F422493

General Info

Members Datasets Scaffolds Average Seq Length
362 268 724 184

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100407855|Ga0070675_1004078552
Length 200
Sequence MARGSRADGAMNKPVALAIVAALACAAATAGFLAIRVLQPAGNEVATPARPVWTEAKWPFPVDQWGTGRAFNCKPSDCGTEVKLYLRAKLGSCNCTIGIADDADLDNMSDFDLVGGEVSPLGAGRPITIAWMKGRSRAYMIPPRNRLGKSVISVAFNDRCDMIVATVVLSHDRPATIEPGVMEFLNSRTILHWAEVALGI

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
208 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
209 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
210 2922368715
211 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
212 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
213 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
214 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
215 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
216 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
217 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
218 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
219 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
220 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
221 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
222 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
223 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
224 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
225 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
226 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
227 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
228 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
229 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
230 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
231 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
232 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
233 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
234 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
235 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
236 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
237 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
238 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
239 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
240 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
241 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
242 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
243 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
244 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
245 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
246 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
247 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
248 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
249 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
250 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
251 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
252 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
253 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
254 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
255 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
256 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
257 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
258 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
259 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
260 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
261 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
262 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
263 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
264 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
265 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
266 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
267 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
268 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.1
Metatranscriptomes 0
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 16.3
Rhizoplane 8.84
Rhizosphere 63.26
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100407855 3300005354 Unclassified 1213
2 JGI25404J52841_10001673 3300003659 Bacteria 3987
3 JGI25404J52841_10005982 3300003659 Bacteria 2529
4 Ga0070658_10584178 3300005327 Bacteria 968
5 Ga0070670_100653016 3300005331 Bacteria 944
6 Ga0070677_10063339 3300005333 Bacteria 1533
7 Ga0068869_100168649 3300005334 Bacteria 1709
8 Ga0070666_10064732 3300005335 Bacteria 2480
9 Ga0070666_10462803 3300005335 Bacteria 917
10 Ga0070682_100486657 3300005337 Bacteria 953
11 Ga0068868_100196673 3300005338 Bacteria 1679
12 Ga0070687_100125476 3300005343 Bacteria 1474
13 Ga0070668_100058328 3300005347 Bacteria 2986
14 Ga0070669_100266446 3300005353 Bacteria 1368
15 Ga0070675_100018004 3300005354 Bacteria 5622
16 Ga0070671_100113493 3300005355 Bacteria 2277
17 Ga0070671_100216599 3300005355 Bacteria 1624
18 Ga0070671_100425063 3300005355 Unclassified 1138
19 Ga0070674_100002845 3300005356 Bacteria 9566
20 Ga0070673_101002649 3300005364 Bacteria 778
21 Ga0070688_100363543 3300005365 Bacteria 1062
22 Ga0070688_100510774 3300005365 Bacteria 908
23 Ga0070667_100269911 3300005367 Unclassified 1525
24 Ga0070713_100412047 3300005436 Bacteria 1264
25 Ga0070710_10313747 3300005437 Bacteria 1027
26 Ga0070711_100260037 3300005439 Unclassified 1365
27 Ga0070694_101006541 3300005444 Bacteria 692
28 Ga0070663_100025428 3300005455 Bacteria 3997
29 Ga0070663_100285860 3300005455 Bacteria 1316
30 Ga0070662_100238014 3300005457 Bacteria 1459
31 Ga0070662_100264402 3300005457 Bacteria 1387
32 Ga0068867_100004801 3300005459 Bacteria 9514
33 Ga0068867_100724190 3300005459 Bacteria 880
34 Ga0070685_10073783 3300005466 Bacteria 2029
35 Ga0070685_10344139 3300005466 Bacteria 1017
36 Ga0070706_101042081 3300005467 Bacteria 754
37 Ga0070699_100002777 3300005518 Bacteria 15622
38 Ga0070672_100028407 3300005543 Bacteria 4184
39 Ga0070672_100564529 3300005543 Bacteria 989
40 Ga0070686_100426629 3300005544 Unclassified 1014
41 Ga0070665_100208764 3300005548 Bacteria 1953
42 Ga0068857_100715772 3300005577 Bacteria 952
43 Ga0068852_100851647 3300005616 Bacteria 927
44 Ga0068864_100310658 3300005618 Bacteria 1478
45 Ga0068866_10303507 3300005718 Bacteria 998
46 Ga0068866_10718796 3300005718 Bacteria 687
47 Ga0068861_100616721 3300005719 Bacteria 998
48 Ga0068858_100020898 3300005842 Bacteria 6117
49 Ga0068860_100103076 3300005843 Bacteria 2723
50 Ga0081538_10016395 3300005981 Bacteria 5684
51 Ga0081538_10019749 3300005981 Bacteria 4989
52 Ga0081540_1000238 3300005983 Bacteria 57732
53 Ga0081540_1000948 3300005983 Bacteria 26149
54 Ga0081540_1001435 3300005983 Bacteria 20610
55 Ga0081540_1007580 3300005983 Bacteria 7710
56 Ga0081540_1049537 3300005983 Bacteria 2095
57 Ga0081540_1065573 3300005983 Bacteria 1707
58 Ga0081540_1089982 3300005983 Bacteria 1352
59 Ga0075365_10006495 3300006038 Bacteria 6439
60 Ga0075365_10032538 3300006038 Bacteria 3353
61 Ga0075365_10171220 3300006038 Bacteria 1516
62 Ga0070712_100003417 3300006175 Bacteria 9769
63 Ga0070712_100254971 3300006175 Bacteria 1403
64 Ga0075362_10104290 3300006177 Bacteria 1329
65 Ga0075367_10145698 3300006178 Bacteria 1468
66 Ga0075367_10230200 3300006178 Bacteria 1161
67 Ga0075367_10335455 3300006178 Bacteria 953
68 Ga0097621_100695745 3300006237 Bacteria 936
69 Ga0075370_10045525 3300006353 Bacteria 2481
70 Ga0068871_100503584 3300006358 Bacteria 1092
71 Ga0075428_100033136 3300006844 Bacteria 5705
72 Ga0075428_100151787 3300006844 Bacteria 2517
73 Ga0075428_100498497 3300006844 Bacteria 1303
