F422282

General Info

Members Datasets Scaffolds Average Seq Length
361 226 722 185

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0027878|Ga0316574_0027878_666_1220
Length 184
Sequence MGHRLSKIYTRTGDAGTTGLGNGERVAKDHPRVEAYGTVDELNSAIGVVLACDPPAPIAGCLTEVQHDLFEVGGELCMPEYRAVTSAQVENLERTLDALNADLPPLKEFILPGGGPAAAACHLARTICRRAERRIWTLARDAEVNEALPRYLNRLSDLLFVAARVLARHEHGSEVLWRHDRGAG

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0
Rhizoplane 8.03
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0027878 3300035398 Bacteria 3403
2 JGI25406J46586_10006862 3300003203 Bacteria 5227
3 rootL2_10136436 3300003322 Bacteria 1280
4 Ga0065712_10001122 3300005290 Bacteria 7895
5 Ga0065715_10113334 3300005293 Bacteria 2494
6 Ga0065707_10082388 3300005295 Bacteria 15766
7 Ga0070683_100094488 3300005329 Bacteria 2810
8 Ga0070690_100001093 3300005330 Bacteria 13935
9 Ga0070670_100033404 3300005331 Bacteria 4431
10 Ga0068869_100000529 3300005334 Bacteria 21265
11 Ga0068869_100129949 3300005334 Bacteria 1935
12 Ga0070666_10023759 3300005335 Bacteria 3992
13 Ga0070666_10279980 3300005335 Bacteria 1185
14 Ga0070680_100002922 3300005336 Bacteria 12702
15 Ga0070680_100494474 3300005336 Bacteria 1046
16 Ga0070682_100062489 3300005337 Bacteria 2359
17 Ga0070682_100739387 3300005337 Bacteria 793
18 Ga0068868_100017628 3300005338 Bacteria 5325
19 Ga0068868_100153579 3300005338 Bacteria 1897
20 Ga0068868_100240206 3300005338 Bacteria 1522
21 Ga0070660_100418652 3300005339 Bacteria 1109
22 Ga0070689_100010318 3300005340 Bacteria 6659
23 Ga0070661_100002396 3300005344 Bacteria 12854
24 Ga0070661_100574610 3300005344 Bacteria 909
25 Ga0070668_100067466 3300005347 Bacteria 2779
26 Ga0070675_100022808 3300005354 Bacteria 5001
27 Ga0070671_100002695 3300005355 Bacteria 13771
28 Ga0070674_100162367 3300005356 Bacteria 1696
29 Ga0070673_100001487 3300005364 Bacteria 13745
30 Ga0070673_100306612 3300005364 Bacteria 1399
31 Ga0070688_100012028 3300005365 Bacteria 4834
32 Ga0070667_100052353 3300005367 Bacteria 3445
33 Ga0070667_100053465 3300005367 Bacteria 3408
34 Ga0070667_100207578 3300005367 Bacteria 1740
35 Ga0070709_10025346 3300005434 Bacteria 3503
36 Ga0070709_10246688 3300005434 Bacteria 1285
37 Ga0070714_100014198 3300005435 Bacteria 6395
38 Ga0070713_100024043 3300005436 Bacteria 4739
39 Ga0070713_100101533 3300005436 Bacteria 2492
40 Ga0070710_10070522 3300005437 Bacteria 2013
41 Ga0070711_100009105 3300005439 Bacteria 6103
42 Ga0070711_100031748 3300005439 Bacteria 3509
43 Ga0070705_100002350 3300005440 Bacteria 9536
44 Ga0070705_100083839 3300005440 Bacteria 1965
45 Ga0070663_101030002 3300005455 Bacteria 717
46 Ga0070678_100327554 3300005456 Bacteria 1310
47 Ga0070662_100001428 3300005457 Bacteria 14750
48 Ga0070681_10007547 3300005458 Bacteria 10627
49 Ga0070681_10012223 3300005458 Bacteria 8512
50 Ga0070681_10041716 3300005458 Bacteria 4600
51 Ga0070681_10085617 3300005458 Bacteria 3104
52 Ga0070681_10202894 3300005458 Bacteria 1901
53 Ga0070685_10003567 3300005466 Bacteria 7899
54 Ga0070699_100512389 3300005518 Bacteria 1090
55 Ga0070679_100000821 3300005530 Bacteria 26983
56 Ga0070679_100021309 3300005530 Bacteria 6325
57 Ga0070679_100053691 3300005530 Bacteria 4011
58 Ga0070679_100130035 3300005530 Bacteria 2499
59 Ga0070679_100130133 3300005530 Bacteria 2498
60 Ga0070679_100386582 3300005530 Bacteria 1346
61 Ga0070684_100004710 3300005535 Bacteria 10417
62 Ga0070684_100331891 3300005535 Bacteria 1398
