F422238

General Info

Members Datasets Scaffolds Average Seq Length
361 250 315 331

Family's Representative Sequence

Representative Sequence 3300025231|Ga0207427_100147|Ga0207427_10014753
Length 376
Sequence MPALGRGLGVSGHETFSISDSTQRRTQRGYMPITTAPYSGMRSTSLLITMNRMSLINRQLRLKTRPEGMVSREDFDLVEQLVPELRDGEVLVRVLYLSMDPTNRVWMRDIPQYLPPVAIGEVMRALGLGRVVQSRSTQYQEGDLVQGVTGWQDYLVLHDSAKGYVRLPADPGIPLPTLLGACGMSGVTAYYGLTDIAPVQAGETLVVSAAAGSARVVGIAGGADKCRYLTDELGFDATVDYKAADFKQQLKAATPDGVHVNFENVGGEVMRAVLSRMVIGGRVALCGLISGYNSGERPSDDFGVFVMKRLSMRGFLVLDYTKTREAVQALSGWIREGKLKAEETVVDGLENAPVVLNRLFDGSHRGKLVLRVDPQA

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
4 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
5 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
6 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
7 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
11 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
12 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
13 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
14 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
15 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
16 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
17 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
18 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
19 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
20 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
21 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
22 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
23 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
24 2818991452 Burkholderia cepacia 561 Isolate Unclassified
25 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
26 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
27 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
28 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
29 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
30 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
31 2904564687 Burkholderia sp. 571 Isolate Unclassified
32 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
33 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
34 2928163908 Burkholderia sp. 567 Isolate Unclassified
35 2928170801 Burkholderia sp. 572 Isolate Unclassified
36 2928536128 Burkholderia sola 565 Isolate Unclassified
37 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
243 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
244 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
245 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
246 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
247 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
248 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
249 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
250 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.26
Metatranscriptomes 0
Isolates 12.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.07
Nodule 0.28
Rhizoplane 5.54
Rhizosphere 64.54
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018157 3300001989 Bacteria 2531
2 JGI24737J22298_10015780 3300001990 Bacteria 2442
3 JGI25162J39368_1000636 3300002737 Bacteria 24918
4 JGI25162J39368_1003095 3300002737 Bacteria 5312
5 JGI25157J39369_1001204 3300002741 Bacteria 10818
6 JGI25164J39214_1000664 3300002772 Bacteria 14036
7 JGI25164J39214_1000684 3300002772 Bacteria 13424
8 JGI25164J39214_1000713 3300002772 Bacteria 12708
9 JGI25165J46597_1000748 3300003214 Bacteria 25071
10 JGI25404J52841_10000395 3300003659 Bacteria 6023
11 Ga0055532_1000519 3300003758 Bacteria 16848
12 Ga0055532_1000572 3300003758 Bacteria 15320
13 Ga0055532_1001502 3300003758 Bacteria 6418
14 Ga0055527_1000376 3300003760 Bacteria 20236
15 Ga0055535_1000513 3300003761 Bacteria 33796
16 Ga0055535_1000533 3300003761 Bacteria 33007
17 Ga0055542_1000428 3300003762 Bacteria 40570
18 Ga0055542_1000534 3300003762 Bacteria 33796
19 Ga0055542_1002775 3300003762 Bacteria 5293
20 Ga0055529_1000518 3300003763 Bacteria 33803
21 Ga0055529_1002227 3300003763 Bacteria 3969
22 Ga0055528_1005057 3300003790 Bacteria 6229
23 Ga0055541_1012179 3300003841 Bacteria 1239
24 Ga0058692_1010207 3300003856 Bacteria 2330
25 Ga0070658_10001433 3300005327 Bacteria 20325
26 Ga0070658_10061268 3300005327 Bacteria 3065
27 Ga0070658_10179211 3300005327 Bacteria 1783
28 Ga0070683_100227789 3300005329 Bacteria 1772
29 Ga0068869_100034248 3300005334 Bacteria 3591
30 Ga0070666_10000007 3300005335 Bacteria 293732
31 Ga0070682_100016646 3300005337 Bacteria 4279
32 Ga0068868_100010124 3300005338 Bacteria 6813
33 Ga0070660_100000003 3300005339 Bacteria 176884
34 Ga0070660_100434129 3300005339 Bacteria 1088
35 Ga0070691_10048464 3300005341 Bacteria 2022
36 Ga0070661_100047357 3300005344 Bacteria 3146
37 Ga0070661_100064670 3300005344 Bacteria 2688
38 Ga0070668_100010429 3300005347 Bacteria 6905
39 Ga0070669_100067427 3300005353 Bacteria 2640
40 Ga0070675_100057547 3300005354 Bacteria 3205
41 Ga0070671_100256298 3300005355 Bacteria 1486
42 Ga0070659_100000914 3300005366 Bacteria 21609
43 Ga0070659_100102655 3300005366 Bacteria 2302
44 Ga0070667_100008469 3300005367 Bacteria 8528
45 Ga0070713_100001046 3300005436 Bacteria 17685
46 Ga0070713_100111930 3300005436 Bacteria 2381
47 Ga0070711_100236926 3300005439 Bacteria 1425
48 Ga0070700_100010739 3300005441 Bacteria 5060
49 Ga0070663_100000043 3300005455 Bacteria 57818
50 Ga0070663_100007499 3300005455 Bacteria 6644
51 Ga0070663_100215932 3300005455 Bacteria 1504
52 Ga0070663_100355784 3300005455 Bacteria 1187
53 Ga0070662_100024000 3300005457 Bacteria 4196
