F422346

General Info

Members Datasets Scaffolds Average Seq Length
361 226 722 154

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0040834|Ga0495645_0040834_830_1273
Length 147
Sequence MTGRLNVGDKVEDFTLPDETGAARSLTELLTEGPVVLFFYPAALSAGCTAEACHFRDLAAEFAAVGARPVKQQEFAGKHTLGMPLLSDADGTIRERFGVKRGFSLAPTKRATFVIGEDRTILEVVSSELRMNTHADRALAALRAHRK

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
22 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
28 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
29 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
59 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
60 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
61 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
184 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
187 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
190 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
191 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
192 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
193 2643221647 Streptomyces sp. Root369 Isolate Unclassified
194 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
195 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
196 2643221714 Streptomyces sp. Root264 Isolate Unclassified
197 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
198 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
199 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
200 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
201 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
202 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
203 2862574272 Streptomyces sp. AcE210 Isolate Nodule
204 2867428634 Streptomyces sp. RP5T Isolate Unclassified
205 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
206 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
207 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
208 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
209 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
210 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
211 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
212 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
213 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
214 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
218 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
219 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
220 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
221 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
222 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
223 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
224 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
225 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
226 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.2
Metatranscriptomes 0.28
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.99
Nodule 0.28
Rhizoplane 0.83
Rhizosphere 78.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0040834 3300046543 Bacteria 3383
2 JGI24739J22299_10020329 3300001989 Bacteria 2372
3 JGI24735J21928_10063584 3300002067 Bacteria 1059
4 JGI24738J21930_10112348 3300002075 Bacteria 587
5 rootH2_10037733 3300003320 Bacteria 8105
6 rootL2_10077258 3300003322 Bacteria 5256
7 rootH1_10002244 3300003323 Bacteria 12088
8 rootH1_10033086 3300003323 Bacteria 5932
9 rootH1_10037601 3300003323 Bacteria 4104
10 Ga0006562J51391_1091897 3300003578 Bacteria 1770
11 Ga0070683_101368596 3300005329 Bacteria 680
12 Ga0070698_101061057 3300005471 Bacteria 758
13 Ga0070679_100865955 3300005530 Bacteria 847