63 Ga0068853_100695992 3300005539 Bacteria 969
64 Ga0070672_100149765 3300005543 Bacteria 1930
65 Ga0070695_100316294 3300005545 Bacteria 1159
66 Ga0070693_100544347 3300005547 Bacteria 830
67 Ga0070665_100015242 3300005548 Bacteria 7717
68 Ga0070665_100017600 3300005548 Bacteria 7178
69 Ga0070665_100039722 3300005548 Bacteria 4730
70 Ga0068855_100002601 3300005563 Bacteria 22253
71 Ga0068855_100004359 3300005563 Bacteria 17300
72 Ga0068855_100086634 3300005563 Bacteria 3622
73 Ga0070664_100024322 3300005564 Bacteria 5009
74 Ga0068857_100016360 3300005577 Bacteria 6499
75 Ga0068856_100013070 3300005614 Bacteria 8041
76 Ga0070702_100001019 3300005615 Bacteria 11112
77 Ga0068852_100176510 3300005616 Bacteria 2006
78 Ga0068852_100380216 3300005616 Bacteria 1385
79 Ga0068859_100005782 3300005617 Bacteria 12566
80 Ga0068859_100888602 3300005617 Bacteria 976
81 Ga0068864_100001343 3300005618 Bacteria 20448
82 Ga0068866_10083846 3300005718 Bacteria 1718
83 Ga0068861_100049076 3300005719 Bacteria 3194
84 Ga0068861_100279961 3300005719 Bacteria 1436
85 Ga0068870_10003328 3300005840 Bacteria 6794
86 Ga0068863_100002407 3300005841 Bacteria 18585
87 Ga0068863_100015052 3300005841 Bacteria 7432
88 Ga0068858_100010307 3300005842 Bacteria 8858
89 Ga0068860_100013367 3300005843 Bacteria 8048
90 Ga0068860_100026861 3300005843 Bacteria 5547
91 Ga0068862_100002546 3300005844 Bacteria 16122
92 Ga0068862_100234708 3300005844 Bacteria 1665
93 Ga0081455_10003053 3300005937 Bacteria 19501
94 Ga0081539_10000011 3300005985 Bacteria 461887
95 Ga0070717_10296027 3300006028 Bacteria 1438
96 Ga0070715_10001962 3300006163 Bacteria 6198
97 Ga0070716_100000879 3300006173 Bacteria 12963
98 Ga0070716_100012414 3300006173 Bacteria 4318
99 Ga0070712_100022073 3300006175 Bacteria 4189
100 Ga0070712_100024883 3300006175 Bacteria 3972
101 Ga0097621_100002159 3300006237 Bacteria 13461
102 Ga0097621_100101581 3300006237 Bacteria 2420
103 Ga0068871_100017466 3300006358 Bacteria 5430
104 Ga0068871_100028160 3300006358 Bacteria 4402
105 Ga0068871_100304439 3300006358 Bacteria 1400
106 Ga0068871_100367624 3300006358 Bacteria 1275
107 Ga0075430_100134406 3300006846 Bacteria 2061
108 Ga0068865_100011247 3300006881 Bacteria 5595
109 Ga0068865_100015321 3300006881 Bacteria 4888
110 Ga0068865_100614280 3300006881 Bacteria 920
111 Ga0097620_100005782 3300006931 Bacteria 12566
112 Ga0097620_100888463 3300006931 Bacteria 976
113 Ga0099794_10079205 3300007265 Bacteria 1618
114 Ga0105240_10003246 3300009093 Bacteria 25453
115 Ga0105240_10003362 3300009093 Bacteria 24885
116 Ga0105240_10029451 3300009093 Bacteria 7152
117 Ga0105240_10087172 3300009093 Bacteria 3823
118 Ga0105240_10169478 3300009093 Bacteria 2587
119 Ga0111539_10033008 3300009094 Bacteria 6285
120 Ga0105245_10034166 3300009098 Bacteria 4509
121 Ga0105247_10018835 3300009101 Bacteria 4145
122 Ga0105247_10048312 3300009101 Bacteria 2613
123 Ga0105247_10408923 3300009101 Bacteria 969
124 Ga0105243_10206335 3300009148 Bacteria 1727
125 Ga0105241_10074551 3300009174 Bacteria 2643
126 Ga0105241_10142670 3300009174 Bacteria 1952
127 Ga0105242_10001597 3300009176 Bacteria 17834
128 Ga0105242_10213835 3300009176 Bacteria 1720
129 Ga0105248_10006501 3300009177 Bacteria 12816
130 Ga0105248_10027353 3300009177 Bacteria 6348
131 Ga0105237_10039886 3300009545 Bacteria 4737
132 Ga0105237_10070059 3300009545 Bacteria 3502
133 Ga0105237_10147449 3300009545 Bacteria 2348