54 Ga0068867_100260618 3300005459 Bacteria 1413
55 Ga0070685_10214788 3300005466 Bacteria 1257
56 Ga0070679_100006116 3300005530 Bacteria 11198
57 Ga0070684_100007768 3300005535 Bacteria 8360
58 Ga0070684_100197785 3300005535 Bacteria 1830
59 Ga0068853_100150460 3300005539 Bacteria 2095
60 Ga0070696_100046408 3300005546 Bacteria 3012
61 Ga0070665_100121248 3300005548 Bacteria 2616
62 Ga0068855_100125810 3300005563 Unclassified 2931
63 Ga0068855_100143057 3300005563 Bacteria 2724
64 Ga0070664_100006534 3300005564 Bacteria 9400
65 Ga0068857_100205969 3300005577 Bacteria 1794
66 Ga0068856_100075206 3300005614 Bacteria 3345
67 Ga0068856_100144724 3300005614 Bacteria 2384
68 Ga0068852_100030995 3300005616 Unclassified 4407
69 Ga0068859_100117133 3300005617 Bacteria 2729
70 Ga0068859_100153076 3300005617 Bacteria 2382
71 Ga0068864_100081987 3300005618 Bacteria 2829
72 Ga0068861_100017216 3300005719 Bacteria 5125
73 Ga0068858_100065005 3300005842 Bacteria 3376
74 Ga0068858_100253673 3300005842 Bacteria 1671
75 Ga0068858_100274351 3300005842 Unclassified 1605
76 Ga0068858_100478889 3300005842 Bacteria 1201
77 Ga0068860_100115426 3300005843 Bacteria 2568
78 Ga0068860_100271885 3300005843 Bacteria 1654
79 Ga0068862_100009761 3300005844 Bacteria 7937
80 Ga0081455_10023554 3300005937 Bacteria 5727
81 Ga0081455_10048680 3300005937 Bacteria 3660
82 Ga0081540_1000044 3300005983 Bacteria 134269
83 Ga0081539_10001717 3300005985 Bacteria 35101
84 Ga0070717_10078738 3300006028 Bacteria 2763
85 Ga0075363_100057914 3300006048 Bacteria 2081
86 Ga0070712_100217765 3300006175 Bacteria 1510
87 Ga0075366_10050489 3300006195 Bacteria 2470
88 Ga0075433_10454215 3300006852 Bacteria 1129
89 Ga0075434_100439508 3300006871 Bacteria 1326
90 Ga0097620_100117133 3300006931 Bacteria 2729
91 Ga0097620_100153069 3300006931 Bacteria 2382
92 Ga0099794_10030161 3300007265 Bacteria 2530
93 Ga0105240_10000236 3300009093 Bacteria 110204
94 Ga0105240_10000477 3300009093 Bacteria 74075
95 Ga0105240_10001413 3300009093 Bacteria 41177
96 Ga0105240_10023060 3300009093 Bacteria 8242
97 Ga0105240_10184252 3300009093 Unclassified 2461
98 Ga0105240_10292740 3300009093 Bacteria 1866
99 Ga0105245_10017718 3300009098 Bacteria 6216
100 Ga0114129_10390624 3300009147 Bacteria 1835
101 Ga0105243_10111467 3300009148 Bacteria 2290
102 Ga0105248_10037434 3300009177 Bacteria 5428
103 Ga0105237_10016027 3300009545 Bacteria 7795
104 Ga0105237_10045614 3300009545 Bacteria 4410
105 Ga0105237_10049469 3300009545 Bacteria 4225
106 Ga0105237_10257919 3300009545 Bacteria 1746
107 Ga0105238_10000173 3300009551 Bacteria 70523
108 Ga0105238_10026617 3300009551 Bacteria 5897
109 Ga0105238_10062586 3300009551 Bacteria 3721
110 Ga0105249_10001572 3300009553 Bacteria 20015
111 Ga0105239_10000110 3300010375 Bacteria 115508
112 Ga0105239_10002007 3300010375 Bacteria 26432
113 Ga0105239_10007669 3300010375 Bacteria 12361
114 Ga0157371_10049313 3300013102 Bacteria 2991
115 Ga0157371_10050822 3300013102 Bacteria 2947
116 Ga0157370_10027112 3300013104 Bacteria 5649
117 Ga0157370_10093142 3300013104 Bacteria 2827
118 Ga0157370_10097772 3300013104 Bacteria 2753
119 Ga0157369_10169463 3300013105 Bacteria 2301
120 Ga0157369_10213940 3300013105 Bacteria 2020
121 Ga0157374_10047945 3300013296 Bacteria 3963
122 Ga0163162_10000060 3300013306 Bacteria 106982
123 Ga0157372_10136490 3300013307 Bacteria 2825
124 Ga0157375_10064862 3300013308 Bacteria 3638
125 Ga0163163_10063684 3300014325 Bacteria 3657
126 Ga0182008_10010337 3300014497 Bacteria 4996
127 Ga0182008_10037458 3300014497 Bacteria 2426
128 Ga0157377_10003357 3300014745 Bacteria 7244
129 Ga0157379_10282683 3300014968 Bacteria 1510
130 Ga0182006_1008427 3300015261 Bacteria 4670
131 Ga0182007_10002691 3300015262 Bacteria 8693
132 Ga0182007_10007133 3300015262 Bacteria 4721
133 Ga0183369_1006 3300015685 Bacteria 449058
134 Ga0213872_10024795 3300021361 Bacteria 2758
135 Ga0209566_101032 3300025225 Bacteria 11634
136 Ga0209674_100061 3300025226 Bacteria 280844
137 Ga0209674_100679 3300025226 Bacteria 12133
138 Ga0209674_100842 3300025226 Bacteria 10154
139 Ga0209672_100036 3300025228 Bacteria 287801
140 Ga0209672_100050 3300025228 Bacteria 238103
141 Ga0209672_100932 3300025228 Bacteria 13176
142 Ga0209147_100066 3300025229 Bacteria 232474
143 Ga0209147_100075 3300025229 Bacteria 208215
144 Ga0209147_100166 3300025229 Bacteria 90046
145 Ga0207427_100147 3300025231 Bacteria 80584
146 Ga0207427_100406 3300025231 Bacteria 25132
147 Ga0207427_101377 3300025231 Bacteria 8915
148 Ga0209437_100005 3300025233 Bacteria 1071596
149 Ga0209437_100076 3300025233 Bacteria 295194
150 Ga0209437_100167 3300025233 Bacteria 144661
151 Ga0209258_100085 3300025242 Bacteria 244731
152 Ga0209258_100175 3300025242 Bacteria 141709
153 Ga0209258_101010 3300025242 Bacteria 12782
154 Ga0209258_103192 3300025242 Bacteria 3675
155 Ga0209646_1015761 3300025246 Bacteria 1126
156 Ga0209026_1000090 3300025250 Bacteria 172829
157 Ga0209026_1001112 3300025250 Bacteria 12770
158 Ga0209026_1002499 3300025250 Bacteria 6831
159 Ga0209148_1000002 3300025254 Bacteria 2399500
160 Ga0209148_1000174 3300025254 Bacteria 130039
161 Ga0209148_1000873 3300025254 Bacteria 20956
162 Ga0209759_1007252 3300025256 Bacteria 3594
163 Ga0209233_1000011 3300025261 Bacteria 1071611
164 Ga0209233_1000046 3300025261 Bacteria 470971
165 Ga0209233_1008060 3300025261 Bacteria 3289
166 Ga0209233_1011060 3300025261 Bacteria 2673
167 Ga0209455_1000212 3300025272 Bacteria 82606
168 Ga0209455_1000689 3300025272 Bacteria 19911
169 Ga0209673_1000046 3300025273 Bacteria 289907
