F422335

General Info

Members Datasets Scaffolds Average Seq Length
361 185 339 103

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0001118|Ga0495606_0001118_16603_16995
Length 120
Sequence MNKNPYNPAPIHPDARSAVSLPPCPKCSSEYTYEDGTQLVDGAADASDEVKIIKDAVGNTLQDGDTVTVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVKKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
5 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
6 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
7 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
12 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
13 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
14 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
15 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
16 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
17 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
18 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
19 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
20 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
97 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
98 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
181 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
182 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
183 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
184 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
185 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 2.22
Rhizosphere 78.12
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1228505 2162886007 Bacteria 1057
2 SwRhRL2b_contig_692490 2162886007 Bacteria 1545
3 Ga0055540_1004175 3300003792 Bacteria 6656
4 Ga0055541_1002475 3300003841 Bacteria 3683
5 Ga0065714_10069007 3300005288 Bacteria 4430
6 Ga0065714_10072853 3300005288 Bacteria 3287
7 Ga0065704_10075160 3300005289 Bacteria 5760
8 Ga0065704_10097703 3300005289 Bacteria 2366
9 Ga0065712_10000955 3300005290 Bacteria 9076
10 Ga0070670_100001744 3300005331 Bacteria 17710
11 Ga0070669_101089388 3300005353 Bacteria 688
12 Ga0070659_100272681 3300005366 Bacteria 1406
13 Ga0070662_100007555 3300005457 Bacteria 7054
14 Ga0075364_10197976 3300006051 Bacteria 1361
15 Ga0075432_10006004 3300006058 Bacteria 4136
16 Ga0075432_10479161 3300006058 Bacteria 551
17 Ga0075366_10405480 3300006195 Unclassified 839
18 Ga0075436_100383431 3300006914 Bacteria 1016
19 Ga0105251_10000697 3300009011 Bacteria 31001
20 Ga0105251_10033032 3300009011 Bacteria 2573
21 Ga0105251_10036141 3300009011 Bacteria 2433
22 Ga0105251_10046763 3300009011 Bacteria 2082
23 Ga0105251_10431685 3300009011 Bacteria 609
24 Ga0105244_10039855 3300009036 Bacteria 2442
25 Ga0105244_10054886 3300009036 Bacteria 2020
26 Ga0105250_10001836 3300009092 Bacteria 11095
27 Ga0105250_10062799 3300009092 Bacteria 1494
28 Ga0105243_10283602 3300009148 Bacteria 1493
29 Ga0105241_11831670 3300009174 Bacteria 593
30 Ga0105242_10925978 3300009176 Bacteria 874
31 Ga0105246_10233218 3300011119 Bacteria 1450
32 Ga0105246_12380991 3300011119 Bacteria 519
33 Ga0157373_10113821 3300013100 Bacteria 1901
34 Ga0157373_10312295 3300013100 Bacteria 1117
35 Ga0157371_10040185 3300013102 Bacteria 3342
36 Ga0157369_10016877 3300013105 Bacteria 8204
37 Ga0157369_10407798 3300013105 Bacteria 1410
38 Ga0157369_10763099 3300013105 Bacteria 995
39 Ga0163162_10008507 3300013306 Bacteria 10007
40 Ga0157372_10205439 3300013307 Bacteria 2282
41 Ga0182008_10011716 3300014497 Bacteria 4653
42 Ga0182006_1013566 3300015261 Bacteria 3533
43 Ga0163161_10009102 3300017792 Bacteria 6863
44 Ga0163161_10338973 3300017792 Bacteria 1192
45 Ga0163161_10646428 3300017792 Bacteria 876
46 Ga0209566_100543 3300025225 Bacteria 25496
47 Ga0209566_101744 3300025225 Bacteria 5211
48 Ga0209130_1013012 3300025284 Bacteria 2149
49 Ga0209676_1013610 3300025292 Bacteria 3117
50 Ga0209025_1006949 3300025294 Bacteria 8603
51 Ga0209050_1000701 3300025298 Bacteria 49786
52 Ga0209051_1000499 3300025303 Bacteria 49786
53 Ga0209257_1008360 3300025304 Bacteria 5909
54 Ga0207696_1000047 3300025711 Bacteria 285005
55 Ga0207696_1002455 3300025711 Bacteria 9072
56 Ga0207696_1024711 3300025711 Bacteria 1881
57 Ga0207655_1001764 3300025728 Bacteria 18906
58 Ga0207655_1014792 3300025728 Bacteria 4382
59 Ga0207655_1030275 3300025728 Bacteria 2519
60 Ga0207655_1040268 3300025728 Bacteria 2019
61 Ga0207655_1183707 3300025728 Bacteria 636
62 Ga0207713_1000138 3300025735 Bacteria 111150
63 Ga0207713_1003349 3300025735 Bacteria 10997
64 Ga0207713_1007290 3300025735 Bacteria 6559
65 Ga0207713_1085013 3300025735 Bacteria 1127
66 Ga0207713_1124455 3300025735 Bacteria 861
67 Ga0207713_1136628 3300025735 Bacteria 805
68 Ga0207650_10000276 3300025925 Bacteria 53717
69 Ga0207650_10000299 3300025925 Bacteria 49108
70 Ga0207690_10454605 3300025932 Bacteria 1030
71 Ga0207706_10010689 3300025933 Bacteria 8385
72 Ga0207686_10506184 3300025934 Bacteria 938
73 Ga0207709_10247998 3300025935 Bacteria 1299