14 Ga0068855_100066324 3300005563 Bacteria 4208
15 Ga0070664_100030335 3300005564 Bacteria 4511
16 Ga0068857_100695614 3300005577 Bacteria 966
17 Ga0068856_100079941 3300005614 Bacteria 3243
18 Ga0081539_10000254 3300005985 Bacteria 123532
19 Ga0075363_100016180 3300006048 Bacteria 3681
20 Ga0075363_100520004 3300006048 Bacteria 708
21 Ga0075367_10000602 3300006178 Bacteria 13819
22 Ga0075429_100093589 3300006880 Bacteria 2621
23 Ga0105251_10053834 3300009011 Bacteria 1912
24 Ga0105033_101473 3300009986 Bacteria 1925
25 Ga0105028_122216 3300009993 Bacteria 691
26 Ga0157372_10511954 3300013307 Bacteria 1399
27 Ga0182008_10009383 3300014497 Bacteria 5284
28 Ga0182006_1022392 3300015261 Bacteria 2627
29 Ga0182007_10000163 3300015262 Bacteria 46066
30 Ga0182005_1024804 3300015265 Bacteria 1637
31 Ga0183367_1012 3300015688 Bacteria 347438
32 Ga0207713_1074775 3300025735 Bacteria 1238
33 Ga0207647_10004105 3300025904 Bacteria 10809
34 Ga0207652_10771664 3300025921 Bacteria 855
35 Ga0207679_10539278 3300025945 Bacteria 1045
36 Ga0207667_10051213 3300025949 Bacteria 4354
37 Ga0207639_10079777 3300026041 Bacteria 2588
38 Ga0207702_10931310 3300026078 Bacteria 861
39 Ga0207674_10692995 3300026116 Bacteria 983
40 Ga0209371_1016597 3300027312 Bacteria 1935
41 Ga0209813_10034063 3300027866 Bacteria 1518
42 Ga0307517_10059896 3300028786 Bacteria 3636
43 Ga0307515_10000787 3300028794 Bacteria 73140
44 Ga0307515_10060979 3300028794 Bacteria 5364
45 Ga0307515_10353577 3300028794 Bacteria 1114
46 Ga0268256_1018448 3300030500 Bacteria 1935
47 Ga0307511_10002825 3300030521 Bacteria 18039
48 Ga0307511_10104553 3300030521 Bacteria 1838
49 Ga0307511_10232861 3300030521 Bacteria 909
50 Ga0265316_10565088 3300031344 Bacteria 809
51 Ga0307513_10002153 3300031456 Bacteria 27557
52 Ga0307513_10056380 3300031456 Bacteria 4195
53 Ga0307513_10109923 3300031456 Bacteria 2753
54 Ga0307509_10061249 3300031507 Bacteria 3974
55 Ga0307508_10002009 3300031616 Bacteria 22192
56 Ga0307508_10024655 3300031616 Bacteria 5458
57 Ga0307508_10043536 3300031616 Bacteria 4021
58 Ga0307514_10001855 3300031649 Bacteria 23367
59 Ga0307514_10144472 3300031649 Bacteria 1610
60 Ga0307514_10371298 3300031649 Bacteria 749
61 Ga0307516_10009196 3300031730 Bacteria 11061
62 Ga0307516_10057371 3300031730 Bacteria 3793
63 Ga0307516_10179088 3300031730 Bacteria 1855
64 Ga0307413_10024191 3300031824 Bacteria 3307
65 Ga0307413_10300633 3300031824 Bacteria 1217
66 Ga0307413_10937566 3300031824 Bacteria 738
67 Ga0307518_10161548 3300031838 Bacteria 1538
68 Ga0307518_10287523 3300031838 Bacteria 1011
69 Ga0307518_10381881 3300031838 Bacteria 798
70 Ga0307518_10456831 3300031838 Bacteria 680
71 Ga0307409_101407566 3300031995 Bacteria 724
72 Ga0307507_10005137 3300033179 Bacteria 21932
73 Ga0307507_10006988 3300033179 Bacteria 16763
74 Ga0307510_10045708 3300033180 Bacteria 4720
75 Ga0307510_10046610 3300033180 Bacteria 4657
76 Ga0307510_10161596 3300033180 Bacteria 1835
77 Ga0307510_10181063 3300033180 Bacteria 1670
78 Ga0395900_0136801 3300037418 Bacteria 2510
79 Ga0395900_0524369 3300037418 Bacteria 1132
80 Ga0395898_0001645 3300037466 Bacteria 30199
81 Ga0395898_0559165 3300037466 Bacteria 1086
82 Ga0395905_0736972 3300037471 Bacteria 888
83 Ga0395901_0286998 3300038443 Bacteria 1709
84 Ga0395901_1047508 3300038443 Bacteria 789
85 Ga0451791_0121941 3300041451 Bacteria 1153
86 Ga0451800_0079487 3300041459 Bacteria 566
87 Ga0451849_0901507 3300041505 Bacteria 585
88 Ga0451843_0327070 3300041509 Bacteria 696
89 Ga0451853_1619563 3300041512 Bacteria 3668
90 Ga0451853_3016896 3300041512 Bacteria 846
91 Ga0451853_4040671 3300041512 Bacteria 1046