170 Ga0209564_1002273 3300025295 Bacteria 15715
171 Ga0207688_10004485 3300025901 Bacteria 7600
172 Ga0207680_10000002 3300025903 Bacteria 1018646
173 Ga0207647_10011518 3300025904 Bacteria 6199
174 Ga0207705_10004525 3300025909 Bacteria 10505
175 Ga0207705_10021044 3300025909 Bacteria 4653
176 Ga0207695_10000422 3300025913 Bacteria 93814
177 Ga0207695_10000628 3300025913 Bacteria 70699
178 Ga0207695_10000699 3300025913 Bacteria 65747
179 Ga0207695_10018998 3300025913 Bacteria 7926
180 Ga0207695_10309892 3300025913 Unclassified 1469
181 Ga0207671_10107876 3300025914 Bacteria 2116
182 Ga0207693_10053344 3300025915 Bacteria 3172
183 Ga0207663_10191334 3300025916 Bacteria 1469
184 Ga0207657_10000002 3300025919 Bacteria 444378
185 Ga0207649_10031184 3300025920 Bacteria 3166
186 Ga0207652_10000605 3300025921 Bacteria 35708
187 Ga0207652_10127850 3300025921 Bacteria 2264
188 Ga0207681_10173240 3300025923 Bacteria 1637
189 Ga0207694_10000237 3300025924 Bacteria 52878
190 Ga0207694_10048878 3300025924 Bacteria 3273
191 Ga0207687_10029631 3300025927 Bacteria 3683
192 Ga0207700_10059374 3300025928 Bacteria 2892
193 Ga0207644_10075843 3300025931 Bacteria 2472
194 Ga0207690_10000014 3300025932 Bacteria 263016
195 Ga0207690_10002164 3300025932 Bacteria 12007
196 Ga0207690_10004436 3300025932 Bacteria 8280
197 Ga0207690_10041981 3300025932 Bacteria 3001
198 Ga0207706_10057226 3300025933 Bacteria 3436
199 Ga0207691_10166168 3300025940 Bacteria 1934
200 Ga0207661_10283510 3300025944 Bacteria 1481
201 Ga0207679_10010323 3300025945 Bacteria 6008
202 Ga0207667_10002137 3300025949 Bacteria 24779
203 Ga0207667_10048158 3300025949 Unclassified 4508
204 Ga0207667_10092209 3300025949 Bacteria 3129
205 Ga0207667_10434015 3300025949 Bacteria 1336
206 Ga0207667_10569300 3300025949 Bacteria 1144
207 Ga0207712_10014308 3300025961 Bacteria 5101
208 Ga0207668_10005775 3300025972 Bacteria 7294
209 Ga0207668_10058478 3300025972 Bacteria 2695
210 Ga0207658_10001003 3300025986 Bacteria 23159
211 Ga0207658_10027816 3300025986 Bacteria 3977
212 Ga0207677_10102938 3300026023 Bacteria 2106
213 Ga0207703_10041762 3300026035 Bacteria 3677
214 Ga0207703_10394432 3300026035 Bacteria 1283
215 Ga0207639_10117764 3300026041 Bacteria 2177
216 Ga0207678_10000113 3300026067 Bacteria 66664
217 Ga0207678_10005722 3300026067 Bacteria 11094
218 Ga0207678_10155024 3300026067 Bacteria 1955
219 Ga0207678_10272957 3300026067 Bacteria 1450
220 Ga0207708_10003292 3300026075 Bacteria 11884
221 Ga0207648_10140110 3300026089 Bacteria 2131
222 Ga0207648_10269375 3300026089 Bacteria 1521
223 Ga0207676_10067299 3300026095 Bacteria 2861
224 Ga0207674_10008173 3300026116 Bacteria 12133
225 Ga0207698_10398554 3300026142 Bacteria 1314
226 Ga0209371_1000131 3300027312 Bacteria 122972
227 Ga0268266_10000004 3300028379 Bacteria 1495817
228 Ga0268266_10240743 3300028379 Unclassified 1670
229 Ga0268265_10002140 3300028380 Bacteria 15316
230 Ga0268264_10073061 3300028381 Bacteria 2910
231 Ga0268264_10085853 3300028381 Bacteria 2702
232 Ga0268264_10407957 3300028381 Bacteria 1307
233 Ga0268256_1000385 3300030500 Bacteria 40764
234 Ga0265327_10000130 3300031251 Bacteria 165066
235 Ga0265327_10011202 3300031251 Bacteria 6211
236 Ga0265313_10005233 3300031595 Bacteria 9612
237 Ga0307413_10037777 3300031824 Bacteria 2792
238 Ga0307410_10002164 3300031852 Bacteria 9336
239 Ga0307409_100033828 3300031995 Bacteria 3725
240 Ga0307411_10058504 3300032005 Bacteria 2551
241 Ga0307415_100099187 3300032126 Bacteria 2131
242 Ga0307415_100347692 3300032126 Bacteria 1247
243 Ga0307510_10000690 3300033180 Bacteria 34549
244 Ga0316574_0226404 3300035398 Bacteria 1197
245 Ga0373937_0042843 3300036401 Bacteria 4131
246 Ga0395899_0060614 3300037312 Bacteria 2788
247 Ga0395900_0065358 3300037418 Bacteria 3737
248 Ga0395901_0000667 3300038443 Bacteria 39465
249 Ga0395901_0078590 3300038443 Bacteria 3445
250 Ga0436361_1046112 3300039447 Bacteria 1110
251 Ga0439465_0045085 3300041413 Bacteria 1433
252 Ga0439431_0010665 3300041997 Bacteria 2087
253 Ga0439445_0003071 3300042004 Bacteria 3738
254 Ga0439445_0009956 3300042004 Bacteria 2244
255 Ga0439434_0010078 3300042435 Bacteria 2783
256 Ga0451577_0091725 3300042876 Bacteria 2712
257 Ga0466965_0033758 3300044683 Bacteria 2502
258 Ga0451576_0018219 3300045051 Bacteria 7701
259 Ga0451576_0030319 3300045051 Bacteria 5780
260 Ga0495638_0000082 3300046460 Bacteria 153986
261 Ga0495650_0000253 3300046471 Bacteria 104338
262 Ga0495650_0087522 3300046471 Bacteria 1191
263 Ga0495606_0000113 3300046507 Bacteria 136805
264 Ga0495606_0038466 3300046507 Bacteria 3236
265 Ga0495606_0055458 3300046507 Bacteria 2563
266 Ga0495652_0041993 3300046529 Bacteria 3944
267 Ga0495654_0008021 3300046530 Bacteria 5863
268 Ga0495668_0054475 3300046616 Bacteria 2211
269 Ga0495625_0031341 3300046660 Bacteria 3957
270 Ga0496100_0070982 3300048903 Bacteria 2324
271 Ga0496101_0004645 3300048904 Bacteria 8686
272 Ga0496101_0037222 3300048904 Bacteria 3450
273 Ga0496102_0043020 3300048905 Bacteria 4094
274 Ga0496102_0270443 3300048905 Bacteria 1602
275 Ga0496103_0012058 3300048906 Bacteria 5134
276 Ga0496104_0075328 3300048907 Bacteria 3213
277 Ga0496105_0014555 3300048908 Bacteria 6263
278 Ga0496105_0094193 3300048908 Bacteria 2473
279 Ga0496107_0016365 3300048910 Bacteria 5205
280 Ga0496108_0317742 3300048911 Bacteria 1357
281 Ga0496109_0057709 3300048912 Bacteria 3544
282 Ga0496110_0060575 3300048913 Bacteria 3338
283 Ga0496112_0113010 3300048915 Bacteria 2686
284 Ga0496113_0020391 3300048916 Bacteria 4659
285 Ga0496115_0035357 3300048918 Bacteria 3952
286 Ga0496116_0003508 3300048919 Bacteria 15433