74 Ga0207669_10249916 3300025937 Bacteria 1320
75 Ga0209371_1000320 3300027312 Bacteria 52690
76 Ga0209371_1000490 3300027312 Bacteria 38556
77 Ga0209995_1002942 3300027471 Bacteria 2704
78 Ga0209968_1001699 3300027526 Bacteria 3325
79 Ga0209982_1021433 3300027552 Bacteria 995
80 Ga0209983_1005062 3300027665 Bacteria 2747
81 Ga0209971_1001792 3300027682 Bacteria 5266
82 Ga0209974_10011474 3300027876 Bacteria 2974
83 Ga0209974_10012183 3300027876 Bacteria 2878
84 Ga0207428_10045362 3300027907 Bacteria 3541
85 Ga0265323_10029465 3300028653 Bacteria 2052
86 Ga0268256_1000279 3300030500 Bacteria 52918
87 Ga0268256_1000419 3300030500 Bacteria 38396
88 Ga0265327_10000778 3300031251 Bacteria 49242
89 Ga0265316_10003670 3300031344 Bacteria 15464
90 Ga0265316_10006286 3300031344 Bacteria 11374
91 Ga0307408_100000063 3300031548 Bacteria 125218
92 Ga0316576_10470410 3300031727 Bacteria 927
93 Ga0307413_11250945 3300031824 Bacteria 647
94 Ga0307406_10000270 3300031901 Bacteria 31010
95 Ga0307414_10001978 3300032004 Bacteria 10624
96 Ga0307414_10002242 3300032004 Bacteria 10091
97 Ga0307414_10166150 3300032004 Bacteria 1759
98 Ga0307411_11155040 3300032005 Bacteria 700
99 Ga0316585_10177538 3300032137 Bacteria 704
100 Ga0316585_10233825 3300032137 Bacteria 609
101 Ga0307510_10149163 3300033180 Bacteria 1962
102 Ga0373929_0045964 3300035085 Bacteria 985
103 Ga0373962_0010175 3300035242 Bacteria 2340
104 Ga0373931_0084234 3300035691 Bacteria 1760
105 Ga0316582_0162780 3300036647 Bacteria 1512
106 Ga0373925_1185786 3300037068 Bacteria 628
107 Ga0400483_096028 3300039062 Bacteria 2414
108 Ga0436361_0821130 3300039447 Bacteria 788
109 Ga0436361_1171507 3300039447 Bacteria 1418
110 Ga0439438_047967 3300041405 Bacteria 1093
111 Ga0439447_020758 3300041407 Bacteria 1737
112 Ga0439447_040481 3300041407 Bacteria 1137
113 Ga0439466_0005526 3300041411 Bacteria 4822
114 Ga0439432_000376 3300042006 Bacteria 16483
115 Ga0439432_011969 3300042006 Bacteria 2980
116 Ga0439432_037550 3300042006 Bacteria 1545
117 Ga0439451_087115 3300042009 Bacteria 628
118 Ga0439451_098880 3300042009 Bacteria 589
119 Ga0439455_0136737 3300042012 Bacteria 693
120 Ga0439456_040218 3300042013 Bacteria 1012
121 Ga0450923_013138 3300042125 Bacteria 1518
122 Ga0450900_016066 3300042136 Bacteria 1011
123 Ga0450905_001225 3300042142 Bacteria 3255
124 Ga0450905_004801 3300042142 Bacteria 1802
125 Ga0439464_0008051 3300042439 Bacteria 2763
126 Ga0439464_0205350 3300042439 Bacteria 629
127 Ga0451577_0084878 3300042876 Bacteria 2826
128 Ga0451577_0159049 3300042876 Bacteria 2034
129 Ga0451577_0454645 3300042876 Bacteria 1163
130 Ga0453683_0072540 3300044673 Bacteria 2155
131 Ga0453684_0033054 3300044712 Bacteria 7219
132 Ga0453684_0240578 3300044712 Bacteria 2084
133 Ga0453684_1903592 3300044712 Bacteria 602
134 Ga0451576_0000119 3300045051 Bacteria 200621
135 Ga0451576_1498798 3300045051 Bacteria 701
136 Ga0495617_023800 3300046452 Bacteria 2068
137 Ga0495627_000165 3300046453 Bacteria 75339
138 Ga0495627_012100 3300046453 Bacteria 3071
139 Ga0495603_0019722 3300046455 Bacteria 4082
140 Ga0495591_000675 3300046458 Bacteria 25029
141 Ga0495591_001816 3300046458 Bacteria 12647
142 Ga0495591_011903 3300046458 Bacteria 3266
143 Ga0495638_0172821 3300046460 Bacteria 1238
144 Ga0495638_0327722 3300046460 Bacteria 816
145 Ga0495653_0015518 3300046463 Bacteria 6208
146 Ga0495650_0001687 3300046471 Bacteria 20348
147 Ga0495650_0001732 3300046471 Bacteria 19938
148 Ga0495650_0008101 3300046471 Bacteria 6190
149 Ga0495605_0000221 3300046474 Bacteria 70254
150 Ga0495605_0000696 3300046474 Bacteria 25113
151 Ga0495605_0003686 3300046474 Bacteria 9097
152 Ga0495605_0123300 3300046474 Bacteria 1173
153 Ga0495605_0337596 3300046474 Bacteria 633
154 Ga0495584_0010589 3300046491 Bacteria 4737
155 Ga0495584_0059493 3300046491 Bacteria 1921
156 Ga0495585_0007699 3300046492 Bacteria 6564
157 Ga0495585_0081676 3300046492 Bacteria 1750
158 Ga0495594_0022974 3300046499 Bacteria 3339
159 Ga0495607_0000499 3300046501 Bacteria 39205
160 Ga0495607_0003278 3300046501 Bacteria 12451
161 Ga0495607_0009325 3300046501 Bacteria 6651
162 Ga0495607_0010054 3300046501 Bacteria 6372
163 Ga0495607_0027338 3300046501 Bacteria 3528
164 Ga0495607_0176244 3300046501 Bacteria 1075
165 Ga0495607_0208747 3300046501 Bacteria 962
166 Ga0495583_0000168 3300046506 Bacteria 111781
167 Ga0495583_0000368 3300046506 Bacteria 70160
168 Ga0495583_0001270 3300046506 Bacteria 26433
169 Ga0495583_0001927 3300046506 Bacteria 19192
170 Ga0495583_0041432 3300046506 Bacteria 2156
171 Ga0495583_0043506 3300046506 Bacteria 2090
172 Ga0495606_0001118 3300046507 Bacteria 38331
173 Ga0495606_0246370 3300046507 Bacteria 993
174 Ga0495606_0357211 3300046507 Bacteria 773
175 Ga0495610_0016821 3300046512 Bacteria 4195
176 Ga0495610_0027009 3300046512 Bacteria 3058
177 Ga0495610_0034348 3300046512 Bacteria 2612
178 Ga0495610_0038429 3300046512 Bacteria 2429
179 Ga0495610_0075803 3300046512 Bacteria 1556