74 Ga0075430_100095379 3300006846 Bacteria 2486
75 Ga0075431_100005620 3300006847 Bacteria 12385
76 Ga0075429_100013839 3300006880 Bacteria 6997
77 Ga0075429_100025949 3300006880 Bacteria 5086
78 Ga0068865_100436221 3300006881 Bacteria 1080
79 Ga0075435_100287015 3300007076 Bacteria 1405
80 Ga0111539_10055152 3300009094 Bacteria 4724
81 Ga0111539_10106781 3300009094 Bacteria 3285
82 Ga0111539_11592775 3300009094 Bacteria 757
83 Ga0111539_11837002 3300009094 Unclassified 703
84 Ga0105247_10012123 3300009101 Bacteria 5182
85 Ga0114129_10011653 3300009147 Bacteria 12516
86 Ga0114129_10110051 3300009147 Bacteria 3803
87 Ga0114129_10252022 3300009147 Bacteria 2369
88 Ga0114129_10620822 3300009147 Bacteria 1398
89 Ga0105243_10444846 3300009148 Bacteria 1214
90 Ga0105243_10528431 3300009148 Bacteria 1123
91 Ga0105248_10126260 3300009177 Bacteria 2886
92 Ga0105248_10403985 3300009177 Bacteria 1538
93 Ga0105248_10940394 3300009177 Bacteria 976
94 Ga0105248_11515162 3300009177 Bacteria 759
95 Ga0105237_10179392 3300009545 Bacteria 2118
96 Ga0105249_10604952 3300009553 Bacteria 1151
97 Ga0105249_10679750 3300009553 Bacteria 1088
98 Ga0105239_10147323 3300010375 Bacteria 2627
99 Ga0105246_10611259 3300011119 Bacteria 943
100 Ga0157374_10036761 3300013296 Bacteria 4489
101 Ga0157374_10576578 3300013296 Bacteria 1134
102 Ga0157378_10240542 3300013297 Bacteria 1729
103 Ga0163162_10126877 3300013306 Bacteria 2658
104 Ga0157375_10035847 3300013308 Bacteria 4739
105 Ga0157375_11018803 3300013308 Bacteria 967
106 Ga0163163_10096586 3300014325 Bacteria 2975
107 Ga0157380_10073188 3300014326 Bacteria 2777
108 Ga0157380_10244342 3300014326 Bacteria 1620
109 Ga0157380_10275469 3300014326 Unclassified 1536
110 Ga0157380_10648211 3300014326 Bacteria 1053
111 Ga0182008_10102509 3300014497 Bacteria 1415
112 Ga0157379_11629058 3300014968 Bacteria 631
113 Ga0157376_10050901 3300014969 Bacteria 3438
114 Ga0157376_10135154 3300014969 Bacteria 2206
115 Ga0157376_11550146 3300014969 Unclassified 696
116 Ga0163161_10363579 3300017792 Bacteria 1153
117 Ga0207682_10005965 3300025893 Bacteria 4927
118 Ga0207692_10048608 3300025898 Bacteria 2136
119 Ga0207642_10082710 3300025899 Bacteria 1564
120 Ga0207710_10024078 3300025900 Bacteria 2620
121 Ga0207645_10082393 3300025907 Bacteria 2062
122 Ga0207645_10543432 3300025907 Bacteria 788
123 Ga0207684_10189791 3300025910 Bacteria 1772
124 Ga0207693_10012753 3300025915 Bacteria 6784
125 Ga0207693_10051211 3300025915 Bacteria 3241
126 Ga0207663_10224422 3300025916 Unclassified 1369
127 Ga0207650_10509629 3300025925 Bacteria 1006
128 Ga0207659_10037700 3300025926 Bacteria 3358
129 Ga0207659_10468503 3300025926 Unclassified 1063
130 Ga0207700_10429542 3300025928 Bacteria 1161
131 Ga0207706_10092433 3300025933 Bacteria 2660
132 Ga0207686_10336938 3300025934 Bacteria 1132
133 Ga0207709_11137886 3300025935 Unclassified 642
134 Ga0207669_10005101 3300025937 Bacteria 5849
135 Ga0207669_10134767 3300025937 Bacteria 1704
136 Ga0207691_10008109 3300025940 Bacteria 10084
137 Ga0207691_10394452 3300025940 Bacteria 1181
138 Ga0207689_10278137 3300025942 Bacteria 1386
139 Ga0207689_10445281 3300025942 Bacteria 1082
140 Ga0207651_10014033 3300025960 Bacteria 4611
141 Ga0207712_10264361 3300025961 Bacteria 1397
142 Ga0207668_10199998 3300025972 Bacteria 1590
143 Ga0207703_10036959 3300026035 Bacteria 3889
144 Ga0207678_10002762 3300026067 Bacteria 15886
145 Ga0207678_10046205 3300026067 Bacteria 3765
146 Ga0207678_10099204 3300026067 Bacteria 2488
147 Ga0207708_10091696 3300026075 Bacteria 2343
148 Ga0207648_10058464 3300026089 Bacteria 3362
149 Ga0207648_10101901 3300026089 Bacteria 2516
150 Ga0207675_100450829 3300026118 Bacteria 1275
151 Ga0207683_10054561 3300026121 Bacteria 3504
152 Ga0207698_10677963 3300026142 Bacteria 1024
153 Ga0207428_10040445 3300027907 Bacteria 3781