92 Ga0439448_0011668 3300042005 Bacteria 2620
93 Ga0439449_0002884 3300042007 Bacteria 6688
94 Ga0439455_0031891 3300042012 Bacteria 1314
95 Ga0450903_006139 3300042138 Bacteria 2005
96 Ga0439458_0000484 3300042157 Bacteria 10197
97 Ga0466972_0012651 3300044658 Bacteria 4239
98 Ga0466972_0013311 3300044658 Bacteria 4130
99 Ga0466972_0015040 3300044658 Bacteria 3870
100 Ga0466972_0024013 3300044658 Bacteria 3027
101 Ga0466972_0190612 3300044658 Bacteria 961
102 Ga0466965_0000579 3300044683 Bacteria 13286
103 Ga0466965_0440442 3300044683 Bacteria 724
104 Ga0466966_0001877 3300044684 Bacteria 13634
105 Ga0466966_0139338 3300044684 Bacteria 1483
106 Ga0466966_0651045 3300044684 Bacteria 635
107 Ga0466961_0001296 3300044693 Bacteria 15426
108 Ga0466961_0132781 3300044693 Bacteria 1560
109 Ga0466963_0002931 3300044694 Bacteria 9647
110 Ga0466964_0003247 3300044706 Bacteria 5914
111 Ga0466971_0002402 3300044719 Bacteria 7904
112 Ga0466971_0005686 3300044719 Bacteria 5421
113 Ga0466970_0000569 3300044765 Bacteria 18059
114 Ga0466970_0000840 3300044765 Bacteria 14784
115 Ga0466957_0000726 3300044842 Bacteria 16888
116 Ga0466960_0011740 3300044901 Bacteria 3677
117 Ga0466960_0040863 3300044901 Bacteria 2195
118 Ga0466960_0390199 3300044901 Bacteria 800
119 Ga0466959_0000770 3300045049 Bacteria 18762
120 Ga0466958_0000341 3300045836 Bacteria 18634
121 Ga0466958_0801056 3300045836 Bacteria 614
122 Ga0466967_0008670 3300045976 Bacteria 7479
123 Ga0466967_0780695 3300045976 Bacteria 948
124 Ga0495617_005681 3300046452 Bacteria 4410
125 Ga0495592_0006523 3300046454 Bacteria 8694
126 Ga0495592_0322943 3300046454 Bacteria 997
127 Ga0495603_0007935 3300046455 Bacteria 6406
128 Ga0495603_0021502 3300046455 Bacteria 3907
129 Ga0495603_0177864 3300046455 Bacteria 1231
130 Ga0495603_0356903 3300046455 Bacteria 838
131 Ga0495629_0033917 3300046459 Bacteria 3609
132 Ga0495629_0114807 3300046459 Bacteria 1876
133 Ga0495629_0138281 3300046459 Bacteria 1695
134 Ga0495629_0323415 3300046459 Bacteria 1054
135 Ga0495638_0060646 3300046460 Bacteria 2339
136 Ga0495638_0111912 3300046460 Bacteria 1621
137 Ga0495638_0126336 3300046460 Bacteria 1507
138 Ga0495651_0001073 3300046462 Bacteria 21056
139 Ga0495580_0410350 3300046472 Bacteria 912
140 Ga0495582_0035873 3300046473 Bacteria 2728
141 Ga0495605_0002792 3300046474 Bacteria 10622
142 Ga0495605_0023216 3300046474 Bacteria 3265
143 Ga0495605_0101146 3300046474 Bacteria 1325
144 Ga0495639_0033293 3300046475 Bacteria 2301
145 Ga0495662_0023178 3300046476 Bacteria 2998
146 Ga0495662_0028739 3300046476 Bacteria 2684
147 Ga0495662_0038946 3300046476 Bacteria 2297
148 Ga0495664_0001523 3300046477 Bacteria 12267
149 Ga0495584_0357424 3300046491 Bacteria 742
150 Ga0495585_0149409 3300046492 Bacteria 1219
151 Ga0495585_0160825 3300046492 Bacteria 1165
152 Ga0495594_0007139 3300046499 Bacteria 5748
153 Ga0495594_0010879 3300046499 Bacteria 4725
154 Ga0495594_0020786 3300046499 Bacteria 3499
155 Ga0495596_0050432 3300046500 Bacteria 1631
156 Ga0495607_0061354 3300046501 Bacteria 2136
157 Ga0495583_0061934 3300046506 Bacteria 1667
158 Ga0495583_0085693 3300046506 Bacteria 1363
159 Ga0495583_0382759 3300046506 Bacteria 553
160 Ga0495606_0020595 3300046507 Bacteria 4855
161 Ga0495608_0102067 3300046511 Bacteria 1849
162 Ga0495610_0243775 3300046512 Bacteria 715
163 Ga0495616_0050843 3300046513 Bacteria 2070
164 Ga0495620_0001968 3300046515 Bacteria 12024
165 Ga0495620_0028722 3300046515 Bacteria 2582
166 Ga0495620_0084307 3300046515 Bacteria 1282
167 Ga0495620_0158555 3300046515 Bacteria 880
168 Ga0495628_0039109 3300046516 Bacteria 3795