134 Ga0105238_10002269 3300009551 Bacteria 19366
135 Ga0105238_10023319 3300009551 Bacteria 6309
136 Ga0105238_10218541 3300009551 Bacteria 1881
137 Ga0105238_10451193 3300009551 Bacteria 1283
138 Ga0105249_10009153 3300009553 Bacteria 8659
139 Ga0105249_10742282 3300009553 Bacteria 1043
140 Ga0105239_10158330 3300010375 Bacteria 2530
141 Ga0105239_10219409 3300010375 Bacteria 2133
142 Ga0157369_10006474 3300013105 Bacteria 13573
143 Ga0157369_10030768 3300013105 Bacteria 5918
144 Ga0157374_10001898 3300013296 Bacteria 17507
145 Ga0157374_10203863 3300013296 Bacteria 1937
146 Ga0157378_10013865 3300013297 Bacteria 7051
147 Ga0163162_10022836 3300013306 Bacteria 6169
148 Ga0163162_10025999 3300013306 Bacteria 5785
149 Ga0157372_10618967 3300013307 Bacteria 1262
150 Ga0157375_10017966 3300013308 Bacteria 6402
151 Ga0157375_10081053 3300013308 Bacteria 3285
152 Ga0163163_10020251 3300014325 Bacteria 6262
153 Ga0163163_10156452 3300014325 Bacteria 2324
154 Ga0163163_11637924 3300014325 Bacteria 704
155 Ga0157377_10024023 3300014745 Bacteria 3237
156 Ga0157379_10225583 3300014968 Bacteria 1698
157 Ga0157376_10236936 3300014969 Bacteria 1698
158 Ga0213874_10005149 3300021377 Bacteria 3032
159 Ga0213874_10056673 3300021377 Bacteria 1217
160 Ga0213871_10032078 3300021441 Bacteria 1375
161 Ga0207692_10021917 3300025898 Bacteria 2931
162 Ga0207642_10005117 3300025899 Bacteria 4267
163 Ga0207710_10014552 3300025900 Bacteria 3320
164 Ga0207710_10056659 3300025900 Bacteria 1769
165 Ga0207688_10058348 3300025901 Bacteria 2172
166 Ga0207680_10083879 3300025903 Bacteria 2009
167 Ga0207680_10136303 3300025903 Bacteria 1623
168 Ga0207680_10204868 3300025903 Bacteria 1346
169 Ga0207685_10015536 3300025905 Bacteria 2415
170 Ga0207699_10241408 3300025906 Bacteria 1241
171 Ga0207699_10341043 3300025906 Bacteria 1056
172 Ga0207643_10373870 3300025908 Bacteria 898
173 Ga0207705_10558809 3300025909 Bacteria 890
174 Ga0207654_10106086 3300025911 Bacteria 1739
175 Ga0207654_10292082 3300025911 Bacteria 1106
176 Ga0207707_10001109 3300025912 Bacteria 25562
177 Ga0207707_10009956 3300025912 Bacteria 8243
178 Ga0207707_10026365 3300025912 Bacteria 5080
179 Ga0207707_10031173 3300025912 Bacteria 4664
180 Ga0207707_10109969 3300025912 Bacteria 2409
181 Ga0207707_10189658 3300025912 Bacteria 1793
182 Ga0207695_10002304 3300025913 Bacteria 28458
183 Ga0207695_10028164 3300025913 Bacteria 6238
184 Ga0207695_10076037 3300025913 Bacteria 3414
185 Ga0207695_10143334 3300025913 Bacteria 2335
186 Ga0207695_10251486 3300025913 Unclassified 1666
187 Ga0207695_10296555 3300025913 Bacteria 1508
188 Ga0207693_10000114 3300025915 Bacteria 73026
189 Ga0207693_10030961 3300025915 Bacteria 4227
190 Ga0207663_10031815 3300025916 Bacteria 3126
191 Ga0207660_10002241 3300025917 Bacteria 12775
192 Ga0207660_10349468 3300025917 Bacteria 1185
193 Ga0207657_10107507 3300025919 Bacteria 2308
194 Ga0207652_10046463 3300025921 Bacteria 3704
195 Ga0207652_10183596 3300025921 Bacteria 1880
196 Ga0207652_10515522 3300025921 Bacteria 1076
197 Ga0207694_10011143 3300025924 Bacteria 6787
198 Ga0207694_10093799 3300025924 Bacteria 2371
199 Ga0207650_10021855 3300025925 Bacteria 4525
200 Ga0207659_10015027 3300025926 Bacteria 5006
201 Ga0207700_10077110 3300025928 Bacteria 2588
202 Ga0207700_10155309 3300025928 Bacteria 1895
203 Ga0207700_10237728 3300025928 Bacteria 1551
204 Ga0207700_10639990 3300025928 Bacteria 948