287 Ga0496117_0028601 3300048920 Bacteria 4314
288 Ga0496118_0001044 3300048921 Bacteria 43186
289 Ga0496118_0009231 3300048921 Bacteria 10016
290 Ga0496119_0000029 3300048922 Bacteria 243194
291 Ga0496119_0023037 3300048922 Bacteria 4433
292 Ga0496120_0000039 3300048923 Bacteria 202237
293 Ga0496120_0009805 3300048923 Bacteria 6748
294 Ga0496121_0000063 3300048924 Bacteria 273080
295 Ga0496121_0019230 3300048924 Bacteria 6841
296 Ga0496125_0037991 3300048928 Bacteria 4177
297 Ga0496125_0064756 3300048928 Bacteria 2902
298 Ga0496126_0002573 3300048929 Bacteria 24212
299 Ga0496126_0011099 3300048929 Bacteria 9358
300 Ga0496126_0178806 3300048929 Bacteria 1803
301 Ga0501043_0123333 3300049579 Bacteria 2032
302 Ga0501047_0121437 3300049581 Bacteria 2494
303 Ga0501048_0184886 3300049582 Bacteria 1477
304 Ga0501070_0013314 3300049586 Bacteria 6937
305 Ga0501070_0068111 3300049586 Bacteria 2947
306 Ga0501080_0087902 3300049742 Bacteria 2887
307 Ga0501083_0003936 3300049744 Bacteria 10435
308 nmdc:mga05p37_122234_c1 3300050507 Bacteria 3197
309 nmdc:mga0n895_297483_c1 3300050512 Bacteria 1636
310 Ga0500592_000099 3300053116 Bacteria 18699
311 Ga0500595_002257 3300053119 Bacteria 9752
312 Ga0500595_025359 3300053119 Bacteria 2056
313 Ga0500658_0034250 3300053134 Bacteria 2003
314 Ga0500568_0019631 3300053139 Bacteria 2933
315 Ga0500627_0000292 3300053158 Bacteria 13985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2902792274 2902793118 282
2 3300028381 Ga0268264_10407957 Ga0268264_104079571 291
3 3300009177 Ga0105248_10037434 Ga0105248_100374343 292
4 3300025940 Ga0207691_10166168 Ga0207691_101661682 292
5 3300009147 Ga0114129_10390624 Ga0114129_103906241 295
6 3300031595 Ga0265313_10005233 Ga0265313_100052334 295
7 3300050507 nmdc:mga05p37_122234_c1 nmdc:mga05p37_122234_c1_1975_2940 295
8 3300050512 nmdc:mga0n895_297483_c1 nmdc:mga0n895_297483_c1_287_1252 295
9 3300006852 Ga0075433_10454215 Ga0075433_104542151 298
10 3300005535 Ga0070684_100007768 Ga0070684_1000077684 302
11 3300005614 Ga0068856_100144724 Ga0068856_1001447242 302
12 3300013308 Ga0157375_10064862 Ga0157375_100648622 302
13 3300014745 Ga0157377_10003357 Ga0157377_100033577 302
14 3300025933 Ga0207706_10057226 Ga0207706_100572263 302
15 3300048913 Ga0496110_0060575 Ga0496110_0060575_467_1474 302
16 3300005334 Ga0068869_100034248 Ga0068869_1000342484 303
17 3300005441 Ga0070700_100010739 Ga0070700_1000107393 303
18 3300005617 Ga0068859_100117133 Ga0068859_1001171332 303
19 3300006931 Ga0097620_100117133 Ga0097620_1001171332 303
20 3300025915 Ga0207693_10053344 Ga0207693_100533442 303
21 3300026075 Ga0207708_10003292 Ga0207708_100032927 303
22 3300026089 Ga0207648_10140110 Ga0207648_101401102 303
23 3300048905 Ga0496102_0043020 Ga0496102_0043020_620_1630 303
24 3300009098 Ga0105245_10017718 Ga0105245_100177184 304
25 3300009148 Ga0105243_10111467 Ga0105243_101114672 304
26 3300013296 Ga0157374_10047945 Ga0157374_100479454 304
27 3300013307 Ga0157372_10136490 Ga0157372_101364902 304
28 3300014325 Ga0163163_10063684 Ga0163163_100636844 304
29 3300025927 Ga0207687_10029631 Ga0207687_100296313 304
30 3300044683 Ga0466965_0033758 Ga0466965_0033758_93_1100 304
31 3300048907 Ga0496104_0075328 Ga0496104_0075328_1853_2860 304
32 3300048915 Ga0496112_0113010 Ga0496112_0113010_1557_2564 304
33 3300048916 Ga0496113_0020391 Ga0496113_0020391_990_1997 304
34 3300005329 Ga0070683_100227789 Ga0070683_1002277891 305
35 3300005337 Ga0070682_100016646 Ga0070682_1000166464 305
36 3300005338 Ga0068868_100010124 Ga0068868_1000101241 305
37 3300005339 Ga0070660_100434129 Ga0070660_1004341291 305
38 3300005341 Ga0070691_10048464 Ga0070691_100484642 305
39 3300005344 Ga0070661_100064670 Ga0070661_1000646702 305
40 3300005355 Ga0070671_100256298 Ga0070671_1002562982 305
41 3300005439 Ga0070711_100236926 Ga0070711_1002369262 305
42 3300005457 Ga0070662_100024000 Ga0070662_1000240002 305
43 3300005564 Ga0070664_100006534 Ga0070664_1000065344 305
44 3300005577 Ga0068857_100205969 Ga0068857_1002059692 305
45 3300005618 Ga0068864_100081987 Ga0068864_1000819871 305
46 3300005719 Ga0068861_100017216 Ga0068861_1000172162 305
47 3300005843 Ga0068860_100271885 Ga0068860_1002718852 305
48 3300025901 Ga0207688_10004485 Ga0207688_100044854 305
49 3300025916 Ga0207663_10191334 Ga0207663_101913342 305
50 3300025931 Ga0207644_10075843 Ga0207644_100758432 305
51 3300025944 Ga0207661_10283510 Ga0207661_102835102 305
52 3300025945 Ga0207679_10010323 Ga0207679_100103233 305
53 3300026023 Ga0207677_10102938 Ga0207677_101029382 305
54 3300026067 Ga0207678_10155024 Ga0207678_101550242 305
55 3300026095 Ga0207676_10067299 Ga0207676_100672992 305
56 3300028381 Ga0268264_10073061 Ga0268264_100730612 305
57 3300048904 Ga0496101_0037222 Ga0496101_0037222_43_1053 305
58 3300048908 Ga0496105_0094193 Ga0496105_0094193_997_2007 305
59 3300048911 Ga0496108_0317742 Ga0496108_0317742_292_1302 305
60 3300048912 Ga0496109_0057709 Ga0496109_0057709_2003_3013 305
61 3300025949 Ga0207667_10569300 Ga0207667_105693001 306
62 3300042876 Ga0451577_0091725 Ga0451577_0091725_21_992 307
63 3300005436 Ga0070713_100111930 Ga0070713_1001119301 310
64 3300006028 Ga0070717_10078738 Ga0070717_100787383 310
65 3300006175 Ga0070712_100217765 Ga0070712_1002177652 310
66 3300025928 Ga0207700_10059374 Ga0207700_100593742 310
67 3300009093 Ga0105240_10184252 Ga0105240_101842522 311
68 3300006871 Ga0075434_100439508 Ga0075434_1004395081 312
69 3300009545 Ga0105237_10257919 Ga0105237_102579192 313
70 3300005985 Ga0081539_10001717 Ga0081539_1000171714 315
71 3300025913 Ga0207695_10309892 Ga0207695_103098922 315