169 Ga0495628_0202407 3300046516 Bacteria 1495
170 Ga0495631_0136965 3300046518 Bacteria 1051
171 Ga0495637_0128405 3300046520 Bacteria 970
172 Ga0495643_0002682 3300046522 Bacteria 13756
173 Ga0495644_0132495 3300046523 Bacteria 950
174 Ga0495648_0096002 3300046524 Bacteria 1648
175 Ga0495648_0183760 3300046524 Bacteria 1060
176 Ga0495648_0295805 3300046524 Bacteria 761
177 Ga0495666_0016680 3300046526 Bacteria 3656
178 Ga0495666_0363137 3300046526 Bacteria 652
179 Ga0495642_0040619 3300046528 Bacteria 1890
180 Ga0495642_0057697 3300046528 Bacteria 1606
181 Ga0495652_0250957 3300046529 Bacteria 1311
182 Ga0495654_0073946 3300046530 Bacteria 1611
183 Ga0495640_0002152 3300046533 Bacteria 15737
184 Ga0495587_0002300 3300046536 Bacteria 12796
185 Ga0495587_0116140 3300046536 Bacteria 1535
186 Ga0495609_0046562 3300046538 Bacteria 1942
187 Ga0495597_0024095 3300046542 Bacteria 2811
188 Ga0495597_0267418 3300046542 Bacteria 668
189 Ga0495622_0107074 3300046557 Bacteria 1280
190 Ga0495622_0191913 3300046557 Bacteria 913
191 Ga0495633_0016765 3300046558 Bacteria 3767
192 Ga0495633_0158776 3300046558 Bacteria 1043
193 Ga0495667_0236246 3300046559 Bacteria 1165
194 Ga0495667_0514757 3300046559 Bacteria 749
195 Ga0495668_0129518 3300046616 Bacteria 1381
196 Ga0495634_0008879 3300046642 Bacteria 7450
197 Ga0495634_0158117 3300046642 Bacteria 1430
198 Ga0495611_0091056 3300046648 Bacteria 1409
199 Ga0495625_0004172 3300046660 Bacteria 13773
200 Ga0495625_0338105 3300046660 Bacteria 955
201 Ga0495635_0003725 3300046663 Bacteria 10580
202 Ga0495661_0437823 3300046665 Bacteria 631
203 Ga0495588_0016635 3300046674 Bacteria 3556
204 Ga0495588_0159926 3300046674 Bacteria 1191
205 Ga0495588_0196796 3300046674 Bacteria 1064
206 Ga0495588_0513867 3300046674 Bacteria 628
207 Ga0495657_0000085 3300046675 Bacteria 82569
208 Ga0495657_0008370 3300046675 Bacteria 7919
209 Ga0495657_0044828 3300046675 Bacteria 3004
210 Ga0495657_0126696 3300046675 Bacteria 1603
211 Ga0495623_0275896 3300046679 Bacteria 937
212 Ga0495646_0000196 3300046680 Bacteria 30156
213 Ga0495658_0039616 3300046683 Bacteria 2615
214 Ga0495613_0000273 3300046689 Bacteria 48007
215 Ga0495613_0009089 3300046689 Bacteria 7370
216 Ga0495613_0042291 3300046689 Bacteria 3372
217 Ga0495624_0059373 3300046690 Bacteria 2400
218 Ga0495624_0356594 3300046690 Bacteria 879
219 Ga0495671_0002101 3300046692 Bacteria 12734
220 Ga0495589_0004685 3300046794 Bacteria 7266
221 Ga0495589_0019525 3300046794 Bacteria 3473
222 Ga0495589_0020793 3300046794 Bacteria 3355
223 Ga0495589_0146781 3300046794 Bacteria 1127
224 Ga0495589_0253076 3300046794 Bacteria 822
225 Ga0495589_0335573 3300046794 Bacteria 697
226 Ga0495600_0018082 3300046809 Bacteria 4488
227 Ga0495600_0070028 3300046809 Bacteria 2292
228 Ga0495600_0094398 3300046809 Bacteria 1951
229 Ga0495660_0279899 3300046810 Bacteria 763
230 Ga0495660_0407443 3300046810 Bacteria 594
231 Ga0495581_0026886 3300047315 Bacteria 3336
232 Ga0495581_0033980 3300047315 Bacteria 2951
233 Ga0495581_0146053 3300047315 Bacteria 1380
234 Ga0495604_0018995 3300047317 Bacteria 5503
235 Ga0495604_0189416 3300047317 Bacteria 1434
236 Ga0495636_0037691 3300047318 Bacteria 1997
237 Ga0495636_0404763 3300047318 Bacteria 650
238 Ga0495674_0087968 3300047319 Bacteria 2658
239 Ga0495674_0207988 3300047319 Bacteria 1621
240 Ga0495672_0334372 3300047320 Bacteria 708
241 Ga0495676_0011172 3300047321 Bacteria 8114
242 Ga0495676_0011789 3300047321 Bacteria 7885
243 Ga0495676_0088813 3300047321 Bacteria 2316
244 Ga0495680_0009841 3300047322 Bacteria 8570
245 Ga0495683_0063871 3300047323 Bacteria 1819