205 Ga0207700_11397845 3300025928 Bacteria 622
206 Ga0207664_10030350 3300025929 Bacteria 4128
207 Ga0207664_10855354 3300025929 Bacteria 817
208 Ga0207644_10043949 3300025931 Bacteria 3172
209 Ga0207706_10088820 3300025933 Bacteria 2717
210 Ga0207686_10028215 3300025934 Bacteria 3297
211 Ga0207686_10064114 3300025934 Bacteria 2339
212 Ga0207709_10131838 3300025935 Bacteria 1704
213 Ga0207670_10197143 3300025936 Bacteria 1527
214 Ga0207704_10018767 3300025938 Bacteria 3618
215 Ga0207704_10027948 3300025938 Bacteria 3121
216 Ga0207665_10001700 3300025939 Bacteria 14796
217 Ga0207665_10024393 3300025939 Bacteria 3986
218 Ga0207691_10063440 3300025940 Bacteria 3351
219 Ga0207711_10010696 3300025941 Bacteria 7631
220 Ga0207689_10005277 3300025942 Bacteria 11582
221 Ga0207689_10232251 3300025942 Bacteria 1524
222 Ga0207661_10087021 3300025944 Bacteria 2594
223 Ga0207667_10003279 3300025949 Bacteria 19978
224 Ga0207667_10058798 3300025949 Bacteria 4030
225 Ga0207651_10009381 3300025960 Bacteria 5354
226 Ga0207712_10055071 3300025961 Bacteria 2796
227 Ga0207668_10057223 3300025972 Bacteria 2719
228 Ga0207658_10001938 3300025986 Bacteria 15448
229 Ga0207658_10028861 3300025986 Bacteria 3911
230 Ga0207658_10223750 3300025986 Bacteria 1584
231 Ga0207677_10393952 3300026023 Bacteria 1172
232 Ga0207677_10395478 3300026023 Bacteria 1170
233 Ga0207677_10525507 3300026023 Bacteria 1027
234 Ga0207703_10009608 3300026035 Bacteria 7593
235 Ga0207703_10202837 3300026035 Bacteria 1763
236 Ga0207678_10922418 3300026067 Bacteria 772
237 Ga0207641_10151938 3300026088 Bacteria 2097
238 Ga0207648_10043949 3300026089 Bacteria 3921
239 Ga0207676_10006664 3300026095 Bacteria 8165
240 Ga0207676_10653513 3300026095 Bacteria 1015
241 Ga0207675_100002933 3300026118 Bacteria 16773
242 Ga0207683_10030415 3300026121 Bacteria 4679
243 Ga0207683_10030919 3300026121 Bacteria 4643
244 Ga0207698_10395703 3300026142 Bacteria 1319
245 Ga0207698_10423435 3300026142 Bacteria 1278
246 Ga0268266_10008114 3300028379 Bacteria 9375
247 Ga0268266_10104991 3300028379 Bacteria 2495
248 Ga0268266_10889130 3300028379 Bacteria 861
249 Ga0268265_10014455 3300028380 Bacteria 5378
250 Ga0268265_11575944 3300028380 Bacteria 661
251 Ga0268264_10031780 3300028381 Bacteria 4329
252 Ga0268264_10192206 3300028381 Bacteria 1862
253 Ga0307515_10109524 3300028794 Bacteria 3242
254 Ga0265328_10004100 3300031239 Bacteria 6366
255 Ga0265339_10279346 3300031249 Bacteria 801
256 Ga0265331_10117677 3300031250 Bacteria 1216
257 Ga0265316_10138348 3300031344 Bacteria 1831
258 Ga0307513_10059659 3300031456 Bacteria 4049
259 Ga0307509_10106587 3300031507 Bacteria 2821
260 Ga0316575_10002715 3300031665 Bacteria 5970
261 Ga0316576_10007109 3300031727 Bacteria 7017
262 Ga0316576_10064669 3300031727 Bacteria 2687
263 Ga0316578_10548609 3300031728 Bacteria 679
264 Ga0307409_100614504 3300031995 Bacteria 1076
265 Ga0307414_10014113 3300032004 Bacteria 4776
266 Ga0316585_10143726 3300032137 Bacteria 787
267 Ga0373958_0011601 3300034819 Bacteria 1492
268 Ga0373923_0031841 3300035111 Bacteria 2128
269 Ga0373923_0247969 3300035111 Bacteria 833
270 Ga0373945_0019799 3300035116 Bacteria 2299
271 Ga0373954_0169394 3300035118 Bacteria 1069
272 Ga0316574_0005278 3300035398 Bacteria 6880
273 Ga0316574_0055750 3300035398 Bacteria 2470
274 Ga0373927_0146994 3300035695 Bacteria 1543
275 Ga0316582_0004706 3300036647 Bacteria 6941
276 Ga0316584_0559761 3300036712 Bacteria 797
