F421976

General Info

Members Datasets Scaffolds Average Seq Length
360 236 720 106

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0717984|Ga0495634_0717984_134_520
Length 128
Sequence MPKPASIANKTVRGSRSGRPIMTLLDLLGRRWSLRIVWELRDGALTSRALRTACDDASPTVIQTRLSDLREAGLVELLPGDGYGLTQLGNDLRESFQPLYRFADRWSEHVAGIKPPRPSGWRRRPAQS

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
225 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
229 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
230 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
234 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
235 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
236 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 1.67
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.17
Nodule 0.28
Rhizoplane 4.72
Rhizosphere 71.67
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0717984 3300046642 Bacteria 574
2 rootH1_10107014 3300003316 Bacteria 1290
3 Ga0070683_100187891 3300005329 Bacteria 1961
4 Ga0070683_101812446 3300005329 Bacteria 587
5 Ga0068868_101198906 3300005338 Bacteria 702
6 Ga0070689_100082469 3300005340 Bacteria 2526
7 Ga0070689_100183708 3300005340 Bacteria 1700
8 Ga0070661_100048175 3300005344 Bacteria 3119
9 Ga0070661_100106967 3300005344 Bacteria 2086
10 Ga0070675_100205447 3300005354 Bacteria 1711
11 Ga0070671_100586211 3300005355 Bacteria 963
12 Ga0070659_100746737 3300005366 Bacteria 848
13 Ga0070659_102106035 3300005366 Bacteria 507
14 Ga0070709_11689989 3300005434 Bacteria 517
15 Ga0070714_100073525 3300005435 Bacteria 2962
16 Ga0070713_101587776 3300005436 Bacteria 635
17 Ga0070713_101631532 3300005436 Bacteria 626
18 Ga0070710_10961159 3300005437 Bacteria 620
19 Ga0070711_100679094 3300005439 Bacteria 866
20 Ga0070711_100710789 3300005439 Bacteria 847
21 Ga0070708_100438161 3300005445 Bacteria 1233
22 Ga0070678_100980594 3300005456 Bacteria 776
23 Ga0068867_100250902 3300005459 Bacteria 1439
24 Ga0068867_101499891 3300005459 Bacteria 628
25 Ga0070706_100956355 3300005467 Bacteria 790
26 Ga0070707_100194446 3300005468 Bacteria 1978
27 Ga0070707_101551737 3300005468 Bacteria 629
28 Ga0070698_100037026 3300005471 Bacteria 5032
29 Ga0070699_100029858 3300005518 Bacteria 4702
30 Ga0070679_100435080 3300005530 Bacteria 1257
31 Ga0070679_101845907 3300005530 Bacteria 553
32 Ga0070684_100024372 3300005535 Bacteria 5075
33 Ga0070684_102322549 3300005535 Bacteria 506
34 Ga0070697_100021576 3300005536 Bacteria 5104
35 Ga0068853_100516674 3300005539 Bacteria 1129
36 Ga0070672_100250411 3300005543 Bacteria 1492
37 Ga0070672_101192776 3300005543 Bacteria 678
38 Ga0070693_100756058 3300005547 Bacteria 717
39 Ga0070693_101422031 3300005547 Bacteria 540
40 Ga0070665_100003659 3300005548 Bacteria 16287
41 Ga0070665_100052241 3300005548 Bacteria 4100
42 Ga0070665_100225578 3300005548 Bacteria 1874
43 Ga0068855_100154313 3300005563 Bacteria 2610
44 Ga0068855_100862983 3300005563 Bacteria 958
45 Ga0068855_101051802 3300005563 Bacteria 853
46 Ga0070664_100074780 3300005564 Bacteria 2908
47 Ga0070664_100147751 3300005564 Bacteria 2074
48 Ga0070664_100516277 3300005564 Unclassified 1102
49 Ga0068857_100016904 3300005577 Bacteria 6392
50 Ga0068857_101487584 3300005577 Bacteria 660
51 Ga0068854_100529412 3300005578 Bacteria 997
52 Ga0068856_101193308 3300005614 Bacteria 777
53 Ga0068856_102418874 3300005614 Bacteria 532
54 Ga0070702_101581024 3300005615 Bacteria 542
55 Ga0068852_100018894 3300005616 Bacteria 5442
