437 Ga0068871_100375572
438 Ga0097620_100000520
439 Ga0097620_100091045
440 Ga0099826_10019808
441 Ga0099826_10138022
442 Ga0105250_10057167
443 Ga0105240_10001667
444 Ga0105240_10015663
445 Ga0105240_10038760
446 Ga0105240_10135814
447 Ga0105245_10176892
448 Ga0105247_10000317
449 Ga0105247_10036117
450 Ga0105243_10074900
451 Ga0105248_10057443
452 Ga0105248_10100117
453 Ga0105248_10505270
454 Ga0105237_10075708
455 Ga0105237_10650162
456 Ga0105238_10001249
457 Ga0105238_10067576
458 Ga0105238_10304369
459 Ga0105238_10913928
460 Ga0105249_10056668
461 Ga0105249_10103499
462 Ga0105239_10181823
463 Ga0105239_10550447
464 Ga0157373_10036040
465 Ga0157370_10002946
466 Ga0157369_10059385
467 Ga0163163_10058000
468 Ga0163163_10718003
469 Ga0157379_10005758
470 Ga0157379_10120981
471 Ga0157379_10239764
472 Ga0157379_10376821
473 Ga0157376_10283019
474 Ga0157376_10374457
475 Ga0163161_10042446
476 Ga0206354_10554487
477 Ga0209565_1000087
478 Ga0209673_1000145
479 Ga0209673_1027543
480 Ga0209675_1000085
481 Ga0209676_1037613
482 Ga0209025_1042389
483 Ga0209051_1000275
484 Ga0209051_1014399
485 Ga0207656_10084180
486 Ga0207710_10000323
487 Ga0207680_10460631
488 Ga0207645_10148549
489 Ga0207645_10206384
490 Ga0207684_10709178
491 Ga0207707_10000035
492 Ga0207695_10021102
493 Ga0207695_10061520
494 Ga0207695_10094722
495 Ga0207695_10325661
496 Ga0207671_10074664
497 Ga0207671_10106667
498 Ga0207671_10402533
499 Ga0207671_10457992
500 Ga0207652_10001126
501 Ga0207652_10160277
502 Ga0207646_10079645
503 Ga0207646_10123406
504 Ga0207694_10031372
505 Ga0207694_10599387
506 Ga0207644_10126332
507 Ga0207706_10038916
508 Ga0207706_10187713
509 Ga0207709_10099210
510 Ga0207711_10039083
511 Ga0207689_10165900
512 Ga0207667_10014596
513 Ga0207667_10178462
514 Ga0207651_10060843
515 Ga0207712_10079720
516 Ga0207668_10096580
517 Ga0207640_10034134
518 Ga0207640_10081666
519 Ga0207640_10226423
520 Ga0207658_10011569
521 Ga0207658_10035895
522 Ga0207677_10099091
523 Ga0207703_10000777
524 Ga0207703_10000911
525 Ga0207639_10123718
526 Ga0207639_10339895
527 Ga0207639_10373014
528 Ga0207678_10031041
529 Ga0207678_10084391
530 Ga0207702_10048570
531 Ga0207702_10112924
532 Ga0207641_10000480
533 Ga0207641_10004471
534 Ga0207648_10053380
535 Ga0207648_10283611
536 Ga0207674_10030361
537 Ga0207698_10051907
538 Ga0207698_10463323
539 Ga0209282_1000304
540 Ga0209813_10067335
541 Ga0209974_10055206
542 Ga0268266_10005412
543 Ga0268266_10052426
544 Ga0268266_10358574
545 Ga0268265_10006056
546 Ga0268264_10000774
547 Ga0268264_10020220
548 Ga0268264_10142193
549 Ga0307517_10000058
550 Ga0307517_10144206
551 Ga0307515_10000692
552 Ga0307515_10277570
553 Ga0307511_10000066
554 Ga0307512_10022917
555 Ga0316179_1013011
556 Ga0316181_1240339
557 Ga0307513_10017660
558 Ga0307513_10064976
559 Ga0307513_10208607
560 Ga0307513_10545666
561 Ga0307509_10000003
562 Ga0307509_10000215
563 Ga0307509_10005753
564 Ga0307509_10049400
565 Ga0307509_10098522
566 Ga0307408_100134225
567 Ga0307508_10000909
568 Ga0307508_10045923
569 Ga0307508_10095273
570 Ga0307508_10160708
571 Ga0307514_10012243
572 Ga0307514_10113154
573 Ga0307514_10148012
574 Ga0316575_10011154
575 Ga0307516_10238558
576 Ga0307516_10238914
577 Ga0307406_10341464
578 Ga0307407_10433230
579 Ga0307416_100338194
580 Ga0307414_10069198
581 Ga0307411_10057394
582 Ga0307415_100254688
583 Ga0307510_10000001
584 Ga0307510_10006334
585 Ga0307510_10014225
586 Ga0307510_10054467
587 Ga0373932_0044015
588 Ga0373927_0361892
589 Ga0316582_0005533
590 Ga0395900_0095191
591 Ga0395898_0017081
592 Ga0395898_0030222
593 Ga0439436_0012630
594 Ga0439466_0016661
595 Ga0439432_020962
596 Ga0439449_0001524
597 Ga0450922_002899
598 Ga0450906_019850
599 Ga0439458_0066451
600 Ga0450909_029565
601 Ga0466959_0010129
602 Ga0466959_0018297
603 Ga0466959_0116975
604 Ga0466958_0267328
605 Ga0495592_0000173
606 Ga0495590_0021018
607 Ga0495638_0158231
608 Ga0495650_0007591
609 Ga0495650_0026726
610 Ga0495605_0041559
611 Ga0495620_0101521
612 Ga0495632_0014699
613 Ga0495648_0114106
614 Ga0495597_0006566
615 Ga0495625_0000012
616 Ga0495625_0064368
617 Ga0495671_0161190
618 Ga0495649_0011013
619 Ga0495660_0024909
620 Ga0495687_008714
621 Ga0495687_011099
622 Ga0495687_014177
623 Ga0495687_067387
624 Ga0495673_0074751
625 Ga0495686_0000902
626 Ga0495602_0189005
627 Ga0495626_0021502
628 Ga0496101_0027018
629 Ga0496102_0088067
630 Ga0496102_0131595
631 Ga0496112_0020656
632 Ga0496115_0102487
633 Ga0496116_0044013
634 Ga0496117_0000155
635 Ga0496118_0000066
636 Ga0496119_0000499
637 Ga0496119_0007750
638 Ga0496120_0000370
639 Ga0496120_0018632
640 Ga0496121_0000619
641 Ga0496121_0028740
642 Ga0496124_0016299
643 Ga0496124_0119914
644 Ga0496125_0000415
645 Ga0496125_0004890
646 Ga0496125_0017602
647 Ga0496125_0081371
648 Ga0496126_0010810
649 Ga0501036_0035889
650 Ga0501036_0182169
651 Ga0501038_0079175
652 Ga0501038_0088568
653 Ga0501039_0100000
654 Ga0501039_0382018
655 Ga0501040_0007523
656 Ga0501041_0042512
657 Ga0501042_0012635
658 Ga0501046_0020786
659 Ga0501048_0012708
660 Ga0501072_0014610
661 Ga0501074_0066551
662 Ga0501075_0000093
663 Ga0501076_0065653
664 Ga0501076_0147000
665 Ga0501077_0219530
666 Ga0501249_001312
667 Ga0501225_0047046
668 Ga0501079_0013896
669 Ga0501080_0028481
670 Ga0501080_0302619
671 Ga0501081_0117152
672 Ga0501081_0434918
673 Ga0501083_0016637
674 Ga0501262_000301
675 Ga0501280_000280
676 Ga0501282_000721
677 Ga0501035_0318160
678 Ga0501045_0037217
679 nmdc:mga03683_14463_c1
680 nmdc:mga03683_269302_c1
681 nmdc:mga03683_2859_c1
682 nmdc:mga03683_39240_c1
683 nmdc:mga03683_78835_c1
684 nmdc:mga03n38_10351_c1
685 nmdc:mga00v17_109066_c1
686 nmdc:mga0yw44_6645_c1
687 nmdc:mga0k408_21239_c1
688 nmdc:mga0k408_22223_c1
689 nmdc:mga0k408_236918_c1
690 nmdc:mga0k408_321291_c1
691 nmdc:mga0k408_35328_c1
692 nmdc:mga0k408_3923_c1
693 nmdc:mga0k408_63319_c1
694 nmdc:mga06z11_48814_c1
695 nmdc:mga04h51_17737_c1
696 nmdc:mga07m45_106668_c1
697 nmdc:mga07m45_201465_c1
698 nmdc:mga07m45_2210_c1
699 nmdc:mga07m45_22994_c1
700 nmdc:mga07m45_304562_c1
701 nmdc:mga07m45_33315_c2
702 nmdc:mga07m45_566_c1
703 nmdc:mga07m45_6640_c1
704 nmdc:mga07m45_7307_c1
705 nmdc:mga0n895_159012_c1
706 Ga0500578_0347200
707 Ga0500644_0002809
708 Ga0500583_0203791
709 Ga0500651_0048287
710 Ga0500651_0324249
711 Ga0500594_0016090
712 Ga0500658_0004673
713 Ga0500559_0000109
714 Ga0500604_0088105
715 Ga0500619_000098
716 Ga0500622_0004240
717 Ga0500633_0051675
718 Ga0500637_0086683
719 Ga0500637_0250994
720 Ga0501084_0135975
721 Ga0501082_0012625
722 Ga0466962_0202151
723 Ga0530510_0000686
724 2644455605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