277 Ga0373925_0305153 3300037068 Bacteria 1286
278 Ga0373925_0993701 3300037068 Bacteria 691
279 Ga0436360_0569795 3300039438 Bacteria 10646
280 Ga0436360_0878854 3300039438 Bacteria 3236
281 Ga0436363_0223990 3300039450 Bacteria 17177
282 Ga0436363_1698600 3300039450 Bacteria 5389
283 Ga0451800_0184167 3300041459 Bacteria 861
284 Ga0451804_0648273 3300041463 Bacteria 907
285 Ga0466969_0000360 3300044656 Bacteria 25056
286 Ga0466969_0002731 3300044656 Bacteria 9433
287 Ga0466972_0092681 3300044658 Bacteria 1432
288 Ga0466965_0187431 3300044683 Bacteria 1093
289 Ga0466966_0002415 3300044684 Bacteria 12207
290 Ga0466966_0095845 3300044684 Bacteria 1838
291 Ga0466966_0319767 3300044684 Bacteria 932
292 Ga0466961_0004563 3300044693 Bacteria 8686
293 Ga0453684_0199050 3300044712 Bacteria 2336
294 Ga0466971_0000246 3300044719 Bacteria 20770
295 Ga0466957_0018506 3300044842 Bacteria 4092
296 Ga0466960_0146875 3300044901 Bacteria 1256
297 Ga0466959_0000574 3300045049 Bacteria 21410
298 Ga0466959_0010089 3300045049 Bacteria 6736
299 Ga0466959_0114983 3300045049 Bacteria 1917
300 Ga0466959_0310317 3300045049 Bacteria 1079
301 Ga0451576_0020541 3300045051 Bacteria 7188
302 Ga0451576_0269673 3300045051 Bacteria 1779
303 Ga0495629_0153228 3300046459 Bacteria 1602
304 Ga0495638_0367924 3300046460 Bacteria 754
305 Ga0495580_0003540 3300046472 Bacteria 13266
306 Ga0495582_0222325 3300046473 Bacteria 1080
307 Ga0495594_0147783 3300046499 Bacteria 1334
308 Ga0495618_0053746 3300046514 Bacteria 2547
309 Ga0495630_0151043 3300046517 Bacteria 1767
310 Ga0495632_0271600 3300046519 Bacteria 756
311 Ga0495659_0020272 3300046664 Bacteria 2232
312 Ga0495658_0080472 3300046683 Bacteria 1911
313 Ga0495581_0217926 3300047315 Bacteria 1116
314 Ga0496100_0015872 3300048903 Bacteria 4409
315 Ga0496101_0004452 3300048904 Bacteria 8824
316 Ga0496101_0294852 3300048904 Bacteria 1269
317 Ga0496101_0403323 3300048904 Bacteria 1077
318 Ga0496102_0008903 3300048905 Bacteria 8614
319 Ga0496102_0013014 3300048905 Bacteria 7203
320 Ga0496102_0273351 3300048905 Bacteria 1593
321 Ga0496103_0077377 3300048906 Bacteria 2088
322 Ga0496104_0038447 3300048907 Bacteria 4477
323 Ga0496105_0253681 3300048908 Bacteria 1424
324 Ga0496105_0575428 3300048908 Bacteria 877
325 Ga0496106_0010725 3300048909 Bacteria 6773
326 Ga0496106_0246394 3300048909 Bacteria 1428
327 Ga0496106_0259392 3300048909 Bacteria 1391
328 Ga0496107_0016389 3300048910 Bacteria 5202
329 Ga0496107_0207734 3300048910 Bacteria 1456
330 Ga0496108_0005163 3300048911 Bacteria 10558
331 Ga0496108_0047534 3300048911 Bacteria 3587
332 Ga0496109_0007953 3300048912 Bacteria 8988
333 Ga0496109_0344271 3300048912 Bacteria 1408
334 Ga0496110_0014412 3300048913 Bacteria 6563
335 Ga0496110_0037714 3300048913 Bacteria 4201
336 Ga0496111_0004212 3300048914 Bacteria 9057
337 Ga0496112_0036465 3300048915 Bacteria 4797
338 Ga0496113_0043082 3300048916 Bacteria 3338
339 Ga0496114_0049449 3300048917 Bacteria 3498
340 Ga0496115_0007468 3300048918 Bacteria 8044
341 Ga0496118_0285486 3300048921 Bacteria 915
342 Ga0501046_0026779 3300049580 Bacteria 4709
343 nmdc:mga08x19_111824_c1 3300050514 Bacteria 1822
344 nmdc:mga0a205_420594_c1 3300050515 Bacteria 1198
345 Ga0495601_0118692 3300053077 Bacteria 1717
346 Ga0500583_0002970 3300053092 Bacteria 5229
347 Ga0500583_0034662 3300053092 Bacteria 2245
348 Ga0500556_0000763 3300053104 Bacteria 19092
349 Ga0500562_084480 3300053108 Bacteria 860