246 Ga0495687_000735 3300047443 Bacteria 35916
247 Ga0495687_001037 3300047443 Bacteria 27583
248 Ga0495687_004594 3300047443 Bacteria 9236
249 Ga0495687_043269 3300047443 Bacteria 1963
250 Ga0495687_057814 3300047443 Bacteria 1611
251 Ga0495687_089572 3300047443 Bacteria 1181
252 Ga0495675_0009240 3300047444 Bacteria 6132
253 Ga0495675_0090645 3300047444 Bacteria 1919
254 Ga0495675_0114006 3300047444 Bacteria 1686
255 Ga0495677_0195728 3300047445 Bacteria 785
256 Ga0495685_003323 3300047447 Bacteria 5117
257 Ga0495685_009042 3300047447 Bacteria 3321
258 Ga0495685_010785 3300047447 Bacteria 3071
259 Ga0495685_019085 3300047447 Bacteria 2354
260 Ga0495685_033582 3300047447 Bacteria 1762
261 Ga0495685_035674 3300047447 Bacteria 1708
262 Ga0495681_0000905 3300047470 Bacteria 22871
263 Ga0495681_0109747 3300047470 Bacteria 1196
264 Ga0495681_0253954 3300047470 Bacteria 693
265 Ga0495684_0588810 3300047471 Bacteria 752
266 Ga0495686_0028856 3300047472 Bacteria 3612
267 Ga0495686_0135722 3300047472 Bacteria 1455
268 Ga0495686_0199782 3300047472 Bacteria 1148
269 Ga0495686_0290099 3300047472 Bacteria 906
270 Ga0495593_0000322 3300047673 Bacteria 26524
271 Ga0495593_0013366 3300047673 Bacteria 4684
272 Ga0495593_0453123 3300047673 Bacteria 642
273 Ga0495602_0033740 3300048088 Bacteria 4797
274 Ga0495614_0008061 3300048089 Bacteria 4681
275 Ga0495614_0040690 3300048089 Bacteria 1994
276 Ga0495614_0069625 3300048089 Bacteria 1515
277 Ga0495614_0157776 3300048089 Bacteria 1014
278 Ga0495614_0397418 3300048089 Bacteria 647
279 Ga0495626_0037208 3300048091 Bacteria 2314
280 Ga0496109_0044931 3300048912 Bacteria 4008
281 Ga0495678_043314 3300049459 Bacteria 1788
282 Ga0495678_091810 3300049459 Bacteria 1068
283 Ga0501031_0098233 3300049568 Bacteria 1911
284 Ga0501032_0231647 3300049569 Bacteria 1201
285 Ga0501034_0166679 3300049571 Bacteria 2171
286 Ga0501034_1022427 3300049571 Bacteria 710
287 Ga0501037_0080352 3300049573 Bacteria 2366
288 Ga0501038_0001154 3300049574 Bacteria 23957
289 Ga0501042_0212744 3300049578 Bacteria 1395
290 Ga0501043_0114501 3300049579 Bacteria 2117
291 Ga0501047_0037837 3300049581 Bacteria 4666
292 Ga0501047_0743544 3300049581 Bacteria 797
293 Ga0501048_0259181 3300049582 Bacteria 1235
294 Ga0501069_0730035 3300049585 Bacteria 598
295 Ga0501070_0063838 3300049586 Bacteria 3051
296 Ga0501070_0348249 3300049586 Bacteria 1203
297 Ga0501080_0536184 3300049742 Bacteria 1043
298 Ga0501035_0249132 3300049822 Bacteria 1509
299 Ga0501035_0320375 3300049822 Bacteria 1303
300 Ga0501035_0366365 3300049822 Bacteria 1203
301 Ga0501044_0002421 3300049823 Bacteria 21280
302 Ga0501044_0138660 3300049823 Bacteria 2421
303 Ga0501044_0143381 3300049823 Bacteria 2376
304 nmdc:mga03n38_34481_c1 3300050490 Bacteria 2162
305 nmdc:mga03n38_390065_c1 3300050490 Bacteria 765
306 nmdc:mga03n38_393443_c1 3300050490 Bacteria 762
307 nmdc:mga0yw44_561028_c1 3300050492 Bacteria 775
308 nmdc:mga06z11_1415_c1 3300050494 Bacteria 8917
309 nmdc:mga04h51_40398_c1 3300050495 Bacteria 1520
310 nmdc:mga09592_88191_c1 3300050508 Bacteria 2649
311 Ga0495612_0033662 3300053078 Bacteria 2074
312 Ga0495655_0192254 3300053083 Bacteria 663
313 Ga0495619_0093920 3300053085 Bacteria 2034
314 Ga0500640_001193 3300053095 Bacteria 7620
315 Ga0500650_0102475 3300053098 Bacteria 1339
316 Ga0500560_003041 3300053107 Bacteria 3324
317 Ga0500560_143880 3300053107 Bacteria 794
318 Ga0500572_009272 3300053111 Bacteria 2323
319 Ga0500573_0220758 3300053140 Bacteria 994
320 Ga0500600_0365467 3300053149 Bacteria 587
321 Ga0500633_0140982 3300053160 Bacteria 902
322 Ga0466962_0000494 3300061719 Bacteria 17137