154 Ga0268266_10005360 3300028379 Bacteria 11983
155 Ga0268266_11083758 3300028379 Bacteria 775
156 Ga0268265_10525793 3300028380 Bacteria 1119
157 Ga0307515_10363595 3300028794 Bacteria 1087
158 Ga0307513_10067654 3300031456 Bacteria 3746
159 Ga0307513_10088855 3300031456 Bacteria 3157
160 Ga0307513_10263381 3300031456 Bacteria 1512
161 Ga0307513_10432429 3300031456 Bacteria 1044
162 Ga0307408_101092142 3300031548 Bacteria 740
163 Ga0307516_10512293 3300031730 Bacteria 854
164 Ga0307405_10457166 3300031731 Bacteria 1014
165 Ga0307405_10815889 3300031731 Bacteria 783
166 Ga0307406_10170220 3300031901 Bacteria 1576
167 Ga0307409_100357457 3300031995 Bacteria 1380
168 Ga0307409_100729740 3300031995 Unclassified 993
169 Ga0307415_100154778 3300032126 Bacteria 1769
170 Ga0307415_100290054 3300032126 Bacteria 1350
171 Ga0373947_0181364 3300035725 Bacteria 1371
172 Ga0436361_0963909 3300039447 Bacteria 1127
173 Ga0451797_0003948 3300041453 Bacteria 1163
174 Ga0451807_1621940 3300041486 Bacteria 782
175 Ga0451841_0739960 3300041498 Bacteria 889
176 Ga0451853_0614314 3300041512 Bacteria 980
177 Ga0451853_3670952 3300041512 Bacteria 1015
178 Ga0439437_013165 3300042000 Bacteria 960
179 Ga0439459_0007330 3300042438 Bacteria 1861
180 Ga0439464_0211485 3300042439 Bacteria 621
181 Ga0466963_0633551 3300044694 Unclassified 755
182 Ga0466957_0226155 3300044842 Unclassified 1237
183 Ga0466967_0292364 3300045976 Bacteria 1566
184 Ga0495617_064076 3300046452 Bacteria 1213
185 Ga0495603_0111045 3300046455 Bacteria 1599
186 Ga0495590_0022584 3300046457 Bacteria 2225
187 Ga0495629_0463761 3300046459 Bacteria 857
188 Ga0495638_0020743 3300046460 Bacteria 4338
189 Ga0495638_0054561 3300046460 Bacteria 2484
190 Ga0495650_0060440 3300046471 Bacteria 1522
191 Ga0495639_0048091 3300046475 Bacteria 1934
192 Ga0495584_0003902 3300046491 Bacteria 8065
193 Ga0495584_0167089 3300046491 Bacteria 1118
194 Ga0495585_0265989 3300046492 Bacteria 851
195 Ga0495594_0271265 3300046499 Bacteria 966
196 Ga0495583_0243213 3300046506 Bacteria 723
197 Ga0495606_0117274 3300046507 Bacteria 1598
198 Ga0495610_0234028 3300046512 Bacteria 736
199 Ga0495616_0062139 3300046513 Bacteria 1830
200 Ga0495620_0067184 3300046515 Bacteria 1476
201 Ga0495631_0033725 3300046518 Bacteria 2298
202 Ga0495632_0033645 3300046519 Bacteria 2629
203 Ga0495643_0268846 3300046522 Bacteria 789
204 Ga0495644_0007297 3300046523 Bacteria 4270
205 Ga0495648_0129560 3300046524 Bacteria 1343
206 Ga0495648_0161728 3300046524 Bacteria 1157
207 Ga0495663_0095072 3300046525 Bacteria 975
208 Ga0495666_0112722 3300046526 Bacteria 1277
209 Ga0495598_0007978 3300046537 Bacteria 2451
210 Ga0495598_0016534 3300046537 Bacteria 1884
211 Ga0495609_0070110 3300046538 Bacteria 1541
212 Ga0495621_0001124 3300046539 Bacteria 6902
213 Ga0495622_0001545 3300046557 Bacteria 11437
214 Ga0495668_0135721 3300046616 Bacteria 1347
215 Ga0495668_0492492 3300046616 Bacteria 675
216 Ga0495611_0201565 3300046648 Bacteria 928
217 Ga0495659_0019029 3300046664 Bacteria 2295
218 Ga0495661_0036173 3300046665 Bacteria 3094
219 Ga0495588_0008332 3300046674 Bacteria 4753
220 Ga0495669_0206972 3300046684 Bacteria 939
221 Ga0495671_0202250 3300046692 Bacteria 963
222 Ga0495649_0088397 3300046694 Bacteria 1653
223 Ga0495589_0146258 3300046794 Bacteria 1130
224 Ga0495660_0169903 3300046810 Bacteria 1063
225 Ga0495636_0036883 3300047318 Bacteria 2018
226 Ga0495676_0593711 3300047321 Bacteria 721
227 Ga0495683_0053506 3300047323 Bacteria 2013
228 Ga0495677_0269445 3300047445 Bacteria 667
229 Ga0495686_0154625 3300047472 Bacteria 1344
230 Ga0495615_0001580 3300048090 Bacteria 3427
231 Ga0495615_0090254 3300048090 Bacteria 853
232 Ga0496100_0051318 3300048903 Bacteria 2677
233 Ga0496100_0105008 3300048903 Bacteria 1953