180 Ga0495616_0054749 3300046513 Bacteria 1977
181 Ga0495616_0088126 3300046513 Bacteria 1474
182 Ga0495620_0000191 3300046515 Bacteria 46699
183 Ga0495620_0000665 3300046515 Bacteria 21206
184 Ga0495620_0100484 3300046515 Bacteria 1153
185 Ga0495631_0018931 3300046518 Bacteria 3236
186 Ga0495631_0032271 3300046518 Bacteria 2362
187 Ga0495632_0003368 3300046519 Bacteria 11389
188 Ga0495632_0042585 3300046519 Bacteria 2274
189 Ga0495632_0102740 3300046519 Bacteria 1346
190 Ga0495632_0172624 3300046519 Bacteria 992
191 Ga0495632_0206961 3300046519 Bacteria 891
192 Ga0495637_0000609 3300046520 Bacteria 25502
193 Ga0495637_0008817 3300046520 Bacteria 4939
194 Ga0495637_0019506 3300046520 Bacteria 3134
195 Ga0495637_0021262 3300046520 Bacteria 2977
196 Ga0495637_0136330 3300046520 Bacteria 934
197 Ga0495643_0004157 3300046522 Bacteria 10281
198 Ga0495643_0014901 3300046522 Bacteria 4612
199 Ga0495643_0049997 3300046522 Bacteria 2252
200 Ga0495643_0068355 3300046522 Bacteria 1869
201 Ga0495644_0006244 3300046523 Bacteria 4627
202 Ga0495648_0004191 3300046524 Bacteria 12386
203 Ga0495648_0014448 3300046524 Bacteria 5781
204 Ga0495642_0001984 3300046528 Bacteria 8571
205 Ga0495654_0000761 3300046530 Bacteria 24924
206 Ga0495654_0003872 3300046530 Bacteria 9040
207 Ga0495654_0011949 3300046530 Bacteria 4681
208 Ga0495654_0020928 3300046530 Bacteria 3407
209 Ga0495654_0086223 3300046530 Bacteria 1463
210 Ga0495654_0226411 3300046530 Bacteria 788
211 Ga0495609_0000099 3300046538 Bacteria 101070
212 Ga0495609_0000159 3300046538 Bacteria 69989
213 Ga0495609_0000271 3300046538 Bacteria 48460
214 Ga0495609_0017784 3300046538 Bacteria 3298
215 Ga0495609_0280081 3300046538 Bacteria 682
216 Ga0495597_0001813 3300046542 Bacteria 14615
217 Ga0495597_0040143 3300046542 Bacteria 2092
218 Ga0495597_0143864 3300046542 Bacteria 982
219 Ga0495633_0000237 3300046558 Bacteria 66800
220 Ga0495668_0006645 3300046616 Bacteria 7536
221 Ga0495668_0034387 3300046616 Bacteria 2843
222 Ga0495668_0425590 3300046616 Bacteria 730
223 Ga0495611_0000524 3300046648 Bacteria 22786
224 Ga0495611_0001614 3300046648 Bacteria 10981
225 Ga0495625_0000050 3300046660 Bacteria 197065
226 Ga0495625_0331698 3300046660 Bacteria 966
227 Ga0495661_0000216 3300046665 Bacteria 66437
228 Ga0495661_0000890 3300046665 Bacteria 27565
229 Ga0495661_0001745 3300046665 Bacteria 17505
230 Ga0495661_0031934 3300046665 Bacteria 3333
231 Ga0495661_0040643 3300046665 Bacteria 2882
232 Ga0495646_0008163 3300046680 Bacteria 6655
233 Ga0495613_0042902 3300046689 Bacteria 3346
234 Ga0495624_0009306 3300046690 Bacteria 6807
235 Ga0495670_0058007 3300046691 Bacteria 1943
236 Ga0495670_0179461 3300046691 Bacteria 1117
237 Ga0495671_0020854 3300046692 Bacteria 3449
238 Ga0495649_0030735 3300046694 Bacteria 2964
239 Ga0495649_0050376 3300046694 Bacteria 2260
240 Ga0495649_0104166 3300046694 Bacteria 1506
241 Ga0495649_0395698 3300046694 Bacteria 694
242 Ga0495589_0001872 3300046794 Bacteria 11920
243 Ga0495600_0007448 3300046809 Bacteria 6697
244 Ga0495660_0014644 3300046810 Bacteria 4535
245 Ga0495660_0033832 3300046810 Bacteria 2862
246 Ga0495660_0091236 3300046810 Bacteria 1583
247 Ga0495604_0024494 3300047317 Bacteria 4815
248 Ga0495672_0006642 3300047320 Bacteria 8888
249 Ga0495672_0007016 3300047320 Bacteria 8556
250 Ga0495672_0021709 3300047320 Bacteria 4184
251 Ga0495672_0046531 3300047320 Bacteria 2586
252 Ga0495672_0213664 3300047320 Bacteria 956
253 Ga0495672_0217396 3300047320 Bacteria 945
254 Ga0495672_0358719 3300047320 Bacteria 675
255 Ga0495676_0000024 3300047321 Bacteria 150285
256 Ga0495676_0154520 3300047321 Bacteria 1629
257 Ga0495680_0014585 3300047322 Bacteria 6801
258 Ga0495683_0000147 3300047323 Bacteria 68938
259 Ga0495683_0045436 3300047323 Bacteria 2207
260 Ga0495679_000142 3300047446 Bacteria 64715
261 Ga0495679_059208 3300047446 Bacteria 1127
262 Ga0495679_103958 3300047446 Bacteria 786
263 Ga0495673_0000005 3300047469 Bacteria 943364
264 Ga0495673_0004379 3300047469 Bacteria 8856
265 Ga0495673_0005331 3300047469 Bacteria 7800
266 Ga0495673_0006802 3300047469 Bacteria 6678
267 Ga0495673_0012946 3300047469 Bacteria 4397
268 Ga0495673_0020228 3300047469 Bacteria 3318
269 Ga0495673_0042140 3300047469 Bacteria 2051
270 Ga0495673_0055514 3300047469 Bacteria 1717
271 Ga0495673_0162716 3300047469 Bacteria 855
272 Ga0495681_0003513 3300047470 Bacteria 10888
273 Ga0495681_0005349 3300047470 Bacteria 8611
274 Ga0495681_0123645 3300047470 Bacteria 1107
275 Ga0495684_0261029 3300047471 Bacteria 1256
276 Ga0495686_0038162 3300047472 Bacteria 3073
277 Ga0495593_0023644 3300047673 Bacteria 3413
278 Ga0495602_0019902 3300048088 Bacteria 6646
279 Ga0495626_0000061 3300048091 Bacteria 144886
280 Ga0495626_0073726 3300048091 Bacteria 1528
281 Ga0495626_0215205 3300048091 Bacteria 782
282 Ga0496102_0264621 3300048905 Bacteria 1621
283 Ga0496102_0297435 3300048905 Bacteria 1521