56 Ga0068852_100204772 3300005616 Bacteria 1869
57 Ga0068859_100246980 3300005617 Bacteria 1874
58 Ga0068864_100250227 3300005618 Bacteria 1645
59 Ga0068866_10149684 3300005718 Bacteria 1350
60 Ga0068851_10232583 3300005834 Bacteria 1039
61 Ga0068863_101459821 3300005841 Bacteria 692
62 Ga0068858_100168888 3300005842 Bacteria 2062
63 Ga0068860_100743484 3300005843 Bacteria 992
64 Ga0068860_101969262 3300005843 Bacteria 606
65 Ga0068860_102520767 3300005843 Bacteria 534
66 Ga0081455_10001357 3300005937 Bacteria 30275
67 Ga0081455_10081681 3300005937 Bacteria 2646
68 Ga0081539_10001002 3300005985 Bacteria 52454
69 Ga0081539_10010747 3300005985 Bacteria 7375
70 Ga0070717_11148730 3300006028 Bacteria 707
71 Ga0075365_10033578 3300006038 Bacteria 3308
72 Ga0075365_10297999 3300006038 Bacteria 1135
73 Ga0075365_10561483 3300006038 Bacteria 807
74 Ga0075368_10530190 3300006042 Bacteria 528
75 Ga0075363_100890505 3300006048 Bacteria 545
76 Ga0075364_10453045 3300006051 Bacteria 876
77 Ga0075364_10492028 3300006051 Bacteria 838
78 Ga0075364_10720393 3300006051 Bacteria 681
79 Ga0075364_10798977 3300006051 Bacteria 643
80 Ga0070716_100446064 3300006173 Bacteria 942
81 Ga0070712_100530877 3300006175 Bacteria 989
82 Ga0075362_10029036 3300006177 Bacteria 2380
83 Ga0075362_10184274 3300006177 Bacteria 1012
84 Ga0075362_10208074 3300006177 Bacteria 954
85 Ga0075362_10680821 3300006177 Bacteria 536
86 Ga0075367_10048964 3300006178 Bacteria 2491
87 Ga0075367_10230224 3300006178 Bacteria 1160
88 Ga0075367_10416287 3300006178 Bacteria 851
89 Ga0075367_10444493 3300006178 Bacteria 821
90 Ga0075367_10570611 3300006178 Bacteria 719
91 Ga0075369_10001393 3300006186 Bacteria 8249
92 Ga0075369_10010527 3300006186 Bacteria 3618
93 Ga0075369_10187791 3300006186 Bacteria 952
94 Ga0075369_10299366 3300006186 Bacteria 751
95 Ga0075369_10362376 3300006186 Bacteria 681
96 Ga0075366_10126897 3300006195 Bacteria 1539
97 Ga0075366_10393724 3300006195 Bacteria 852
98 Ga0075370_10288667 3300006353 Bacteria 975
99 Ga0075370_10449999 3300006353 Bacteria 775
100 Ga0075370_10699964 3300006353 Bacteria 616
101 Ga0068871_100570148 3300006358 Bacteria 1027
102 Ga0068871_100905130 3300006358 Bacteria 818
103 Ga0068871_100966969 3300006358 Bacteria 792
104 Ga0075428_101512349 3300006844 Bacteria 703
105 Ga0075430_100692381 3300006846 Bacteria 840
106 Ga0075429_100397822 3300006880 Bacteria 1206
107 Ga0068865_101968714 3300006881 Bacteria 530
108 Ga0075436_100435701 3300006914 Unclassified 953
109 Ga0097620_100246992 3300006931 Bacteria 1874
110 Ga0099794_10127860 3300007265 Bacteria 1282
111 Ga0105240_10049816 3300009093 Bacteria 5284
112 Ga0105240_10577001 3300009093 Bacteria 1241
113 Ga0105240_12444464 3300009093 Bacteria 540
114 Ga0111539_10381978 3300009094 Bacteria 1640
115 Ga0111539_11332043 3300009094 Bacteria 833
116 Ga0111539_13151086 3300009094 Bacteria 532
117 Ga0105245_11445146 3300009098 Bacteria 738
118 Ga0105245_13089911 3300009098 Bacteria 516
119 Ga0105247_10801250 3300009101 Unclassified 719
120 Ga0105243_10823537 3300009148 Bacteria 917
121 Ga0105243_11361058 3300009148 Bacteria 729
122 Ga0105241_10043976 3300009174 Bacteria 3383
123 Ga0105241_10455693 3300009174 Bacteria 1132
124 Ga0105242_11176551 3300009176 Bacteria 785
125 Ga0105237_10197384 3300009545 Bacteria 2012
126 Ga0105237_11274484 3300009545 Bacteria 741
127 Ga0105238_10165225 3300009551 Bacteria 2189
128 Ga0105238_11592676 3300009551 Bacteria 683
129 Ga0105249_12279351 3300009553 Bacteria 614