350 Ga0500569_132179 3300053109 Bacteria 836
351 Ga0500614_027952 3300053123 Bacteria 1360
352 Ga0500621_159426 3300053126 Bacteria 838
353 Ga0500559_0165478 3300053136 Bacteria 1040
354 Ga0500568_0053885 3300053139 Bacteria 1575
355 Ga0500588_0018411 3300053146 Bacteria 1839
356 Ga0500616_0000182 3300053153 Bacteria 103375
357 Ga0500622_0005754 3300053156 Bacteria 7363
358 Ga0500622_0067263 3300053156 Bacteria 1818
359 Ga0500633_0041420 3300053160 Bacteria 1550
360 Ga0500637_0008077 3300053178 Bacteria 5288
361 Ga0466962_0002441 3300061719 Bacteria 8811
362 Ga0316574_0027878
363 JGI25406J46586_10006862
364 rootL2_10136436
365 Ga0065712_10001122
366 Ga0065715_10113334
367 Ga0065707_10082388
368 Ga0070683_100094488
369 Ga0070690_100001093
370 Ga0070670_100033404
371 Ga0068869_100000529
372 Ga0068869_100129949
373 Ga0070666_10023759
374 Ga0070666_10279980
375 Ga0070680_100002922
376 Ga0070680_100494474
377 Ga0070682_100062489
378 Ga0070682_100739387
379 Ga0068868_100017628
380 Ga0068868_100153579
381 Ga0068868_100240206
382 Ga0070660_100418652
383 Ga0070689_100010318
384 Ga0070661_100002396
385 Ga0070661_100574610
386 Ga0070668_100067466
387 Ga0070675_100022808
388 Ga0070671_100002695
389 Ga0070674_100162367
390 Ga0070673_100001487
391 Ga0070673_100306612
392 Ga0070688_100012028
393 Ga0070667_100052353
394 Ga0070667_100053465
395 Ga0070667_100207578
396 Ga0070709_10025346
397 Ga0070709_10246688
398 Ga0070714_100014198
399 Ga0070713_100024043
400 Ga0070713_100101533
401 Ga0070710_10070522
402 Ga0070711_100009105
403 Ga0070711_100031748
404 Ga0070705_100002350
405 Ga0070705_100083839
406 Ga0070663_101030002
407 Ga0070678_100327554
408 Ga0070662_100001428
409 Ga0070681_10007547
410 Ga0070681_10012223
411 Ga0070681_10041716
412 Ga0070681_10085617
413 Ga0070681_10202894
414 Ga0070685_10003567
415 Ga0070699_100512389
416 Ga0070679_100000821
417 Ga0070679_100021309
418 Ga0070679_100053691
419 Ga0070679_100130035
420 Ga0070679_100130133
421 Ga0070679_100386582
422 Ga0070684_100004710
423 Ga0070684_100331891
424 Ga0068853_100695992
425 Ga0070672_100149765
426 Ga0070695_100316294
427 Ga0070693_100544347
428 Ga0070665_100015242
429 Ga0070665_100017600
430 Ga0070665_100039722
431 Ga0068855_100002601
432 Ga0068855_100004359
433 Ga0068855_100086634
434 Ga0070664_100024322
435 Ga0068857_100016360
436 Ga0068856_100013070
437 Ga0070702_100001019
438 Ga0068852_100176510
439 Ga0068852_100380216
440 Ga0068859_100005782
441 Ga0068859_100888602
442 Ga0068864_100001343
443 Ga0068866_10083846
444 Ga0068861_100049076
445 Ga0068861_100279961
446 Ga0068870_10003328
447 Ga0068863_100002407
448 Ga0068863_100015052
449 Ga0068858_100010307
450 Ga0068860_100013367
451 Ga0068860_100026861
452 Ga0068862_100002546
453 Ga0068862_100234708
454 Ga0081455_10003053
455 Ga0081539_10000011
456 Ga0070717_10296027
457 Ga0070715_10001962
458 Ga0070716_100000879
459 Ga0070716_100012414
460 Ga0070712_100022073
461 Ga0070712_100024883
462 Ga0097621_100002159
463 Ga0097621_100101581
464 Ga0068871_100017466
465 Ga0068871_100028160
466 Ga0068871_100304439
467 Ga0068871_100367624
468 Ga0075430_100134406
469 Ga0068865_100011247
470 Ga0068865_100015321
471 Ga0068865_100614280
472 Ga0097620_100005782
473 Ga0097620_100888463
474 Ga0099794_10079205
475 Ga0105240_10003246
476 Ga0105240_10003362
477 Ga0105240_10029451
478 Ga0105240_10087172
479 Ga0105240_10169478
480 Ga0111539_10033008
481 Ga0105245_10034166
482 Ga0105247_10018835