284 Ga0496110_0177747 3300048913 Bacteria 1932
285 Ga0496110_1574621 3300048913 Bacteria 567
286 Ga0496111_0835003 3300048914 Bacteria 666
287 Ga0496114_0195118 3300048917 Bacteria 1772
288 Ga0496116_0050566 3300048919 Bacteria 2768
289 Ga0496117_0000600 3300048920 Bacteria 59074
290 Ga0496117_0012750 3300048920 Bacteria 7376
291 Ga0496117_0016894 3300048920 Bacteria 6123
292 Ga0496117_0063165 3300048920 Bacteria 2532
293 Ga0496117_0174168 3300048920 Bacteria 1245
294 Ga0496118_0013569 3300048921 Bacteria 7692
295 Ga0496118_0070818 3300048921 Bacteria 2514
296 Ga0496118_0112885 3300048921 Bacteria 1797
297 Ga0496118_0125378 3300048921 Bacteria 1663
298 Ga0496118_0218807 3300048921 Bacteria 1110
299 Ga0496119_0097527 3300048922 Bacteria 1656
300 Ga0496120_0077473 3300048923 Bacteria 1809
301 Ga0496120_0173317 3300048923 Bacteria 1065
302 Ga0496121_0002405 3300048924 Bacteria 28678
303 Ga0496121_0005476 3300048924 Bacteria 16251
304 Ga0496121_0067916 3300048924 Bacteria 2886
305 Ga0496121_0141994 3300048924 Bacteria 1780
306 Ga0496122_0003936 3300048925 Bacteria 18971
307 Ga0496122_0037053 3300048925 Bacteria 3933
308 Ga0496122_0055052 3300048925 Bacteria 2980
309 Ga0496122_0055452 3300048925 Bacteria 2965
310 Ga0496122_0118137 3300048925 Bacteria 1719
311 Ga0496122_0157242 3300048925 Bacteria 1392
312 Ga0496123_0000080 3300048926 Bacteria 190247
313 Ga0496123_0003867 3300048926 Bacteria 16291
314 Ga0496123_0036288 3300048926 Bacteria 3498
315 Ga0496123_0036989 3300048926 Bacteria 3453
316 Ga0496123_0070964 3300048926 Bacteria 2176
317 Ga0496123_0091262 3300048926 Bacteria 1807
318 Ga0496123_0478453 3300048926 Bacteria 548
319 Ga0496124_0007122 3300048927 Bacteria 11972
320 Ga0496124_0009384 3300048927 Bacteria 10081
321 Ga0496124_0013854 3300048927 Bacteria 7842
322 Ga0496124_0070850 3300048927 Bacteria 2891
323 Ga0496125_0002310 3300048928 Bacteria 25163
324 Ga0496125_0033057 3300048928 Bacteria 4584
325 Ga0496126_0053311 3300048929 Bacteria 3670
326 Ga0496126_0066211 3300048929 Bacteria 3230
327 Ga0495678_000254 3300049459 Bacteria 59650
328 Ga0495678_004630 3300049459 Bacteria 7890
329 Ga0495678_004768 3300049459 Bacteria 7734
330 Ga0495678_019795 3300049459 Bacteria 2992
331 Ga0495678_038261 3300049459 Bacteria 1942
332 Ga0495678_053602 3300049459 Bacteria 1547
333 Ga0495682_0000504 3300049460 Bacteria 27008
334 Ga0495682_0001999 3300049460 Bacteria 10072
335 Ga0501034_0000131 3300049571 Bacteria 139479
336 nmdc:mga00v17_151040_c1 3300050491 Bacteria 1493
337 Ga0500573_0034258 3300053140 Bacteria 2929
338 Ga0500586_123241 3300053145 Bacteria 901
339 Ga0500661_037794 3300055283 Bacteria 854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10072853 Ga0065714_100728532 69
2 3300009036 Ga0105244_10054886 Ga0105244_100548862 69
3 3300014497 Ga0182008_10011716 Ga0182008_100117162 69
4 3300025728 Ga0207655_1183707 Ga0207655_11837071 69
5 3300046474 Ga0495605_0000696 Ga0495605_0000696_7494_7913 69
6 3300046506 Ga0495583_0001270 Ga0495583_0001270_20441_20860 69
7 3300046665 Ga0495661_0031934 Ga0495661_0031934_1187_1606 69
8 3300047320 Ga0495672_0021709 Ga0495672_0021709_1538_1906 69
9 3300047469 Ga0495673_0006802 Ga0495673_0006802_3790_4209 69
10 3300048905 Ga0496102_0297435 Ga0496102_0297435_225_617 69
11 3300048920 Ga0496117_0174168 Ga0496117_0174168_779_1198 69
12 3300048921 Ga0496118_0013569 Ga0496118_0013569_1748_2167 69
13 3300048924 Ga0496121_0005476 Ga0496121_0005476_64_483 69
14 3300048925 Ga0496122_0055452 Ga0496122_0055452_2435_2854 69
15 3300048926 Ga0496123_0070964 Ga0496123_0070964_1703_2122 69
16 3300048927 Ga0496124_0007122 Ga0496124_0007122_7867_8286 69
17 3300053145 Ga0500586_123241 Ga0500586_123241_111_455 76
18 3300048913 Ga0496110_1574621 Ga0496110_1574621_174_467 85
19 iso_pu_bacteria 2547132103 2547373598 87
20 3300017792 Ga0163161_10646428 Ga0163161_106464282 92
21 3300006914 Ga0075436_100383431 Ga0075436_1003834312 93
22 3300046460 Ga0495638_0172821 Ga0495638_0172821_712_1053 93
23 3300046492 Ga0495585_0007699 Ga0495585_0007699_5465_5806 93
24 3300046506 Ga0495583_0041432 Ga0495583_0041432_1427_1768 93
25 3300046506 Ga0495583_0043506 Ga0495583_0043506_1254_1595 93
26 3300046512 Ga0495610_0027009 Ga0495610_0027009_1552_1893 93
27 3300046512 Ga0495610_0075803 Ga0495610_0075803_1022_1363 93
28 3300046513 Ga0495616_0054749 Ga0495616_0054749_1619_1960 93
29 3300046519 Ga0495632_0102740 Ga0495632_0102740_100_441 93
30 3300046519 Ga0495632_0206961 Ga0495632_0206961_378_719 93
31 3300046520 Ga0495637_0019506 Ga0495637_0019506_2360_2701 93
32 3300046522 Ga0495643_0049997 Ga0495643_0049997_938_1279 93
33 3300046522 Ga0495643_0068355 Ga0495643_0068355_1111_1452 93
34 3300046530 Ga0495654_0020928 Ga0495654_0020928_2327_2668 93
35 3300046530 Ga0495654_0086223 Ga0495654_0086223_419_760 93
36 3300046538 Ga0495609_0017784 Ga0495609_0017784_1411_1752 93
37 3300046694 Ga0495649_0030735 Ga0495649_0030735_1283_1624 93
38 3300047320 Ga0495672_0007016 Ga0495672_0007016_7128_7469 93