72 3300005842 Ga0068858_100274351 Ga0068858_1002743512 316
73 3300028379 Ga0268266_10240743 Ga0268266_102407432 316
74 iso_pu_bacteria 2537561836 2538834275 316
75 3300005539 Ga0068853_100150460 Ga0068853_1001504602 317
76 3300009545 Ga0105237_10049469 Ga0105237_100494694 317
77 3300010375 Ga0105239_10007669 Ga0105239_1000766912 317
78 3300025914 Ga0207671_10107876 Ga0207671_101078762 317
79 3300031251 Ga0265327_10011202 Ga0265327_100112025 317
80 3300031824 Ga0307413_10037777 Ga0307413_100377773 317
81 3300032126 Ga0307415_100347692 Ga0307415_1003476921 317
82 3300041413 Ga0439465_0045085 Ga0439465_0045085_260_1306 317
83 3300042004 Ga0439445_0003071 Ga0439445_0003071_969_2015 317
84 iso_pu_bacteria 2643221598 2643999825 317
85 iso_pu_bacteria 2643221614 2644088260 317
86 iso_pu_bacteria 2643221661 2644343498 317
87 iso_pu_bacteria 2643221666 2644369025 317
88 3300048910 Ga0496107_0016365 Ga0496107_0016365_63_1076 318
89 3300048924 Ga0496121_0000063 Ga0496121_0000063_249290_250303 318
90 iso_pu_bacteria 2687453130 2687583495 318
91 3300005617 Ga0068859_100153076 Ga0068859_1001530762 319
92 3300006195 Ga0075366_10050489 Ga0075366_100504892 319
93 3300006931 Ga0097620_100153069 Ga0097620_1001530692 319
94 3300007265 Ga0099794_10030161 Ga0099794_100301613 319
95 3300009093 Ga0105240_10000477 Ga0105240_1000047750 319
96 3300025913 Ga0207695_10000422 Ga0207695_1000042235 319
97 3300048903 Ga0496100_0070982 Ga0496100_0070982_1251_2264 319
98 3300048904 Ga0496101_0004645 Ga0496101_0004645_802_1815 319
99 3300048908 Ga0496105_0014555 Ga0496105_0014555_4828_5841 319
100 3300048918 Ga0496115_0035357 Ga0496115_0035357_2758_3771 319
101 3300048920 Ga0496117_0028601 Ga0496117_0028601_2964_3977 319
102 3300048921 Ga0496118_0001044 Ga0496118_0001044_6765_7778 319
103 3300048921 Ga0496118_0009231 Ga0496118_0009231_115_1128 319
104 3300048922 Ga0496119_0000029 Ga0496119_0000029_163341_164354 319
105 3300048923 Ga0496120_0000039 Ga0496120_0000039_37884_38897 319
106 3300048924 Ga0496121_0019230 Ga0496121_0019230_1163_2176 319
107 3300048929 Ga0496126_0002573 Ga0496126_0002573_8398_9411 319
108 3300005327 Ga0070658_10001433 Ga0070658_1000143310 320
109 3300005335 Ga0070666_10000007 Ga0070666_100000076 320
110 3300005344 Ga0070661_100047357 Ga0070661_1000473572 320
111 3300005347 Ga0070668_100010429 Ga0070668_1000104292 320
112 3300005367 Ga0070667_100008469 Ga0070667_1000084697 320
113 3300005466 Ga0070685_10214788 Ga0070685_102147881 320
114 3300005548 Ga0070665_100121248 Ga0070665_1001212482 320
115 3300005842 Ga0068858_100065005 Ga0068858_1000650053 320
116 3300005843 Ga0068860_100115426 Ga0068860_1001154263 320
117 3300005844 Ga0068862_100009761 Ga0068862_1000097612 320
118 3300005937 Ga0081455_10023554 Ga0081455_100235542 320
119 3300009553 Ga0105249_10001572 Ga0105249_1000157218 320
120 3300025903 Ga0207680_10000002 Ga0207680_10000002824 320
121 3300025909 Ga0207705_10004525 Ga0207705_100045252 320
122 3300025920 Ga0207649_10031184 Ga0207649_100311842 320
123 3300025924 Ga0207694_10000237 Ga0207694_100002378 320
124 3300025961 Ga0207712_10014308 Ga0207712_100143083 320
125 3300025972 Ga0207668_10005775 Ga0207668_100057754 320
126 3300025972 Ga0207668_10058478 Ga0207668_100584784 320
127 3300025986 Ga0207658_10001003 Ga0207658_1000100316 320
128 3300025986 Ga0207658_10027816 Ga0207658_100278165 320
129 3300026035 Ga0207703_10041762 Ga0207703_100417623 320
130 3300028379 Ga0268266_10000004 Ga0268266_10000004816 320
131 3300028380 Ga0268265_10002140 Ga0268265_100021403 320
132 3300028381 Ga0268264_10085853 Ga0268264_100858532 320
133 3300033180 Ga0307510_10000690 Ga0307510_1000069015 320
134 3300045051 Ga0451576_0018219 Ga0451576_0018219_6645_7655 320
135 3300046530 Ga0495654_0008021 Ga0495654_0008021_4538_5551 320
136 3300049579 Ga0501043_0123333 Ga0501043_0123333_52_1059 320
137 3300053116 Ga0500592_000099 Ga0500592_000099_10162_11175 320
138 3300053134 Ga0500658_0034250 Ga0500658_0034250_14_1027 320
139 3300053158 Ga0500627_0000292 Ga0500627_0000292_10167_11180 320
140 iso_pu_bacteria 2643221562 2643832040 320
141 iso_pu_bacteria 2816332139 2816507342 320
142 iso_pu_bacteria 2895395659 2895397393 320
143 3300005366 Ga0070659_100102655 Ga0070659_1001026551 321
144 3300005455 Ga0070663_100007499 Ga0070663_1000074992 321
145 3300005530 Ga0070679_100006116 Ga0070679_1000061161 321
146 3300006048 Ga0075363_100057914 Ga0075363_1000579142 321
147 3300014968 Ga0157379_10282683 Ga0157379_102826831 321
148 3300015685 Ga0183369_1006 Ga0183369_1006297 321
149 3300021361 Ga0213872_10024795 Ga0213872_100247952 321
150 3300025250 Ga0209026_1001112 Ga0209026_10011124 321
151 3300025921 Ga0207652_10000605 Ga0207652_1000060532 321
152 3300025932 Ga0207690_10041981 Ga0207690_100419814 321
153 3300026067 Ga0207678_10005722 Ga0207678_100057221 321
154 3300035398 Ga0316574_0226404 Ga0316574_0226404_122_1144 321
155 3300038443 Ga0395901_0078590 Ga0395901_0078590_1212_2225 321
156 3300046616 Ga0495668_0054475 Ga0495668_0054475_380_1396 321
157 3300049586 Ga0501070_0013314 Ga0501070_0013314_2201_3235 321
158 iso_pu_bacteria 2643221715 2644639511 321
159 iso_pu_bacteria 2738541264 2738669428 321
160 iso_pu_bacteria 2738541356 2739148546 321
161 iso_pu_bacteria 2808606384 2808973614 321
162 iso_pu_bacteria 2808606390 2809008463 321
163 iso_pu_bacteria 2808606391 2809015550 321
164 iso_pu_bacteria 2902799365 2902803688 321
165 iso_pu_bacteria 2902810491 2902812199 321
166 3300005563 Ga0068855_100125810 Ga0068855_1001258102 322
167 3300005616 Ga0068852_100030995 Ga0068852_1000309953 322
168 3300005842 Ga0068858_100253673 Ga0068858_1002536733 322