234 Ga0496100_0232260 3300048903 Bacteria 1358
235 Ga0496101_0148577 3300048904 Unclassified 1791
236 Ga0496101_0671598 3300048904 Bacteria 818
237 Ga0496102_0053106 3300048905 Bacteria 3695
238 Ga0496102_0647476 3300048905 Bacteria 980
239 Ga0496103_0144200 3300048906 Bacteria 1524
240 Ga0496104_0016395 3300048907 Bacteria 6730
241 Ga0496104_0205932 3300048907 Bacteria 1879
242 Ga0496104_0207388 3300048907 Bacteria 1872
243 Ga0496105_0013777 3300048908 Bacteria 6421
244 Ga0496105_0155631 3300048908 Bacteria 1877
245 Ga0496105_0172850 3300048908 Bacteria 1771
246 Ga0496106_0044634 3300048909 Bacteria 3327
247 Ga0496107_0052884 3300048910 Bacteria 2930
248 Ga0496107_1057457 3300048910 Bacteria 587
249 Ga0496108_0555489 3300048911 Bacteria 1001
250 Ga0496109_0073362 3300048912 Bacteria 3145
251 Ga0496109_0108573 3300048912 Bacteria 2579
252 Ga0496109_0178988 3300048912 Bacteria 1991
253 Ga0496110_0052467 3300048913 Bacteria 3583
254 Ga0496110_0525986 3300048913 Bacteria 1076
255 Ga0496111_0063647 3300048914 Bacteria 2675
256 Ga0496112_0118283 3300048915 Bacteria 2620
257 Ga0496112_1254092 3300048915 Bacteria 657
258 Ga0496113_0391106 3300048916 Bacteria 1116
259 Ga0496114_0055211 3300048917 Bacteria 3313
260 Ga0496114_0101861 3300048917 Bacteria 2452
261 Ga0496115_0055805 3300048918 Bacteria 3174
262 Ga0496119_0312054 3300048922 Bacteria 772
263 Ga0496120_0168133 3300048923 Bacteria 1087
264 Ga0496121_0013048 3300048924 Bacteria 8974
265 Ga0496126_0248849 3300048929 Bacteria 1482
266 Ga0496126_0337038 3300048929 Bacteria 1236
267 Ga0496126_0354987 3300048929 Bacteria 1198
268 Ga0501041_0703626 3300049577 Bacteria 647
269 Ga0501041_0771500 3300049577 Bacteria 616
270 Ga0501075_0054538 3300049591 Unclassified 3007
271 Ga0501075_0289154 3300049591 Bacteria 1249
272 Ga0501079_0828746 3300049741 Bacteria 728
273 nmdc:mga0yw44_222852_c1 3300050492 Bacteria 1250
274 nmdc:mga0yw44_40665_c1 3300050492 Bacteria 2764
275 nmdc:mga0yw44_86268_c1 3300050492 Bacteria 1977
276 nmdc:mga0yw44_8811_c1 3300050492 Bacteria 5051
277 nmdc:mga06z11_204805_c1 3300050494 Bacteria 1147
278 nmdc:mga05p37_2522_c1 3300050507 Bacteria 21281
279 nmdc:mga05p37_61312_c1 3300050507 Bacteria 2214
280 nmdc:mga09592_168185_c1 3300050508 Bacteria 1895
281 nmdc:mga09592_8455_c1 3300050508 Bacteria 8369
282 nmdc:mga0qj67_36488_c1 3300050509 Bacteria 3846
283 nmdc:mga06r32_12082_c1 3300050510 Bacteria 7785
284 nmdc:mga06r32_4043_c1 3300050510 Bacteria 13150
285 nmdc:mga08y16_21392_c1 3300050511 Bacteria 6832
286 nmdc:mga08y16_88011_c1 3300050511 Bacteria 3236
287 nmdc:mga0a205_646226_c1 3300050515 Unclassified 909
288 nmdc:mga0sz30_129971_c1 3300050516 Bacteria 1109
289 nmdc:mga0sz30_21848_c1 3300050516 Bacteria 2593
290 Ga0495601_0231066 3300053077 Bacteria 1208
291 Ga0500651_0053832 3300053093 Bacteria 2524
292 Ga0500641_0016916 3300053096 Bacteria 2719
293 Ga0500650_0180669 3300053098 Bacteria 967
294 Ga0500595_025095 3300053119 Bacteria 2072
295 Ga0500589_080515 3300053147 Bacteria 1455
296 Ga0500604_0023304 3300053151 Bacteria 1765
297 Ga0500622_0159514 3300053156 Bacteria 1059
298 Ga0500634_0065013 3300053161 Bacteria 1926
299 Ga0500637_0102920 3300053178 Bacteria 1656
300 Ga0530510_0245146 3300061734 Bacteria 1335
301 2528854241 2528768022 Bacteria 10457665
302 2824666381 2824661429 Bacteria 9877870
303 2879100567 2879099564 Bacteria 10442239
304 2922376928
305 2929624088 2929615660 Bacteria 9193770
306 2929633404 2929624759 Bacteria 9339455
307 2932790121 2932784394 Bacteria 9704911
308 2932818098 2932809354 Bacteria 9135765
309 2932827932 2932818245 Bacteria 9955613
310 2932833423 2932828146 Bacteria 9745859
311 2933586126 2933577622 Bacteria 9116884
312 2935621303 2935616580 Bacteria 9032984
313 2935643376 2935638405 Bacteria 10015038
314 2935671301 2935665750 Bacteria 9571747