130 Ga0105035_105012 3300009988 Bacteria 1064
131 Ga0099796_10109681 3300010159 Bacteria 1049
132 Ga0105239_12745108 3300010375 Bacteria 575
133 Ga0157373_10782382 3300013100 Bacteria 703
134 Ga0157371_10178612 3300013102 Bacteria 1518
135 Ga0157370_10748177 3300013104 Bacteria 891
136 Ga0157370_11152331 3300013104 Bacteria 700
137 Ga0157369_10273200 3300013105 Bacteria 1761
138 Ga0157374_10864412 3300013296 Bacteria 921
139 Ga0163162_10453862 3300013306 Bacteria 1414
140 Ga0163162_11953898 3300013306 Bacteria 672
141 Ga0163162_13134465 3300013306 Bacteria 531
142 Ga0163162_13391614 3300013306 Bacteria 509
143 Ga0157372_12986866 3300013307 Bacteria 541
144 Ga0157380_13141278 3300014326 Bacteria 527
145 Ga0182008_10392077 3300014497 Bacteria 744
146 Ga0157377_10321250 3300014745 Bacteria 1029
147 Ga0157376_10294670 3300014969 Bacteria 1533
148 Ga0157376_10371391 3300014969 Bacteria 1375
149 Ga0157376_10975935 3300014969 Bacteria 869
150 Ga0197907_10961808 3300020069 Bacteria 547
151 Ga0206356_10744336 3300020070 Bacteria 775
152 Ga0206353_10685292 3300020082 Bacteria 2114
153 Ga0213872_10110061 3300021361 Bacteria 1224
154 Ga0213874_10019076 3300021377 Bacteria 1862
155 Ga0213871_10008300 3300021441 Bacteria 2284
156 Ga0207426_1050360 3300025302 Bacteria 1242
157 Ga0207656_10558419 3300025321 Bacteria 583
158 Ga0207642_10491939 3300025899 Bacteria 750
159 Ga0207699_10909641 3300025906 Bacteria 649
160 Ga0207645_10113685 3300025907 Bacteria 1754
161 Ga0207643_10644809 3300025908 Bacteria 683
162 Ga0207705_10631249 3300025909 Bacteria 833
163 Ga0207654_10022838 3300025911 Bacteria 3343
164 Ga0207654_10740605 3300025911 Bacteria 708
165 Ga0207693_10039417 3300025915 Bacteria 3721
166 Ga0207693_10108867 3300025915 Bacteria 2174
167 Ga0207663_10041428 3300025916 Bacteria 2807
168 Ga0207663_10820060 3300025916 Bacteria 742
169 Ga0207657_10080691 3300025919 Bacteria 2734
170 Ga0207649_10050165 3300025920 Bacteria 2580
171 Ga0207649_10259246 3300025920 Bacteria 1256
172 Ga0207652_11437880 3300025921 Bacteria 593
173 Ga0207646_10892014 3300025922 Bacteria 789
174 Ga0207694_10176422 3300025924 Bacteria 1732
175 Ga0207659_10371771 3300025926 Bacteria 1190
176 Ga0207687_10031394 3300025927 Bacteria 3589
177 Ga0207687_10385002 3300025927 Bacteria 1150
178 Ga0207644_11153582 3300025931 Bacteria 651
179 Ga0207706_10530614 3300025933 Bacteria 1014
180 Ga0207709_10817180 3300025935 Bacteria 753
181 Ga0207670_10100466 3300025936 Bacteria 2065
182 Ga0207669_10586568 3300025937 Bacteria 904
183 Ga0207669_10625734 3300025937 Bacteria 878
184 Ga0207704_10699939 3300025938 Bacteria 839
185 Ga0207691_10181756 3300025940 Bacteria 1837
186 Ga0207661_10125612 3300025944 Bacteria 2190
187 Ga0207679_10003441 3300025945 Bacteria 9767
188 Ga0207679_10106996 3300025945 Bacteria 2199
189 Ga0207667_10061599 3300025949 Bacteria 3925
190 Ga0207667_10109311 3300025949 Bacteria 2851
191 Ga0207667_11234782 3300025949 Bacteria 726
192 Ga0207668_10369215 3300025972 Bacteria 1205
193 Ga0207640_10181238 3300025981 Bacteria 1579
194 Ga0207640_11849563 3300025981 Bacteria 546
195 Ga0207640_12129310 3300025981 Bacteria 509
196 Ga0207703_10327383 3300026035 Bacteria 1405
197 Ga0207703_10661510 3300026035 Bacteria 991
198 Ga0207703_11080421 3300026035 Bacteria 771
199 Ga0207639_10331867 3300026041 Bacteria 1353
200 Ga0207639_10447242 3300026041 Bacteria 1172
201 Ga0207702_10096552 3300026078 Bacteria 2599
202 Ga0207702_12175472 3300026078 Bacteria 544
203 Ga0207648_10815189 3300026089 Bacteria 869