39 3300047320 Ga0495672_0213664 Ga0495672_0213664_431_772 93
40 3300047469 Ga0495673_0042140 Ga0495673_0042140_674_1015 93
41 3300047470 Ga0495681_0005349 Ga0495681_0005349_1008_1349 93
42 3300047470 Ga0495681_0123645 Ga0495681_0123645_33_374 93
43 3300048091 Ga0495626_0073726 Ga0495626_0073726_893_1234 93
44 3300048091 Ga0495626_0215205 Ga0495626_0215205_367_708 93
45 3300049459 Ga0495678_004768 Ga0495678_004768_199_540 93
46 3300049459 Ga0495678_053602 Ga0495678_053602_920_1261 93
47 3300050491 nmdc:mga00v17_151040_c1 nmdc:mga00v17_151040_c1_694_1035 93
48 3300006051 Ga0075364_10197976 Ga0075364_101979761 94
49 3300006058 Ga0075432_10006004 Ga0075432_100060046 94
50 3300011119 Ga0105246_12380991 Ga0105246_123809912 94
51 3300013105 Ga0157369_10016877 Ga0157369_100168772 94
52 3300017792 Ga0163161_10009102 Ga0163161_100091022 94
53 3300027907 Ga0207428_10045362 Ga0207428_100453623 94
54 3300032004 Ga0307414_10166150 Ga0307414_101661501 94
55 3300041407 Ga0439447_020758 Ga0439447_020758_506_847 94
56 3300041411 Ga0439466_0005526 Ga0439466_0005526_3887_4228 94
57 3300042009 Ga0439451_087115 Ga0439451_087115_62_403 94
58 3300042009 Ga0439451_098880 Ga0439451_098880_196_537 94
59 3300042013 Ga0439456_040218 Ga0439456_040218_221_562 94
60 3300042125 Ga0450923_013138 Ga0450923_013138_482_823 94
61 3300046455 Ga0495603_0019722 Ga0495603_0019722_723_1064 94
62 3300046460 Ga0495638_0327722 Ga0495638_0327722_144_485 94
63 3300046501 Ga0495607_0027338 Ga0495607_0027338_1383_1724 94
64 3300046530 Ga0495654_0003872 Ga0495654_0003872_7153_7494 94
65 3300046538 Ga0495609_0280081 Ga0495609_0280081_208_549 94
66 3300046660 Ga0495625_0331698 Ga0495625_0331698_562_903 94
67 3300046665 Ga0495661_0040643 Ga0495661_0040643_2245_2586 94
68 3300046691 Ga0495670_0058007 Ga0495670_0058007_19_360 94
69 3300046810 Ga0495660_0091236 Ga0495660_0091236_514_855 94
70 3300047320 Ga0495672_0006642 Ga0495672_0006642_7136_7477 94
71 3300005288 Ga0065714_10069007 Ga0065714_100690072 95
72 3300005289 Ga0065704_10075160 Ga0065704_100751602 95
73 3300009011 Ga0105251_10036141 Ga0105251_100361412 95
74 3300013100 Ga0157373_10113821 Ga0157373_101138213 95
75 3300025225 Ga0209566_101744 Ga0209566_1017443 95
76 3300025925 Ga0207650_10000276 Ga0207650_1000027641 95
77 3300041405 Ga0439438_047967 Ga0439438_047967_175_516 95
78 3300041407 Ga0439447_040481 Ga0439447_040481_577_918 95
79 3300042006 Ga0439432_000376 Ga0439432_000376_15238_15579 95
80 3300048905 Ga0496102_0264621 Ga0496102_0264621_1253_1591 95
81 3300048928 Ga0496125_0002310 Ga0496125_0002310_24177_24518 95
82 iso_pu_bacteria 2510065053 2510281259 95
83 iso_pu_bacteria 2510065058 2510309407 95
84 iso_pu_bacteria 2843690924 2843695346 95
85 iso_pu_bacteria 2974298342 2974300832 95
86 3300005290 Ga0065712_10000955 Ga0065712_100009553 96
87 3300005353 Ga0070669_101089388 Ga0070669_1010893881 96
88 3300005366 Ga0070659_100272681 Ga0070659_1002726812 96
89 3300005457 Ga0070662_100007555 Ga0070662_1000075552 96
90 3300006195 Ga0075366_10405480 Ga0075366_104054802 96
91 3300009011 Ga0105251_10046763 Ga0105251_100467633 96
92 3300009092 Ga0105250_10001836 Ga0105250_100018362 96
93 3300013307 Ga0157372_10205439 Ga0157372_102054393 96
94 3300017792 Ga0163161_10338973 Ga0163161_103389732 96
95 3300025711 Ga0207696_1000047 Ga0207696_100004780 96
96 3300025728 Ga0207655_1014792 Ga0207655_10147927 96
97 3300025735 Ga0207713_1003349 Ga0207713_100334911 96
98 3300025735 Ga0207713_1124455 Ga0207713_11244551 96
99 3300025735 Ga0207713_1136628 Ga0207713_11366281 96
100 3300025932 Ga0207690_10454605 Ga0207690_104546052 96
101 3300025933 Ga0207706_10010689 Ga0207706_100106895 96
102 3300039062 Ga0400483_096028 Ga0400483_096028_848_1189 96
103 3300046458 Ga0495591_000675 Ga0495591_000675_2376_2765 96
104 3300046463 Ga0495653_0015518 Ga0495653_0015518_446_787 96
105 3300046474 Ga0495605_0003686 Ga0495605_0003686_7174_7515 96
106 3300046528 Ga0495642_0001984 Ga0495642_0001984_1073_1414 96
107 3300046538 Ga0495609_0000271 Ga0495609_0000271_16357_16695 96
108 3300046542 Ga0495597_0040143 Ga0495597_0040143_646_987 96
109 3300046616 Ga0495668_0006645 Ga0495668_0006645_5826_6167 96
110 3300046616 Ga0495668_0425590 Ga0495668_0425590_270_608 96
111 3300046680 Ga0495646_0008163 Ga0495646_0008163_5269_5610 96
112 3300046689 Ga0495613_0042902 Ga0495613_0042902_1937_2278 96
113 3300046690 Ga0495624_0009306 Ga0495624_0009306_5400_5741 96
114 3300046694 Ga0495649_0050376 Ga0495649_0050376_508_849 96
115 3300046809 Ga0495600_0007448 Ga0495600_0007448_1068_1409 96
116 3300047317 Ga0495604_0024494 Ga0495604_0024494_3394_3735 96
117 3300047320 Ga0495672_0046531 Ga0495672_0046531_1165_1506 96
118 3300047321 Ga0495676_0154520 Ga0495676_0154520_733_1074 96
119 3300047322 Ga0495680_0014585 Ga0495680_0014585_1066_1407 96
120 3300047469 Ga0495673_0005331 Ga0495673_0005331_6979_7320 96
121 3300047469 Ga0495673_0012946 Ga0495673_0012946_2129_2467 96