315 2935684176 2935675223 Bacteria 9928132
316 2935693394 2935684952 Bacteria 9590419
317 2935700139 2935694250 Bacteria 9291695
318 2935710651 2935703347 Bacteria 10242284
319 2935720817 2935713505 Bacteria 9608509
320 2935730696 2935722832 Bacteria 9608746
321 2935740539 2935732158 Bacteria 9706831
322 2935749987 2935741537 Bacteria 9707219
323 2935759193 2935750917 Bacteria 9590372
324 2935769611 2935760218 Bacteria 9817913
325 2935772357 2935769743 Bacteria 7878163
326 2935781308 2935777560 Bacteria 8077691
327 2935787808 2935785616 Bacteria 7962367
328 2935793635 2935793552 Bacteria 8012592
329 2935810411 2935801545 Bacteria 9301974
330 2935819681 2935810662 Bacteria 9401221
331 2935832899 2935827899 Bacteria 10038562
332 2935846762 2935837841 Bacteria 9454360
333 2935859504 2935855204 Bacteria 9035059
334 2935871432 2935864058 Bacteria 9784707
335 2935879175 2935873716 Bacteria 9632195
336 2935996818 2935992306 Bacteria 9802711
337 2936008694 2936002035 Bacteria 9362176
338 2936046416 2936037263 Bacteria 9446081
339 2940565281 2940556831 Bacteria 9590747
340 2941542767 2941538514 Bacteria 9402094
341 8006984567 8006984368 Bacteria 9651211
342 8016519674 8016511872 Bacteria 9921665
343 8016524686 8016522445 Bacteria 8156687
344 8016538253 8016530956 Bacteria 8155261
345 8016550741 8016548790 Bacteria 8155074
346 8016559157 8016557553 Bacteria 8154380
347 8016567920 8016566248 Bacteria 8158151
348 8016580603 8016575299 Bacteria 8154085
349 8016597111 8016595262 Bacteria 8149947
350 8016608023 8016603502 Bacteria 8731218
351 8016619804 8016613128 Bacteria 8794220
352 8016624402 8016622563 Bacteria 7999408
353 8017065857 8017057580 Bacteria 10023680
354 8019537924 8019530166 Bacteria 8155624
355 8019547231 8019538911 Bacteria 7872763
356 8019551423 8019547302 Bacteria 7996444
357 8019578795 8019576017 Bacteria 10049540
358 8019596836 8019586578 Bacteria 10212056
359 8019604850 8019597564 Bacteria 10041141
360 8019613680 8019608314 Bacteria 10042931
361 8055749828 8055742211 Bacteria 9226248
362 8056674404 8056673599 Bacteria 7871253
363 Ga0070675_100407855
364 JGI25404J52841_10001673
365 JGI25404J52841_10005982
366 Ga0070658_10584178
367 Ga0070670_100653016
368 Ga0070677_10063339
369 Ga0068869_100168649
370 Ga0070666_10064732
371 Ga0070666_10462803
372 Ga0070682_100486657
373 Ga0068868_100196673
374 Ga0070687_100125476
375 Ga0070668_100058328
376 Ga0070669_100266446
377 Ga0070675_100018004
378 Ga0070671_100113493
379 Ga0070671_100216599
380 Ga0070671_100425063
381 Ga0070674_100002845
382 Ga0070673_101002649
383 Ga0070688_100363543
384 Ga0070688_100510774
385 Ga0070667_100269911
386 Ga0070713_100412047
387 Ga0070710_10313747
388 Ga0070711_100260037
389 Ga0070694_101006541
390 Ga0070663_100025428
391 Ga0070663_100285860
392 Ga0070662_100238014
393 Ga0070662_100264402
394 Ga0068867_100004801
395 Ga0068867_100724190
396 Ga0070685_10073783
397 Ga0070685_10344139
398 Ga0070706_101042081
399 Ga0070699_100002777
400 Ga0070672_100028407
401 Ga0070672_100564529
402 Ga0070686_100426629
403 Ga0070665_100208764
404 Ga0068857_100715772
405 Ga0068852_100851647
406 Ga0068864_100310658
407 Ga0068866_10303507
408 Ga0068866_10718796
409 Ga0068861_100616721
410 Ga0068858_100020898
411 Ga0068860_100103076
412 Ga0081538_10016395
413 Ga0081538_10019749
414 Ga0081540_1000238
415 Ga0081540_1000948
416 Ga0081540_1001435
417 Ga0081540_1007580
418 Ga0081540_1049537
419 Ga0081540_1065573
420 Ga0081540_1089982
421 Ga0075365_10006495
422 Ga0075365_10032538
423 Ga0075365_10171220
424 Ga0070712_100003417
425 Ga0070712_100254971
426 Ga0075362_10104290
427 Ga0075367_10145698
428 Ga0075367_10230200
429 Ga0075367_10335455
430 Ga0097621_100695745
431 Ga0075370_10045525
432 Ga0068871_100503584
433 Ga0075428_100033136
434 Ga0075428_100151787