169 3300005937 Ga0081455_10048680 Ga0081455_100486801 322
170 3300009093 Ga0105240_10292740 Ga0105240_102927402 322
171 3300013104 Ga0157370_10027112 Ga0157370_100271123 322
172 3300013104 Ga0157370_10093142 Ga0157370_100931423 322
173 3300025949 Ga0207667_10048158 Ga0207667_100481585 322
174 3300031251 Ga0265327_10000130 Ga0265327_1000013098 322
175 3300036401 Ga0373937_0042843 Ga0373937_0042843_2032_3048 322
176 3300045051 Ga0451576_0030319 Ga0451576_0030319_1615_2649 322
177 3300048919 Ga0496116_0003508 Ga0496116_0003508_4666_5703 322
178 3300048922 Ga0496119_0023037 Ga0496119_0023037_1847_2884 322
179 3300048923 Ga0496120_0009805 Ga0496120_0009805_3295_4332 322
180 3300048928 Ga0496125_0037991 Ga0496125_0037991_205_1242 322
181 3300049581 Ga0501047_0121437 Ga0501047_0121437_736_1773 322
182 3300049744 Ga0501083_0003936 Ga0501083_0003936_5198_6235 322
183 3300053119 Ga0500595_002257 Ga0500595_002257_7739_8758 322
184 3300053119 Ga0500595_025359 Ga0500595_025359_989_2026 322
185 3300053139 Ga0500568_0019631 Ga0500568_0019631_507_1544 322
186 iso_pu_bacteria 2519103095 2519461180 322
187 iso_pu_bacteria 2582581311 2585290065 322
188 iso_pu_bacteria 2599185239 2599735546 322
189 iso_pu_bacteria 2599185240 2599745709 322
190 iso_pu_bacteria 2599185355 2600207617 322
191 iso_pu_bacteria 2675903129 2676745278 322
192 iso_pu_bacteria 2816332253 2817258985 322
193 iso_pu_bacteria 2816332256 2817280594 322
194 iso_pu_bacteria 2816332286 2817454898 322
195 iso_pu_bacteria 2818991452 2819630427 322
196 iso_pu_bacteria 2863421361 2863428005 322
197 iso_pu_bacteria 2870068957 2870074868 322
198 iso_pu_bacteria 2904564687 2904565481 322
199 iso_pu_bacteria 2904571731 2904571823 322
200 iso_pu_bacteria 2928157003 2928157700 322
201 iso_pu_bacteria 2928163908 2928165454 322
202 iso_pu_bacteria 2928170801 2928174199 322
203 iso_pu_bacteria 2928536128 2928537139 322
204 iso_pu_bacteria 2981990288 2981990721 322
205 iso_pu_bacteria 641736154 642418115 322
206 iso_pu_bacteria 8018845410 8018848905 322
207 iso_pu_bacteria 8020807995 8020809078 322
208 iso_pu_bacteria 8020938398 8020941623 322
209 iso_pu_bacteria 8020945358 8020948782 322
210 iso_pu_bacteria 8020953355 8020955602 322
211 iso_pu_bacteria 8021120328 8021121036 322
212 iso_pu_bacteria 8040173305 8040174470 322
213 3300002737 JGI25162J39368_1000636 JGI25162J39368_100063612 323
214 3300002772 JGI25164J39214_1000664 JGI25164J39214_100066413 323
215 3300002772 JGI25164J39214_1000684 JGI25164J39214_10006843 323
216 3300002772 JGI25164J39214_1000713 JGI25164J39214_10007135 323
217 3300003214 JGI25165J46597_1000748 JGI25165J46597_100074815 323
218 3300003659 JGI25404J52841_10000395 JGI25404J52841_100003954 323
219 3300005436 Ga0070713_100001046 Ga0070713_1000010461 323
220 3300005546 Ga0070696_100046408 Ga0070696_1000464082 323
221 3300005983 Ga0081540_1000044 Ga0081540_100004425 323
222 3300009545 Ga0105237_10045614 Ga0105237_100456143 323
223 3300009551 Ga0105238_10000173 Ga0105238_1000017311 323
224 3300009551 Ga0105238_10062586 Ga0105238_100625863 323
225 3300010375 Ga0105239_10000110 Ga0105239_1000011078 323
226 3300013306 Ga0163162_10000060 Ga0163162_1000006088 323
227 3300014497 Ga0182008_10010337 Ga0182008_100103371 323
228 3300014497 Ga0182008_10037458 Ga0182008_100374581 323
229 3300015262 Ga0182007_10007133 Ga0182007_100071332 323
230 3300025226 Ga0209674_100679 Ga0209674_1006799 323
231 3300025231 Ga0207427_100147 Ga0207427_10014753 323
232 3300025231 Ga0207427_100406 Ga0207427_10040615 323
233 3300025233 Ga0209437_100005 Ga0209437_100005769 323
234 3300025233 Ga0209437_100167 Ga0209437_100167117 323
235 3300025261 Ga0209233_1000011 Ga0209233_1000011173 323
236 3300025261 Ga0209233_1000046 Ga0209233_1000046117 323
237 3300025261 Ga0209233_1008060 Ga0209233_10080604 323
238 3300025261 Ga0209233_1011060 Ga0209233_10110602 323
239 3300025921 Ga0207652_10127850 Ga0207652_101278502 323
240 3300025932 Ga0207690_10004436 Ga0207690_100044363 323
241 3300026116 Ga0207674_10008173 Ga0207674_100081732 323
242 3300046471 Ga0495650_0000253 Ga0495650_0000253_56843_57880 323
243 3300046471 Ga0495650_0087522 Ga0495650_0087522_18_1094 323
244 3300046507 Ga0495606_0055458 Ga0495606_0055458_1129_2166 323
245 3300046660 Ga0495625_0031341 Ga0495625_0031341_63_1100 323
246 3300048905 Ga0496102_0270443 Ga0496102_0270443_410_1456 323
247 3300048906 Ga0496103_0012058 Ga0496103_0012058_2293_3339 323
248 3300048928 Ga0496125_0064756 Ga0496125_0064756_19_1056 323
249 3300048929 Ga0496126_0011099 Ga0496126_0011099_3214_4251 323
250 3300001990 JGI24737J22298_10015780 JGI24737J22298_100157801 324
251 3300002741 JGI25157J39369_1001204 JGI25157J39369_10012043 324
252 3300005327 Ga0070658_10061268 Ga0070658_100612683 324
253 3300005455 Ga0070663_100355784 Ga0070663_1003557841 324
254 3300005563 Ga0068855_100143057 Ga0068855_1001430573 324
255 3300005614 Ga0068856_100075206 Ga0068856_1000752061 324
256 3300013102 Ga0157371_10049313 Ga0157371_100493133 324
257 3300013102 Ga0157371_10050822 Ga0157371_100508221 324
258 3300013104 Ga0157370_10097772 Ga0157370_100977721 324
259 3300013105 Ga0157369_10169463 Ga0157369_101694631 324
260 3300025226 Ga0209674_100061 Ga0209674_100061214 324
261 3300025242 Ga0209258_101010 Ga0209258_1010102 324
262 3300025246 Ga0209646_1015761 Ga0209646_10157611 324
263 3300025250 Ga0209026_1000090 Ga0209026_1000090150 324
264 3300025924 Ga0207694_10048878 Ga0207694_100488782 324
265 3300025932 Ga0207690_10002164 Ga0207690_100021645 324
266 3300025949 Ga0207667_10092209 Ga0207667_100922093 324
267 3300025949 Ga0207667_10434015 Ga0207667_104340151 324