323 Ga0466962_0134022 3300061719 Bacteria 1198
324 2585311067 2582581313 Bacteria 10042643
325 2585313848 2582581314 Bacteria 11452267
326 2616697849 2616644814 Bacteria 11555299
327 2643946808 2643221587 Bacteria 7586415
328 2644266365 2643221647 Bacteria 10741251
329 2644434989 2643221677 Bacteria 7584031
330 2644441019 2643221678 Bacteria 9540101
331 2644630425 2643221714 Bacteria 9015452
332 2784585938 2784132148 Bacteria 8627943
333 2786667093 2786546132 Bacteria 10419719
334 2791909876 2791354901 Bacteria 8322202
335 2808846718 2808606359 Bacteria 9866990
336 2812477122 2811994917 Bacteria 7761064
337 2862282274 2862281513 Bacteria 9621493
338 2862576681 2862574272 Bacteria 10567477
339 2867431843 2867428634 Bacteria 9590268
340 2877684394 2877676314 Bacteria 9512378
341 2899365231 2899359706 Bacteria 10940472
342 2912726868 2912723979 Bacteria 8557534
343 2918508535 2918501144 Bacteria 8668083
344 2919468833 2919468124 Bacteria 9133025
345 2946072925 2946072368 Bacteria 8999607
346 2954009095 2954002825 Bacteria 9173742
347 2954389741 2954380949 Bacteria 10050426
348 2954682178 2954673503 Bacteria 9685905
349 2954690746 2954682443 Bacteria 9862841
350 2954700583 2954691527 Bacteria 10720516
351 2954701646 2954701450 Bacteria 10834262
352 2954719247 2954711539 Bacteria 10867210
353 2954729219 2954721474 Bacteria 10456478
354 2954732591 2954731030 Bacteria 10243860
355 2954748119 2954740390 Bacteria 10229294
356 2954751470 2954749733 Bacteria 10366972
357 2954767243 2954759201 Bacteria 9358192
358 3006395124 3006393351 Bacteria 6615579
359 8008581499 8008574985 Bacteria 7815457
360 8023624884 8023623736 Bacteria 8593882
361 8056830509 8056829672 Bacteria 9045328
362 Ga0495645_0040834
363 JGI24739J22299_10020329
364 JGI24735J21928_10063584
365 JGI24738J21930_10112348
366 rootH2_10037733
367 rootL2_10077258
368 rootH1_10002244
369 rootH1_10033086
370 rootH1_10037601
371 Ga0006562J51391_1091897
372 Ga0070683_101368596
373 Ga0070698_101061057
374 Ga0070679_100865955
375 Ga0068855_100066324
376 Ga0070664_100030335
377 Ga0068857_100695614
378 Ga0068856_100079941
379 Ga0081539_10000254
380 Ga0075363_100016180
381 Ga0075363_100520004
382 Ga0075367_10000602
383 Ga0075429_100093589
384 Ga0105251_10053834
385 Ga0105033_101473
386 Ga0105028_122216
387 Ga0157372_10511954
388 Ga0182008_10009383
389 Ga0182006_1022392
390 Ga0182007_10000163
391 Ga0182005_1024804
392 Ga0183367_1012
393 Ga0207713_1074775
394 Ga0207647_10004105
395 Ga0207652_10771664
396 Ga0207679_10539278
397 Ga0207667_10051213
398 Ga0207639_10079777
399 Ga0207702_10931310
400 Ga0207674_10692995
401 Ga0209371_1016597
402 Ga0209813_10034063
403 Ga0307517_10059896
404 Ga0307515_10000787
405 Ga0307515_10060979
406 Ga0307515_10353577
407 Ga0268256_1018448
408 Ga0307511_10002825
409 Ga0307511_10104553
410 Ga0307511_10232861
411 Ga0265316_10565088
412 Ga0307513_10002153
413 Ga0307513_10056380
414 Ga0307513_10109923
415 Ga0307509_10061249
416 Ga0307508_10002009
417 Ga0307508_10024655
418 Ga0307508_10043536
419 Ga0307514_10001855
420 Ga0307514_10144472
421 Ga0307514_10371298
422 Ga0307516_10009196
423 Ga0307516_10057371
424 Ga0307516_10179088
425 Ga0307413_10024191
426 Ga0307413_10300633
427 Ga0307413_10937566
428 Ga0307518_10161548
429 Ga0307518_10287523
430 Ga0307518_10381881
431 Ga0307518_10456831
432 Ga0307409_101407566
433 Ga0307507_10005137
434 Ga0307507_10006988
435 Ga0307510_10045708
436 Ga0307510_10046610
437 Ga0307510_10161596
438 Ga0307510_10181063
439 Ga0395900_0136801
440 Ga0395900_0524369
441 Ga0395898_0001645
442 Ga0395898_0559165
443 Ga0395905_0736972
444 Ga0395901_0286998
445 Ga0395901_1047508