435 Ga0075428_100498497
436 Ga0075430_100095379
437 Ga0075431_100005620
438 Ga0075429_100013839
439 Ga0075429_100025949
440 Ga0068865_100436221
441 Ga0075435_100287015
442 Ga0111539_10055152
443 Ga0111539_10106781
444 Ga0111539_11592775
445 Ga0111539_11837002
446 Ga0105247_10012123
447 Ga0114129_10011653
448 Ga0114129_10110051
449 Ga0114129_10252022
450 Ga0114129_10620822
451 Ga0105243_10444846
452 Ga0105243_10528431
453 Ga0105248_10126260
454 Ga0105248_10403985
455 Ga0105248_10940394
456 Ga0105248_11515162
457 Ga0105237_10179392
458 Ga0105249_10604952
459 Ga0105249_10679750
460 Ga0105239_10147323
461 Ga0105246_10611259
462 Ga0157374_10036761
463 Ga0157374_10576578
464 Ga0157378_10240542
465 Ga0163162_10126877
466 Ga0157375_10035847
467 Ga0157375_11018803
468 Ga0163163_10096586
469 Ga0157380_10073188
470 Ga0157380_10244342
471 Ga0157380_10275469
472 Ga0157380_10648211
473 Ga0182008_10102509
474 Ga0157379_11629058
475 Ga0157376_10050901
476 Ga0157376_10135154
477 Ga0157376_11550146
478 Ga0163161_10363579
479 Ga0207682_10005965
480 Ga0207692_10048608
481 Ga0207642_10082710
482 Ga0207710_10024078
483 Ga0207645_10082393
484 Ga0207645_10543432
485 Ga0207684_10189791
486 Ga0207693_10012753
487 Ga0207693_10051211
488 Ga0207663_10224422
489 Ga0207650_10509629
490 Ga0207659_10037700
491 Ga0207659_10468503
492 Ga0207700_10429542
493 Ga0207706_10092433
494 Ga0207686_10336938
495 Ga0207709_11137886
496 Ga0207669_10005101
497 Ga0207669_10134767
498 Ga0207691_10008109
499 Ga0207691_10394452
500 Ga0207689_10278137
501 Ga0207689_10445281
502 Ga0207651_10014033
503 Ga0207712_10264361
504 Ga0207668_10199998
505 Ga0207703_10036959
506 Ga0207678_10002762
507 Ga0207678_10046205
508 Ga0207678_10099204
509 Ga0207708_10091696
510 Ga0207648_10058464
511 Ga0207648_10101901
512 Ga0207675_100450829
513 Ga0207683_10054561
514 Ga0207698_10677963
515 Ga0207428_10040445
516 Ga0268266_10005360
517 Ga0268266_11083758
518 Ga0268265_10525793
519 Ga0307515_10363595
520 Ga0307513_10067654
521 Ga0307513_10088855
522 Ga0307513_10263381
523 Ga0307513_10432429
524 Ga0307408_101092142
525 Ga0307516_10512293
526 Ga0307405_10457166
527 Ga0307405_10815889
528 Ga0307406_10170220
529 Ga0307409_100357457
530 Ga0307409_100729740
531 Ga0307415_100154778
532 Ga0307415_100290054
533 Ga0373947_0181364
534 Ga0436361_0963909
535 Ga0451797_0003948
536 Ga0451807_1621940
537 Ga0451841_0739960
538 Ga0451853_0614314
539 Ga0451853_3670952
540 Ga0439437_013165
541 Ga0439459_0007330
542 Ga0439464_0211485
543 Ga0466963_0633551
544 Ga0466957_0226155
545 Ga0466967_0292364
546 Ga0495617_064076
547 Ga0495603_0111045
548 Ga0495590_0022584
549 Ga0495629_0463761
550 Ga0495638_0020743
551 Ga0495638_0054561
552 Ga0495650_0060440
553 Ga0495639_0048091
554 Ga0495584_0003902
555 Ga0495584_0167089
556 Ga0495585_0265989
557 Ga0495594_0271265
558 Ga0495583_0243213
559 Ga0495606_0117274
560 Ga0495610_0234028
561 Ga0495616_0062139
562 Ga0495620_0067184
563 Ga0495631_0033725
564 Ga0495632_0033645
565 Ga0495643_0268846
566 Ga0495644_0007297
567 Ga0495648_0129560
568 Ga0495648_0161728
569 Ga0495663_0095072
570 Ga0495666_0112722
571 Ga0495598_0007978
572 Ga0495598_0016534
573 Ga0495609_0070110
574 Ga0495621_0001124
575 Ga0495622_0001545
576 Ga0495668_0135721
577 Ga0495668_0492492
578 Ga0495611_0201565
579 Ga0495659_0019029
580 Ga0495661_0036173
581 Ga0495588_0008332
582 Ga0495669_0206972
583 Ga0495671_0202250
584 Ga0495649_0088397
585 Ga0495589_0146258
586 Ga0495660_0169903
587 Ga0495636_0036883
588 Ga0495676_0593711
589 Ga0495683_0053506
590 Ga0495677_0269445
591 Ga0495686_0154625
592 Ga0495615_0001580
593 Ga0495615_0090254
594 Ga0496100_0051318
595 Ga0496100_0105008
596 Ga0496100_0232260
597 Ga0496101_0148577
598 Ga0496101_0671598
599 Ga0496102_0053106
600 Ga0496102_0647476
601 Ga0496103_0144200
602 Ga0496104_0016395