268 3300026067 Ga0207678_10272957 Ga0207678_102729571 324
269 3300037312 Ga0395899_0060614 Ga0395899_0060614_1081_2094 324
270 3300037418 Ga0395900_0065358 Ga0395900_0065358_1878_2891 324
271 3300038443 Ga0395901_0000667 Ga0395901_0000667_3758_4771 324
272 3300039447 Ga0436361_1046112 Ga0436361_1046112_42_1058 324
273 3300046529 Ga0495652_0041993 Ga0495652_0041993_1793_2809 324
274 3300049582 Ga0501048_0184886 Ga0501048_0184886_195_1208 324
275 3300002737 JGI25162J39368_1003095 JGI25162J39368_10030954 325
276 3300003762 Ga0055542_1000428 Ga0055542_100042832 325
277 3300005353 Ga0070669_100067427 Ga0070669_1000674271 325
278 3300005455 Ga0070663_100215932 Ga0070663_1002159321 325
279 3300009093 Ga0105240_10000236 Ga0105240_1000023648 325
280 3300025228 Ga0209672_100932 Ga0209672_1009326 325
281 3300025231 Ga0207427_101377 Ga0207427_1013776 325
282 3300025233 Ga0209437_100076 Ga0209437_1000766 325
283 3300025242 Ga0209258_103192 Ga0209258_1031922 325
284 3300025250 Ga0209026_1002499 Ga0209026_10024995 325
285 3300025254 Ga0209148_1000002 Ga0209148_10000021009 325
286 3300025913 Ga0207695_10000699 Ga0207695_1000069944 325
287 3300025923 Ga0207681_10173240 Ga0207681_101732402 325
288 3300031852 Ga0307410_10002164 Ga0307410_100021647 325
289 3300031995 Ga0307409_100033828 Ga0307409_1000338283 325
290 3300032005 Ga0307411_10058504 Ga0307411_100585043 325
291 3300032126 Ga0307415_100099187 Ga0307415_1000991871 325
292 3300041997 Ga0439431_0010665 Ga0439431_0010665_730_1767 325
293 3300042004 Ga0439445_0009956 Ga0439445_0009956_972_2009 325
294 3300042435 Ga0439434_0010078 Ga0439434_0010078_279_1316 325
295 3300046460 Ga0495638_0000082 Ga0495638_0000082_104010_105062 325
296 3300046507 Ga0495606_0000113 Ga0495606_0000113_83861_84913 325
297 3300046507 Ga0495606_0038466 Ga0495606_0038466_583_1620 325
298 3300048929 Ga0496126_0178806 Ga0496126_0178806_667_1719 325
299 3300001989 JGI24739J22299_10018157 JGI24739J22299_100181571 326
300 3300003758 Ga0055532_1000519 Ga0055532_100051913 326
301 3300003758 Ga0055532_1000572 Ga0055532_100057215 326
302 3300003758 Ga0055532_1001502 Ga0055532_10015023 326
303 3300003760 Ga0055527_1000376 Ga0055527_100037619 326
304 3300003761 Ga0055535_1000513 Ga0055535_100051316 326
305 3300003761 Ga0055535_1000533 Ga0055535_100053319 326
306 3300003762 Ga0055542_1000534 Ga0055542_100053416 326
307 3300003762 Ga0055542_1002775 Ga0055542_10027754 326
308 3300003763 Ga0055529_1000518 Ga0055529_100051816 326
309 3300003763 Ga0055529_1002227 Ga0055529_10022271 326
310 3300003790 Ga0055528_1005057 Ga0055528_10050575 326
311 3300003841 Ga0055541_1012179 Ga0055541_10121791 326
312 3300003856 Ga0058692_1010207 Ga0058692_10102072 326
313 3300005327 Ga0070658_10179211 Ga0070658_101792112 326
314 3300005339 Ga0070660_100000003 Ga0070660_100000003151 326
315 3300005354 Ga0070675_100057547 Ga0070675_1000575472 326
316 3300005366 Ga0070659_100000914 Ga0070659_10000091416 326
317 3300005455 Ga0070663_100000043 Ga0070663_1000000432 326
318 3300005459 Ga0068867_100260618 Ga0068867_1002606181 326
319 3300005535 Ga0070684_100197785 Ga0070684_1001977852 326
320 3300005842 Ga0068858_100478889 Ga0068858_1004788891 326
321 3300009093 Ga0105240_10001413 Ga0105240_1000141330 326
322 3300009093 Ga0105240_10023060 Ga0105240_100230606 326
323 3300009545 Ga0105237_10016027 Ga0105237_100160276 326
324 3300009551 Ga0105238_10026617 Ga0105238_100266173 326
325 3300010375 Ga0105239_10002007 Ga0105239_100020076 326
326 3300013105 Ga0157369_10213940 Ga0157369_102139402 326
327 3300015261 Ga0182006_1008427 Ga0182006_10084276 326
328 3300015262 Ga0182007_10002691 Ga0182007_1000269110 326
329 3300025225 Ga0209566_101032 Ga0209566_10103210 326
330 3300025226 Ga0209674_100842 Ga0209674_1008426 326
331 3300025228 Ga0209672_100036 Ga0209672_100036151 326
332 3300025228 Ga0209672_100050 Ga0209672_10005053 326
333 3300025229 Ga0209147_100066 Ga0209147_100066151 326
334 3300025229 Ga0209147_100075 Ga0209147_100075137 326
335 3300025229 Ga0209147_100166 Ga0209147_10016620 326
336 3300025242 Ga0209258_100085 Ga0209258_100085151 326
337 3300025242 Ga0209258_100175 Ga0209258_10017553 326
338 3300025254 Ga0209148_1000174 Ga0209148_100017453 326
339 3300025254 Ga0209148_1000873 Ga0209148_100087321 326
340 3300025256 Ga0209759_1007252 Ga0209759_10072524 326
341 3300025272 Ga0209455_1000212 Ga0209455_100021253 326
342 3300025272 Ga0209455_1000689 Ga0209455_10006898 326
343 3300025273 Ga0209673_1000046 Ga0209673_1000046257 326
344 3300025295 Ga0209564_1002273 Ga0209564_100227313 326
345 3300025904 Ga0207647_10011518 Ga0207647_100115186 326
346 3300025909 Ga0207705_10021044 Ga0207705_100210444 326
347 3300025913 Ga0207695_10000628 Ga0207695_1000062852 326
348 3300025913 Ga0207695_10018998 Ga0207695_100189982 326
349 3300025919 Ga0207657_10000002 Ga0207657_10000002372 326
350 3300025932 Ga0207690_10000014 Ga0207690_10000014148 326
351 3300025949 Ga0207667_10002137 Ga0207667_100021374 326
352 3300026035 Ga0207703_10394432 Ga0207703_103944321 326
353 3300026041 Ga0207639_10117764 Ga0207639_101177642 326
354 3300026067 Ga0207678_10000113 Ga0207678_1000011360 326
355 3300026089 Ga0207648_10269375 Ga0207648_102693751 326
356 3300026142 Ga0207698_10398554 Ga0207698_103985541 326
357 3300027312 Ga0209371_1000131 Ga0209371_100013192 326
358 3300030500 Ga0268256_1000385 Ga0268256_100038524 326
359 3300049586 Ga0501070_0068111 Ga0501070_0068111_922_1959 326
360 3300049742 Ga0501080_0087902 Ga0501080_0087902_753_1790 326
361 iso_pu_bacteria 8040167225 8040168003 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