122 3300047471 Ga0495684_0261029 Ga0495684_0261029_455_796 96
123 3300047673 Ga0495593_0023644 Ga0495593_0023644_185_526 96
124 3300048088 Ga0495602_0019902 Ga0495602_0019902_5287_5628 96
125 3300048913 Ga0496110_0177747 Ga0496110_0177747_80_469 96
126 3300048919 Ga0496116_0050566 Ga0496116_0050566_639_980 96
127 3300048920 Ga0496117_0012750 Ga0496117_0012750_6334_6675 96
128 3300048920 Ga0496117_0063165 Ga0496117_0063165_530_871 96
129 3300048921 Ga0496118_0070818 Ga0496118_0070818_916_1257 96
130 3300048921 Ga0496118_0125378 Ga0496118_0125378_736_1077 96
131 3300048922 Ga0496119_0097527 Ga0496119_0097527_1031_1372 96
132 3300048923 Ga0496120_0077473 Ga0496120_0077473_723_1064 96
133 3300048923 Ga0496120_0173317 Ga0496120_0173317_440_781 96
134 3300048924 Ga0496121_0067916 Ga0496121_0067916_1920_2261 96
135 3300048925 Ga0496122_0118137 Ga0496122_0118137_391_732 96
136 3300048925 Ga0496122_0157242 Ga0496122_0157242_678_1019 96
137 3300048926 Ga0496123_0091262 Ga0496123_0091262_881_1222 96
138 3300048926 Ga0496123_0478453 Ga0496123_0478453_180_521 96
139 3300048927 Ga0496124_0013854 Ga0496124_0013854_5957_6298 96
140 3300048927 Ga0496124_0070850 Ga0496124_0070850_1469_1858 96
141 3300048929 Ga0496126_0066211 Ga0496126_0066211_1968_2309 96
142 iso_pu_bacteria 2599185307 2599975468 96
143 iso_pu_bacteria 2643221581 2643913822 96
144 iso_pu_bacteria 2738541271 2738689777 96
145 iso_pu_bacteria 2738543016 2739265551 96
146 iso_pu_bacteria 2826581358 2826586654 96
147 iso_pu_bacteria 2842849001 2842854401 96
148 3300003792 Ga0055540_1004175 Ga0055540_10041752 97
149 3300005331 Ga0070670_100001744 Ga0070670_1000017442 97
150 3300009148 Ga0105243_10283602 Ga0105243_102836023 97
151 3300009176 Ga0105242_10925978 Ga0105242_109259782 97
152 3300011119 Ga0105246_10233218 Ga0105246_102332181 97
153 3300013100 Ga0157373_10312295 Ga0157373_103122952 97
154 3300013105 Ga0157369_10407798 Ga0157369_104077982 97
155 3300025284 Ga0209130_1013012 Ga0209130_10130121 97
156 3300025292 Ga0209676_1013610 Ga0209676_10136104 97
157 3300025294 Ga0209025_1006949 Ga0209025_10069493 97
158 3300025298 Ga0209050_1000701 Ga0209050_100070122 97
159 3300025303 Ga0209051_1000499 Ga0209051_100049922 97
160 3300025304 Ga0209257_1008360 Ga0209257_10083602 97
161 3300025728 Ga0207655_1040268 Ga0207655_10402683 97
162 3300025925 Ga0207650_10000299 Ga0207650_1000029943 97
163 3300025934 Ga0207686_10506184 Ga0207686_105061842 97
164 3300025935 Ga0207709_10247998 Ga0207709_102479982 97
165 3300025937 Ga0207669_10249916 Ga0207669_102499161 97
166 3300027876 Ga0209974_10011474 Ga0209974_100114742 97
167 3300046491 Ga0495584_0010589 Ga0495584_0010589_3468_3809 97
168 3300046520 Ga0495637_0021262 Ga0495637_0021262_1324_1665 97
169 3300047469 Ga0495673_0004379 Ga0495673_0004379_7242_7583 97
170 3300048914 Ga0496111_0835003 Ga0496111_0835003_170_511 97
171 3300049459 Ga0495678_004630 Ga0495678_004630_6185_6526 97
172 3300049459 Ga0495678_038261 Ga0495678_038261_170_511 97
173 iso_pu_bacteria 2554235132 2554812479 97
174 iso_pu_bacteria 2606217733 2608384792 97
175 iso_pu_bacteria 2643221639 2644222168 97
176 iso_pu_bacteria 2643221646 2644257059 97
177 iso_pu_bacteria 2728369097 2729145623 97
178 iso_pu_bacteria 2894510363 2894512257 97
179 iso_pu_bacteria 3007252601 3007255886 97
180 iso_pu_bacteria 3007315729 3007320044 97
181 iso_pu_bacteria 8054357960 8054358916 97
182 iso_pu_bacteria 8054929484 8054932298 97
183 3300003841 Ga0055541_1002475 Ga0055541_10024753 98
184 3300009174 Ga0105241_11831670 Ga0105241_118316701 98
185 3300025225 Ga0209566_100543 Ga0209566_10054314 98
186 3300032137 Ga0316585_10177538 Ga0316585_101775382 98
187 3300036647 Ga0316582_0162780 Ga0316582_0162780_621_962 98
188 3300037068 Ga0373925_1185786 Ga0373925_1185786_170_514 98
189 3300042006 Ga0439432_037550 Ga0439432_037550_59_400 98
190 3300042876 Ga0451577_0159049 Ga0451577_0159049_89_421 98
191 3300044712 Ga0453684_0033054 Ga0453684_0033054_3375_3716 98
192 3300046501 Ga0495607_0000499 Ga0495607_0000499_25624_25992 98
193 3300046506 Ga0495583_0001927 Ga0495583_0001927_15735_16073 98
194 3300046519 Ga0495632_0003368 Ga0495632_0003368_4105_4443 98
195 3300046520 Ga0495637_0008817 Ga0495637_0008817_1684_2022 98
196 3300046542 Ga0495597_0143864 Ga0495597_0143864_433_801 98
197 3300047320 Ga0495672_0358719 Ga0495672_0358719_281_649 98
198 iso_pu_bacteria 8033232454 8033235048 98
199 3300031251 Ga0265327_10000778 Ga0265327_1000077852 99
200 3300031344 Ga0265316_10006286 Ga0265316_1000628613 99
201 3300045051 Ga0451576_1498798 Ga0451576_1498798_82_423 99
202 3300046471 Ga0495650_0001732 Ga0495650_0001732_11030_11422 99
203 3300046474 Ga0495605_0123300 Ga0495605_0123300_241_642 99
204 3300046491 Ga0495584_0059493 Ga0495584_0059493_630_1031 99
205 3300046501 Ga0495607_0003278 Ga0495607_0003278_7388_7726 99
206 3300046501 Ga0495607_0009325 Ga0495607_0009325_2911_3249 99
207 3300046501 Ga0495607_0176244 Ga0495607_0176244_446_847 99