603 Ga0496104_0205932
604 Ga0496104_0207388
605 Ga0496105_0013777
606 Ga0496105_0155631
607 Ga0496105_0172850
608 Ga0496106_0044634
609 Ga0496107_0052884
610 Ga0496107_1057457
611 Ga0496108_0555489
612 Ga0496109_0073362
613 Ga0496109_0108573
614 Ga0496109_0178988
615 Ga0496110_0052467
616 Ga0496110_0525986
617 Ga0496111_0063647
618 Ga0496112_0118283
619 Ga0496112_1254092
620 Ga0496113_0391106
621 Ga0496114_0055211
622 Ga0496114_0101861
623 Ga0496115_0055805
624 Ga0496119_0312054
625 Ga0496120_0168133
626 Ga0496121_0013048
627 Ga0496126_0248849
628 Ga0496126_0337038
629 Ga0496126_0354987
630 Ga0501041_0703626
631 Ga0501041_0771500
632 Ga0501075_0054538
633 Ga0501075_0289154
634 Ga0501079_0828746
635 nmdc:mga0yw44_222852_c1
636 nmdc:mga0yw44_40665_c1
637 nmdc:mga0yw44_86268_c1
638 nmdc:mga0yw44_8811_c1
639 nmdc:mga06z11_204805_c1
640 nmdc:mga05p37_2522_c1
641 nmdc:mga05p37_61312_c1
642 nmdc:mga09592_168185_c1
643 nmdc:mga09592_8455_c1
644 nmdc:mga0qj67_36488_c1
645 nmdc:mga06r32_12082_c1
646 nmdc:mga06r32_4043_c1
647 nmdc:mga08y16_21392_c1
648 nmdc:mga08y16_88011_c1
649 nmdc:mga0a205_646226_c1
650 nmdc:mga0sz30_129971_c1
651 nmdc:mga0sz30_21848_c1
652 Ga0495601_0231066
653 Ga0500651_0053832
654 Ga0500641_0016916
655 Ga0500650_0180669
656 Ga0500595_025095
657 Ga0500589_080515
658 Ga0500604_0023304
659 Ga0500622_0159514
660 Ga0500634_0065013
661 Ga0500637_0102920
662 Ga0530510_0245146
663 2528854241
664 2824666381
665 2879100567
666 2922376928
667 2929624088
668 2929633404
669 2932790121
670 2932818098
671 2932827932
672 2932833423
673 2933586126
674 2935621303
675 2935643376
676 2935671301
677 2935684176
678 2935693394
679 2935700139
680 2935710651
681 2935720817
682 2935730696
683 2935740539
684 2935749987
685 2935759193
686 2935769611
687 2935772357
688 2935781308
689 2935787808
690 2935793635
691 2935810411
692 2935819681
693 2935832899
694 2935846762
695 2935859504
696 2935871432
697 2935879175
698 2935996818
699 2936008694
700 2936046416
701 2940565281
702 2941542767
703 8006984567
704 8016519674
705 8016524686
706 8016538253
707 8016550741
708 8016559157
709 8016567920
710 8016580603
711 8016597111
712 8016608023
713 8016619804
714 8016624402
715 8017065857
716 8019537924
717 8019547231
718 8019551423
719 8019578795
720 8019596836
721 8019604850
722 8019613680
723 8055749828
724 8056674404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s2m-assembly1.cif.gz_D crystal structure of oxa-163 complexed with iodide in the active site 0.6939 118 177
4s2m-assembly2.cif.gz_C crystal structure of oxa-163 complexed with iodide in the active site 0.6785 110 177
6hoo-assembly1.cif.gz_B crystal structure of rationally designed oxa-48loop18 beta-lactamase 0.6668 118 172
1v2b-assembly2.cif.gz_B crystal structure of psbp protein in the oxygen-evolving complex of photosystem ii from higher plants 0.6651 40 159
5odz-assembly1.cif.gz_B crystal structure of the beta-lactamase oxa-163 0.6623 110 172
ID Description Score Start End Superfamily
af_Q9VT82_21_245_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.6655 135 161 3.40.33.10
1v2bB00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6651 40 159 3.40.1000.10
af_Q2QYK0_24_97_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.6561 103 155 2.20.25.80
af_A4HSR5_7_149_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6557 41 172 3.40.1000.10
af_A0A0P0WJL0_129_210_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.6496 103 156 2.20.25.80
ID Description Score Start End GO Terms
AF-H5YKG6-F1-model_v4 Uncharacterized protein 0.9749 39 187
AF-H5YKG6-F1-model_v4 Uncharacterized protein 0.9683 39 187
AF-A0A537KWY6-F1-model_v4 Uncharacterized protein 0.9458 37 187
AF-A0A0D7QEZ0-F1-model_v4 Uncharacterized protein 0.9285 26 187
AF-B8IQI5-F1-model_v4 Uncharacterized protein 0.9103 26 187

Map