446 Ga0451791_0121941
447 Ga0451800_0079487
448 Ga0451849_0901507
449 Ga0451843_0327070
450 Ga0451853_1619563
451 Ga0451853_3016896
452 Ga0451853_4040671
453 Ga0439448_0011668
454 Ga0439449_0002884
455 Ga0439455_0031891
456 Ga0450903_006139
457 Ga0439458_0000484
458 Ga0466972_0012651
459 Ga0466972_0013311
460 Ga0466972_0015040
461 Ga0466972_0024013
462 Ga0466972_0190612
463 Ga0466965_0000579
464 Ga0466965_0440442
465 Ga0466966_0001877
466 Ga0466966_0139338
467 Ga0466966_0651045
468 Ga0466961_0001296
469 Ga0466961_0132781
470 Ga0466963_0002931
471 Ga0466964_0003247
472 Ga0466971_0002402
473 Ga0466971_0005686
474 Ga0466970_0000569
475 Ga0466970_0000840
476 Ga0466957_0000726
477 Ga0466960_0011740
478 Ga0466960_0040863
479 Ga0466960_0390199
480 Ga0466959_0000770
481 Ga0466958_0000341
482 Ga0466958_0801056
483 Ga0466967_0008670
484 Ga0466967_0780695
485 Ga0495617_005681
486 Ga0495592_0006523
487 Ga0495592_0322943
488 Ga0495603_0007935
489 Ga0495603_0021502
490 Ga0495603_0177864
491 Ga0495603_0356903
492 Ga0495629_0033917
493 Ga0495629_0114807
494 Ga0495629_0138281
495 Ga0495629_0323415
496 Ga0495638_0060646
497 Ga0495638_0111912
498 Ga0495638_0126336
499 Ga0495651_0001073
500 Ga0495580_0410350
501 Ga0495582_0035873
502 Ga0495605_0002792
503 Ga0495605_0023216
504 Ga0495605_0101146
505 Ga0495639_0033293
506 Ga0495662_0023178
507 Ga0495662_0028739
508 Ga0495662_0038946
509 Ga0495664_0001523
510 Ga0495584_0357424
511 Ga0495585_0149409
512 Ga0495585_0160825
513 Ga0495594_0007139
514 Ga0495594_0010879
515 Ga0495594_0020786
516 Ga0495596_0050432
517 Ga0495607_0061354
518 Ga0495583_0061934
519 Ga0495583_0085693
520 Ga0495583_0382759
521 Ga0495606_0020595
522 Ga0495608_0102067
523 Ga0495610_0243775
524 Ga0495616_0050843
525 Ga0495620_0001968
526 Ga0495620_0028722
527 Ga0495620_0084307
528 Ga0495620_0158555
529 Ga0495628_0039109
530 Ga0495628_0202407
531 Ga0495631_0136965
532 Ga0495637_0128405
533 Ga0495643_0002682
534 Ga0495644_0132495
535 Ga0495648_0096002
536 Ga0495648_0183760
537 Ga0495648_0295805
538 Ga0495666_0016680
539 Ga0495666_0363137
540 Ga0495642_0040619
541 Ga0495642_0057697
542 Ga0495652_0250957
543 Ga0495654_0073946
544 Ga0495640_0002152
545 Ga0495587_0002300
546 Ga0495587_0116140
547 Ga0495609_0046562
548 Ga0495597_0024095
549 Ga0495597_0267418
550 Ga0495622_0107074
551 Ga0495622_0191913
552 Ga0495633_0016765
553 Ga0495633_0158776
554 Ga0495667_0236246
555 Ga0495667_0514757
556 Ga0495668_0129518
557 Ga0495634_0008879
558 Ga0495634_0158117
559 Ga0495611_0091056
560 Ga0495625_0004172
561 Ga0495625_0338105
562 Ga0495635_0003725
563 Ga0495661_0437823
564 Ga0495588_0016635
565 Ga0495588_0159926
566 Ga0495588_0196796
567 Ga0495588_0513867
568 Ga0495657_0000085
569 Ga0495657_0008370
570 Ga0495657_0044828
571 Ga0495657_0126696
572 Ga0495623_0275896
573 Ga0495646_0000196
574 Ga0495658_0039616
575 Ga0495613_0000273
576 Ga0495613_0009089
577 Ga0495613_0042291
578 Ga0495624_0059373
579 Ga0495624_0356594
580 Ga0495671_0002101
581 Ga0495589_0004685
582 Ga0495589_0019525
583 Ga0495589_0020793
584 Ga0495589_0146781
585 Ga0495589_0253076
586 Ga0495589_0335573
587 Ga0495600_0018082
588 Ga0495600_0070028
589 Ga0495600_0094398
590 Ga0495660_0279899
591 Ga0495660_0407443
592 Ga0495581_0026886
593 Ga0495581_0033980
594 Ga0495581_0146053
595 Ga0495604_0018995
596 Ga0495604_0189416
597 Ga0495636_0037691
598 Ga0495636_0404763
599 Ga0495674_0087968
600 Ga0495674_0207988
601 Ga0495672_0334372
602 Ga0495676_0011172
603 Ga0495676_0011789
604 Ga0495676_0088813
605 Ga0495680_0009841
606 Ga0495683_0063871
607 Ga0495687_000735
608 Ga0495687_001037
609 Ga0495687_004594
610 Ga0495687_043269