6

200

0.89

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

194

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uav-assembly1.cif.gz_A crystal structure of cbby (at3g48420) from arabidobsis thaliana 0.9077 1 249
4uav-assembly1.cif.gz_A crystal structure of cbby (at3g48420) from arabidobsis thaliana 0.883 1 249
4rn3-assembly1.cif.gz_A crystal structure of a had-superfamily hydrolase, subfamily ia, variant 1 (gsu2069) from geobacter sulfurreducens pca at 2.15 a resolution 0.8529 3 199
3fm9-assembly1.cif.gz_A analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis 0.8248 1 219
3l5k-assembly1.cif.gz_A the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a) 0.8107 1 222
ID Description Score Start End Superfamily
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9751 100 216 3.40.50.1000
af_Q6ZDS0_185_318_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9666 100 249 3.40.50.1000
4uavA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9541 99 249 3.40.50.1000
af_Q6ZDS0_185_318_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9526 100 249 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9512 100 216 3.40.50.1000
ID Description Score Start End GO Terms
AF-I3SMI0-F1-model_v4 Uncharacterized protein 0.9758 109 253 GO:0016787
AF-A0A1Q5RTW4-F1-model_v4 Phosphatase 0.9745 102 220 GO:0016787
AF-A0A7R8ZWL1-F1-model_v4 Uncharacterized protein 0.9694 98 228 GO:0016787
AF-A0A6A6KY90-F1-model_v4 Mediator of RNA polymerase II transcription subunit 18 0.9563 2 252 GO:0016787
AF-A0A6N7I3L4-F1-model_v4 HAD-IA family hydrolase 0.9536 1 219 GO:0016787

Map