208 3300046507 Ga0495606_0357211 Ga0495606_0357211_68_469 99
209 3300046512 Ga0495610_0016821 Ga0495610_0016821_3091_3546 99
210 3300046515 Ga0495620_0000665 Ga0495620_0000665_5340_5678 99
211 3300046519 Ga0495632_0172624 Ga0495632_0172624_363_764 99
212 3300046522 Ga0495643_0014901 Ga0495643_0014901_1644_2045 99
213 3300046665 Ga0495661_0000216 Ga0495661_0000216_17759_18160 99
214 3300046665 Ga0495661_0000890 Ga0495661_0000890_11082_11474 99
215 3300046694 Ga0495649_0104166 Ga0495649_0104166_293_694 99
216 3300047321 Ga0495676_0000024 Ga0495676_0000024_37986_38384 99
217 3300047469 Ga0495673_0162716 Ga0495673_0162716_226_627 99
218 3300047470 Ga0495681_0003513 Ga0495681_0003513_6665_7066 99
219 3300049459 Ga0495678_019795 Ga0495678_019795_2196_2597 99
220 3300049460 Ga0495682_0000504 Ga0495682_0000504_21639_21977 99
221 3300009011 Ga0105251_10000697 Ga0105251_1000069715 100
222 3300009011 Ga0105251_10033032 Ga0105251_100330325 100
223 3300025728 Ga0207655_1030275 Ga0207655_10302752 100
224 3300025735 Ga0207713_1000138 Ga0207713_100013864 100
225 3300027471 Ga0209995_1002942 Ga0209995_10029424 100
226 3300027526 Ga0209968_1001699 Ga0209968_10016992 100
227 3300027552 Ga0209982_1021433 Ga0209982_10214332 100
228 3300027665 Ga0209983_1005062 Ga0209983_10050622 100
229 3300027682 Ga0209971_1001792 Ga0209971_10017924 100
230 3300027876 Ga0209974_10012183 Ga0209974_100121832 100
231 3300031727 Ga0316576_10470410 Ga0316576_104704102 100
232 3300033180 Ga0307510_10149163 Ga0307510_101491633 100
233 3300042876 Ga0451577_0454645 Ga0451577_0454645_785_1123 100
234 3300044712 Ga0453684_1903592 Ga0453684_1903592_71_409 100
235 3300046452 Ga0495617_023800 Ga0495617_023800_184_522 100
236 3300046453 Ga0495627_012100 Ga0495627_012100_1338_1676 100
237 3300046458 Ga0495591_001816 Ga0495591_001816_7447_7785 100
238 3300046458 Ga0495591_011903 Ga0495591_011903_2875_3213 100
239 3300046471 Ga0495650_0008101 Ga0495650_0008101_3477_3815 100
240 3300046474 Ga0495605_0000221 Ga0495605_0000221_15001_15339 100
241 3300046474 Ga0495605_0337596 Ga0495605_0337596_256_594 100
242 3300046492 Ga0495585_0081676 Ga0495585_0081676_699_1037 100
243 3300046499 Ga0495594_0022974 Ga0495594_0022974_2029_2367 100
244 3300046501 Ga0495607_0010054 Ga0495607_0010054_4660_4998 100
245 3300046506 Ga0495583_0000168 Ga0495583_0000168_73262_73600 100
246 3300046506 Ga0495583_0000368 Ga0495583_0000368_54567_54905 100
247 3300046507 Ga0495606_0246370 Ga0495606_0246370_627_965 100
248 3300046512 Ga0495610_0034348 Ga0495610_0034348_496_834 100
249 3300046513 Ga0495616_0088126 Ga0495616_0088126_997_1335 100
250 3300046515 Ga0495620_0000191 Ga0495620_0000191_44350_44688 100
251 3300046518 Ga0495631_0018931 Ga0495631_0018931_507_845 100
252 3300046518 Ga0495631_0032271 Ga0495631_0032271_1420_1758 100
253 3300046519 Ga0495632_0042585 Ga0495632_0042585_292_630 100
254 3300046520 Ga0495637_0000609 Ga0495637_0000609_22727_23065 100
255 3300046520 Ga0495637_0136330 Ga0495637_0136330_476_814 100
256 3300046523 Ga0495644_0006244 Ga0495644_0006244_200_538 100
257 3300046524 Ga0495648_0004191 Ga0495648_0004191_8161_8499 100
258 3300046530 Ga0495654_0011949 Ga0495654_0011949_1394_1732 100
259 3300046530 Ga0495654_0226411 Ga0495654_0226411_104_442 100
260 3300046538 Ga0495609_0000159 Ga0495609_0000159_15269_15607 100
261 3300046542 Ga0495597_0001813 Ga0495597_0001813_5910_6248 100
262 3300046558 Ga0495633_0000237 Ga0495633_0000237_15269_15607 100
263 3300046616 Ga0495668_0034387 Ga0495668_0034387_737_1075 100
264 3300046648 Ga0495611_0000524 Ga0495611_0000524_21981_22319 100
265 3300046648 Ga0495611_0001614 Ga0495611_0001614_4788_5126 100
266 3300046665 Ga0495661_0001745 Ga0495661_0001745_15020_15358 100
267 3300046691 Ga0495670_0179461 Ga0495670_0179461_726_1064 100
268 3300046692 Ga0495671_0020854 Ga0495671_0020854_2264_2602 100
269 3300046694 Ga0495649_0395698 Ga0495649_0395698_17_355 100
270 3300046794 Ga0495589_0001872 Ga0495589_0001872_5790_6128 100
271 3300046810 Ga0495660_0014644 Ga0495660_0014644_2860_3198 100
272 3300046810 Ga0495660_0033832 Ga0495660_0033832_126_464 100
273 3300047320 Ga0495672_0217396 Ga0495672_0217396_235_573 100
274 3300047323 Ga0495683_0000147 Ga0495683_0000147_15008_15346 100
275 3300047446 Ga0495679_000142 Ga0495679_000142_12800_13138 100
276 3300047446 Ga0495679_059208 Ga0495679_059208_75_413 100
277 3300047469 Ga0495673_0020228 Ga0495673_0020228_1030_1368 100
278 3300047469 Ga0495673_0055514 Ga0495673_0055514_1254_1592 100
279 3300048091 Ga0495626_0000061 Ga0495626_0000061_107383_107721 100
280 3300048921 Ga0496118_0112885 Ga0496118_0112885_172_510 100
281 3300048924 Ga0496121_0002405 Ga0496121_0002405_21380_21718 100
282 3300048925 Ga0496122_0003936 Ga0496122_0003936_75_413 100
283 3300048925 Ga0496122_0055052 Ga0496122_0055052_759_1097 100
284 3300048926 Ga0496123_0000080 Ga0496123_0000080_61598_61936 100
285 3300048926 Ga0496123_0036288 Ga0496123_0036288_2248_2586 100