611 Ga0495687_057814
612 Ga0495687_089572
613 Ga0495675_0009240
614 Ga0495675_0090645
615 Ga0495675_0114006
616 Ga0495677_0195728
617 Ga0495685_003323
618 Ga0495685_009042
619 Ga0495685_010785
620 Ga0495685_019085
621 Ga0495685_033582
622 Ga0495685_035674
623 Ga0495681_0000905
624 Ga0495681_0109747
625 Ga0495681_0253954
626 Ga0495684_0588810
627 Ga0495686_0028856
628 Ga0495686_0135722
629 Ga0495686_0199782
630 Ga0495686_0290099
631 Ga0495593_0000322
632 Ga0495593_0013366
633 Ga0495593_0453123
634 Ga0495602_0033740
635 Ga0495614_0008061
636 Ga0495614_0040690
637 Ga0495614_0069625
638 Ga0495614_0157776
639 Ga0495614_0397418
640 Ga0495626_0037208
641 Ga0496109_0044931
642 Ga0495678_043314
643 Ga0495678_091810
644 Ga0501031_0098233
645 Ga0501032_0231647
646 Ga0501034_0166679
647 Ga0501034_1022427
648 Ga0501037_0080352
649 Ga0501038_0001154
650 Ga0501042_0212744
651 Ga0501043_0114501
652 Ga0501047_0037837
653 Ga0501047_0743544
654 Ga0501048_0259181
655 Ga0501069_0730035
656 Ga0501070_0063838
657 Ga0501070_0348249
658 Ga0501080_0536184
659 Ga0501035_0249132
660 Ga0501035_0320375
661 Ga0501035_0366365
662 Ga0501044_0002421
663 Ga0501044_0138660
664 Ga0501044_0143381
665 nmdc:mga03n38_34481_c1
666 nmdc:mga03n38_390065_c1
667 nmdc:mga03n38_393443_c1
668 nmdc:mga0yw44_561028_c1
669 nmdc:mga06z11_1415_c1
670 nmdc:mga04h51_40398_c1
671 nmdc:mga09592_88191_c1
672 Ga0495612_0033662
673 Ga0495655_0192254
674 Ga0495619_0093920
675 Ga0500640_001193
676 Ga0500650_0102475
677 Ga0500560_003041
678 Ga0500560_143880
679 Ga0500572_009272
680 Ga0500573_0220758
681 Ga0500600_0365467
682 Ga0500633_0140982
683 Ga0466962_0000494
684 Ga0466962_0134022
685 2585311067
686 2585313848
687 2616697849
688 2643946808
689 2644266365
690 2644434989
691 2644441019
692 2644630425
693 2784585938
694 2786667093
695 2791909876
696 2808846718
697 2812477122
698 2862282274
699 2862576681
700 2867431843
701 2877684394
702 2899365231
703 2912726868
704 2918508535
705 2919468833
706 2946072925
707 2954009095
708 2954389741
709 2954682178
710 2954690746
711 2954700583
712 2954701646
713 2954719247
714 2954729219
715 2954732591
716 2954748119
717 2954751470
718 2954767243
719 3006395124
720 8008581499
721 8023624884
722 8056830509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

7

124

0.93

PF08534

Redoxin

Redoxin

6

139

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8479 4 152
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8177 4 152
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.8121 3 155
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8042 5 154
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.7977 3 155
ID Description Score Start End Superfamily
af_Q5RHH4_186_376_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8957 119 133 2.130.10.10
af_Q9JKU3_185_403_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8884 119 133 2.130.10.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8479 4 152 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8432 5 152 3.40.30.10
af_Q54W09_3_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8402 4 150 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7J3RXP4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.8723 4 154 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A2G7ENJ4-F1-model_v4 deleted 0.8707 1 155
AF-A0A1S2P8V5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.8693 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A515Y0F4-F1-model_v4 deleted 0.8663 1 155
AF-A0A1H0TN93-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.8661 5 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map