483 Ga0105247_10048312
484 Ga0105247_10408923
485 Ga0105243_10206335
486 Ga0105241_10074551
487 Ga0105241_10142670
488 Ga0105242_10001597
489 Ga0105242_10213835
490 Ga0105248_10006501
491 Ga0105248_10027353
492 Ga0105237_10039886
493 Ga0105237_10070059
494 Ga0105237_10147449
495 Ga0105238_10002269
496 Ga0105238_10023319
497 Ga0105238_10218541
498 Ga0105238_10451193
499 Ga0105249_10009153
500 Ga0105249_10742282
501 Ga0105239_10158330
502 Ga0105239_10219409
503 Ga0157369_10006474
504 Ga0157369_10030768
505 Ga0157374_10001898
506 Ga0157374_10203863
507 Ga0157378_10013865
508 Ga0163162_10022836
509 Ga0163162_10025999
510 Ga0157372_10618967
511 Ga0157375_10017966
512 Ga0157375_10081053
513 Ga0163163_10020251
514 Ga0163163_10156452
515 Ga0163163_11637924
516 Ga0157377_10024023
517 Ga0157379_10225583
518 Ga0157376_10236936
519 Ga0213874_10005149
520 Ga0213874_10056673
521 Ga0213871_10032078
522 Ga0207692_10021917
523 Ga0207642_10005117
524 Ga0207710_10014552
525 Ga0207710_10056659
526 Ga0207688_10058348
527 Ga0207680_10083879
528 Ga0207680_10136303
529 Ga0207680_10204868
530 Ga0207685_10015536
531 Ga0207699_10241408
532 Ga0207699_10341043
533 Ga0207643_10373870
534 Ga0207705_10558809
535 Ga0207654_10106086
536 Ga0207654_10292082
537 Ga0207707_10001109
538 Ga0207707_10009956
539 Ga0207707_10026365
540 Ga0207707_10031173
541 Ga0207707_10109969
542 Ga0207707_10189658
543 Ga0207695_10002304
544 Ga0207695_10028164
545 Ga0207695_10076037
546 Ga0207695_10143334
547 Ga0207695_10251486
548 Ga0207695_10296555
549 Ga0207693_10000114
550 Ga0207693_10030961
551 Ga0207663_10031815
552 Ga0207660_10002241
553 Ga0207660_10349468
554 Ga0207657_10107507
555 Ga0207652_10046463
556 Ga0207652_10183596
557 Ga0207652_10515522
558 Ga0207694_10011143
559 Ga0207694_10093799
560 Ga0207650_10021855
561 Ga0207659_10015027
562 Ga0207700_10077110
563 Ga0207700_10155309
564 Ga0207700_10237728
565 Ga0207700_10639990
566 Ga0207700_11397845
567 Ga0207664_10030350
568 Ga0207664_10855354
569 Ga0207644_10043949
570 Ga0207706_10088820
571 Ga0207686_10028215
572 Ga0207686_10064114
573 Ga0207709_10131838
574 Ga0207670_10197143
575 Ga0207704_10018767
576 Ga0207704_10027948
577 Ga0207665_10001700
578 Ga0207665_10024393
579 Ga0207691_10063440
580 Ga0207711_10010696
581 Ga0207689_10005277
582 Ga0207689_10232251
583 Ga0207661_10087021
584 Ga0207667_10003279
585 Ga0207667_10058798
586 Ga0207651_10009381
587 Ga0207712_10055071
588 Ga0207668_10057223
589 Ga0207658_10001938
590 Ga0207658_10028861
591 Ga0207658_10223750
592 Ga0207677_10393952
593 Ga0207677_10395478
594 Ga0207677_10525507
595 Ga0207703_10009608
596 Ga0207703_10202837
597 Ga0207678_10922418
598 Ga0207641_10151938
599 Ga0207648_10043949
600 Ga0207676_10006664
601 Ga0207676_10653513
602 Ga0207675_100002933
603 Ga0207683_10030415
604 Ga0207683_10030919
605 Ga0207698_10395703
606 Ga0207698_10423435
607 Ga0268266_10008114
608 Ga0268266_10104991
609 Ga0268266_10889130
610 Ga0268265_10014455
611 Ga0268265_11575944
612 Ga0268264_10031780
613 Ga0268264_10192206
614 Ga0307515_10109524
615 Ga0265328_10004100
616 Ga0265339_10279346
617 Ga0265331_10117677
618 Ga0265316_10138348
619 Ga0307513_10059659
620 Ga0307509_10106587
621 Ga0316575_10002715
622 Ga0316576_10007109
623 Ga0316576_10064669
624 Ga0316578_10548609
625 Ga0307409_100614504
626 Ga0307414_10014113
627 Ga0316585_10143726
628 Ga0373958_0011601
629 Ga0373923_0031841
630 Ga0373923_0247969
631 Ga0373945_0019799
632 Ga0373954_0169394