58

165

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

202

332

0.86

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

233

370

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7c-assembly1.cif.gz_B crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9402 4 322
4b7x-assembly2.cif.gz_D crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.939 4 322
4b7c-assembly2.cif.gz_D crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9378 4 322
4b7x-assembly5.cif.gz_J crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9371 7 322
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.937 118 318
ID Description Score Start End Superfamily
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9398 6 118 3.90.180.10
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9367 131 291 3.40.50.720
af_Q2QVJ8_160_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9347 164 316 3.40.50.720
af_Q54LY2_135_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 136 290 3.40.50.720
af_C0PGX3_170_327_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9314 164 298 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5VA22-F1-model_v4 deleted 0.9792 1 99
AF-A0A524P6P4-F1-model_v4 NADP-dependent oxidoreductase 0.9775 4 107 GO:0016628
AF-A0A355V4Y6-F1-model_v4 NADP-dependent oxidoreductase 0.9717 4 94 GO:0016628
AF-A0A3D0ZWU5-F1-model_v4 Oxidoreductase N-terminal domain-containing protein 0.9612 4 101 GO:0016628
AF-A0A534S0M3-F1-model_v4 NADP-dependent oxidoreductase 0.9599 1 97

Feature Viewer

pLDDT pTM Quality
89.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map