286 3300049459 Ga0495678_000254 Ga0495678_000254_15018_15356 100
287 2162886007 SwRhRL2b_contig_1228505 SwRhRL2b_0828.00007870 101
288 2162886007 SwRhRL2b_contig_692490 SwRhRL2b_0333.00007530 101
289 3300005289 Ga0065704_10097703 Ga0065704_100977033 101
290 3300006058 Ga0075432_10479161 Ga0075432_104791611 101
291 3300009011 Ga0105251_10431685 Ga0105251_104316852 101
292 3300009036 Ga0105244_10039855 Ga0105244_100398553 101
293 3300009092 Ga0105250_10062799 Ga0105250_100627991 101
294 3300013102 Ga0157371_10040185 Ga0157371_100401853 101
295 3300013105 Ga0157369_10763099 Ga0157369_107630992 101
296 3300013306 Ga0163162_10008507 Ga0163162_100085076 101
297 3300015261 Ga0182006_1013566 Ga0182006_10135663 101
298 3300025711 Ga0207696_1002455 Ga0207696_10024552 101
299 3300025711 Ga0207696_1024711 Ga0207696_10247112 101
300 3300025728 Ga0207655_1001764 Ga0207655_10017642 101
301 3300025735 Ga0207713_1007290 Ga0207713_10072907 101
302 3300025735 Ga0207713_1085013 Ga0207713_10850132 101
303 3300027312 Ga0209371_1000320 Ga0209371_100032033 101
304 3300027312 Ga0209371_1000490 Ga0209371_100049025 101
305 3300028653 Ga0265323_10029465 Ga0265323_100294652 101
306 3300030500 Ga0268256_1000279 Ga0268256_100027933 101
307 3300030500 Ga0268256_1000419 Ga0268256_100041911 101
308 3300031344 Ga0265316_10003670 Ga0265316_100036708 101
309 3300031548 Ga0307408_100000063 Ga0307408_100000063101 101
310 3300031824 Ga0307413_11250945 Ga0307413_112509452 101
311 3300031901 Ga0307406_10000270 Ga0307406_1000027023 101
312 3300032004 Ga0307414_10001978 Ga0307414_100019782 101
313 3300032004 Ga0307414_10002242 Ga0307414_100022422 101
314 3300032005 Ga0307411_11155040 Ga0307411_111550401 101
315 3300032137 Ga0316585_10233825 Ga0316585_102338252 101
316 3300035085 Ga0373929_0045964 Ga0373929_0045964_437_775 101
317 3300035242 Ga0373962_0010175 Ga0373962_0010175_872_1210 101
318 3300035691 Ga0373931_0084234 Ga0373931_0084234_1348_1686 101
319 3300039447 Ga0436361_0821130 Ga0436361_0821130_135_476 101
320 3300039447 Ga0436361_1171507 Ga0436361_1171507_836_1177 101
321 3300042006 Ga0439432_011969 Ga0439432_011969_984_1325 101
322 3300042012 Ga0439455_0136737 Ga0439455_0136737_288_629 101
323 3300042136 Ga0450900_016066 Ga0450900_016066_598_939 101
324 3300042142 Ga0450905_001225 Ga0450905_001225_134_475 101
325 3300042142 Ga0450905_004801 Ga0450905_004801_611_952 101
326 3300042439 Ga0439464_0008051 Ga0439464_0008051_262_603 101
327 3300042439 Ga0439464_0205350 Ga0439464_0205350_182_523 101
328 3300042876 Ga0451577_0084878 Ga0451577_0084878_1741_2079 101
329 3300044673 Ga0453683_0072540 Ga0453683_0072540_1490_1828 101
330 3300044712 Ga0453684_0240578 Ga0453684_0240578_565_903 101
331 3300045051 Ga0451576_0000119 Ga0451576_0000119_34760_35098 101
332 3300046453 Ga0495627_000165 Ga0495627_000165_44905_45249 101
333 3300046471 Ga0495650_0001687 Ga0495650_0001687_968_1369 101
334 3300046501 Ga0495607_0208747 Ga0495607_0208747_299_643 101
335 3300046507 Ga0495606_0001118 Ga0495606_0001118_16603_16995 101
336 3300046512 Ga0495610_0038429 Ga0495610_0038429_12_413 101
337 3300046515 Ga0495620_0100484 Ga0495620_0100484_741_1142 101
338 3300046522 Ga0495643_0004157 Ga0495643_0004157_8990_9331 101
339 3300046524 Ga0495648_0014448 Ga0495648_0014448_3601_4002 101
340 3300046530 Ga0495654_0000761 Ga0495654_0000761_4399_4800 101
341 3300046538 Ga0495609_0000099 Ga0495609_0000099_82986_83387 101
342 3300046660 Ga0495625_0000050 Ga0495625_0000050_118629_119030 101
343 3300047323 Ga0495683_0045436 Ga0495683_0045436_363_764 101
344 3300047446 Ga0495679_103958 Ga0495679_103958_118_519 101
345 3300047469 Ga0495673_0000005 Ga0495673_0000005_636993_637334 101
346 3300047472 Ga0495686_0038162 Ga0495686_0038162_1798_2199 101
347 3300048917 Ga0496114_0195118 Ga0496114_0195118_324_665 101
348 3300048920 Ga0496117_0000600 Ga0496117_0000600_37546_37890 101
349 3300048920 Ga0496117_0016894 Ga0496117_0016894_1245_1586 101
350 3300048921 Ga0496118_0218807 Ga0496118_0218807_94_435 101
351 3300048924 Ga0496121_0141994 Ga0496121_0141994_251_592 101
352 3300048925 Ga0496122_0037053 Ga0496122_0037053_2214_2555 101
353 3300048926 Ga0496123_0003867 Ga0496123_0003867_12730_13071 101
354 3300048926 Ga0496123_0036989 Ga0496123_0036989_566_907 101
355 3300048927 Ga0496124_0009384 Ga0496124_0009384_8980_9321 101
356 3300048928 Ga0496125_0033057 Ga0496125_0033057_1046_1387 101
357 3300048929 Ga0496126_0053311 Ga0496126_0053311_583_924 101
358 3300049460 Ga0495682_0001999 Ga0495682_0001999_559_900 101
359 3300049571 Ga0501034_0000131 Ga0501034_0000131_101743_102084 101
360 3300053140 Ga0500573_0034258 Ga0500573_0034258_2518_2862 101
361 3300055283 Ga0500661_037794 Ga0500661_037794_95_436 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03831

YjdM

PhnA domain

53

120

0.98

PF08274

YjdM_Zn_Ribbon

PhnA Zinc-Ribbon

20

40

0.96

Feature Viewer

pLDDT pTM Quality
72.76 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map