633 Ga0316574_0005278
634 Ga0316574_0055750
635 Ga0373927_0146994
636 Ga0316582_0004706
637 Ga0316584_0559761
638 Ga0373925_0305153
639 Ga0373925_0993701
640 Ga0436360_0569795
641 Ga0436360_0878854
642 Ga0436363_0223990
643 Ga0436363_1698600
644 Ga0451800_0184167
645 Ga0451804_0648273
646 Ga0466969_0000360
647 Ga0466969_0002731
648 Ga0466972_0092681
649 Ga0466965_0187431
650 Ga0466966_0002415
651 Ga0466966_0095845
652 Ga0466966_0319767
653 Ga0466961_0004563
654 Ga0453684_0199050
655 Ga0466971_0000246
656 Ga0466957_0018506
657 Ga0466960_0146875
658 Ga0466959_0000574
659 Ga0466959_0010089
660 Ga0466959_0114983
661 Ga0466959_0310317
662 Ga0451576_0020541
663 Ga0451576_0269673
664 Ga0495629_0153228
665 Ga0495638_0367924
666 Ga0495580_0003540
667 Ga0495582_0222325
668 Ga0495594_0147783
669 Ga0495618_0053746
670 Ga0495630_0151043
671 Ga0495632_0271600
672 Ga0495659_0020272
673 Ga0495658_0080472
674 Ga0495581_0217926
675 Ga0496100_0015872
676 Ga0496101_0004452
677 Ga0496101_0294852
678 Ga0496101_0403323
679 Ga0496102_0008903
680 Ga0496102_0013014
681 Ga0496102_0273351
682 Ga0496103_0077377
683 Ga0496104_0038447
684 Ga0496105_0253681
685 Ga0496105_0575428
686 Ga0496106_0010725
687 Ga0496106_0246394
688 Ga0496106_0259392
689 Ga0496107_0016389
690 Ga0496107_0207734
691 Ga0496108_0005163
692 Ga0496108_0047534
693 Ga0496109_0007953
694 Ga0496109_0344271
695 Ga0496110_0014412
696 Ga0496110_0037714
697 Ga0496111_0004212
698 Ga0496112_0036465
699 Ga0496113_0043082
700 Ga0496114_0049449
701 Ga0496115_0007468
702 Ga0496118_0285486
703 Ga0501046_0026779
704 nmdc:mga08x19_111824_c1
705 nmdc:mga0a205_420594_c1
706 Ga0495601_0118692
707 Ga0500583_0002970
708 Ga0500583_0034662
709 Ga0500556_0000763
710 Ga0500562_084480
711 Ga0500569_132179
712 Ga0500614_027952
713 Ga0500621_159426
714 Ga0500559_0165478
715 Ga0500568_0053885
716 Ga0500588_0018411
717 Ga0500616_0000182
718 Ga0500622_0005754
719 Ga0500622_0067263
720 Ga0500633_0041420
721 Ga0500637_0008077
722 Ga0466962_0002441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

8

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9762 30 174
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9749 29 174
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9438 30 174
3ke4-assembly1.cif.gz_B crystal structure of a pduo-type atp:cob(i)alamin adenosyltransferase from bacillus cereus 0.9422 16 170
8g3k-assembly1.cif.gz_B cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp 0.9409 30 170
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9762 18 174 1.20.1200.10
af_Q18218_22_209_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9499 18 170 1.20.1200.10
5cy5B00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9389 30 170 1.20.1200.10
2r6xB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9358 26 165 1.20.1200.10
5cy5A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9352 29 166 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A0S6YZY4-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9855 49 169 GO:0005524
GO:0008817
GO:0009236
AF-A0A1E4HHH5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.985 55 170 GO:0005524
GO:0008817
GO:0009236
AF-A0A6I2ZQM8-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9845 26 170 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D0STD6-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9835 34 173 GO:0005524
GO:0008817
GO:0009236
AF-A0A4Q3HWJ1-F1-model_v4 deleted 0.979 14 174

Map