204 Ga0207674_10010621 3300026116 Bacteria 10414
205 Ga0207674_10079633 3300026116 Bacteria 3280
206 Ga0207675_100634670 3300026118 Bacteria 1073
207 Ga0207683_10060434 3300026121 Bacteria 3331
208 Ga0207683_11365894 3300026121 Bacteria 655
209 Ga0207698_10020199 3300026142 Bacteria 4579
210 Ga0207698_10298872 3300026142 Bacteria 1498
211 Ga0207428_10281325 3300027907 Bacteria 1235
212 Ga0268266_10056272 3300028379 Bacteria 3383
213 Ga0268266_10074490 3300028379 Bacteria 2948
214 Ga0268266_10516157 3300028379 Bacteria 1142
215 Ga0268266_10798506 3300028379 Bacteria 911
216 Ga0268266_12270050 3300028379 Unclassified 514
217 Ga0268264_11340607 3300028381 Bacteria 726
218 Ga0268264_11592115 3300028381 Bacteria 664
219 Ga0265334_10022820 3300028573 Bacteria 2547
220 Ga0265340_10029363 3300031247 Bacteria 2762
221 Ga0265316_10334695 3300031344 Bacteria 1098
222 Ga0307509_10040219 3300031507 Bacteria 5086
223 Ga0307509_10795941 3300031507 Bacteria 610
224 Ga0265342_10323268 3300031712 Bacteria 808
225 Ga0307518_10000210 3300031838 Bacteria 44276
226 Ga0307406_10599344 3300031901 Bacteria 908
227 Ga0307416_101829219 3300032002 Bacteria 711
228 Ga0373926_0012278 3300035083 Bacteria 2895
229 Ga0373934_0177835 3300035086 Bacteria 874
230 Ga0373936_0006106 3300035113 Bacteria 4539
231 Ga0373936_0131993 3300035113 Bacteria 1074
232 Ga0373946_0165969 3300035171 Bacteria 1040
233 Ga0373955_1000757 3300035172 Bacteria 515
234 Ga0373942_0016191 3300035207 Bacteria 1827
235 Ga0373931_0086051 3300035691 Bacteria 1744
236 Ga0373931_0735593 3300035691 Bacteria 654
237 Ga0373931_1051278 3300035691 Bacteria 553
238 Ga0373935_0492013 3300035692 Bacteria 890
239 Ga0373927_0281115 3300035695 Bacteria 1095
240 Ga0373927_0477499 3300035695 Bacteria 824
241 Ga0373947_0869314 3300035725 Bacteria 616
242 Ga0373937_0117513 3300036401 Bacteria 2477
243 Ga0373937_0762265 3300036401 Bacteria 915
244 Ga0373925_1296972 3300037068 Bacteria 597
245 Ga0373925_1427544 3300037068 Bacteria 567
246 Ga0395899_0043398 3300037312 Bacteria 3354
247 Ga0395900_0006685 3300037418 Bacteria 11982
248 Ga0395900_0061123 3300037418 Bacteria 3874
249 Ga0395900_1686364 3300037418 Bacteria 545
250 Ga0395905_0190136 3300037471 Bacteria 1926
251 Ga0395901_0034241 3300038443 Bacteria 5245
252 Ga0395901_0082293 3300038443 Bacteria 3363
253 Ga0436365_0773672 3300039437 Bacteria 3597
254 Ga0436360_0053944 3300039438 Bacteria 9297
255 Ga0436360_0994378 3300039438 Bacteria 564
256 Ga0436361_0769855 3300039447 Bacteria 720
257 Ga0436361_1184843 3300039447 Bacteria 5137
258 Ga0436363_0076429 3300039450 Bacteria 684
259 Ga0436363_0678303 3300039450 Bacteria 600
260 Ga0436363_1204188 3300039450 Bacteria 4442
261 Ga0451797_0362583 3300041453 Bacteria 666
262 Ga0451795_1676127 3300041456 Bacteria 627
263 Ga0451849_1266050 3300041505 Bacteria 616
264 Ga0451843_0061257 3300041509 Bacteria 790
265 Ga0439448_0036496 3300042005 Bacteria 1577
266 Ga0466957_0035732 3300044842 Bacteria 2983
267 Ga0466958_0334341 3300045836 Bacteria 974
268 Ga0466967_0333796 3300045976 Bacteria 1464
269 Ga0466967_0645661 3300045976 Bacteria 1046
270 Ga0495603_0080836 3300046455 Bacteria 1904
271 Ga0495629_1097025 3300046459 Bacteria 515
272 Ga0495628_0034818 3300046516 Bacteria 4049
273 Ga0495628_0439599 3300046516 Bacteria 948
274 Ga0495630_0775792 3300046517 Bacteria 732
275 Ga0495631_0422105 3300046518 Bacteria 568
276 Ga0495640_0879940 3300046533 Bacteria 531
277 Ga0495645_0025049 3300046543 Bacteria 4330
278 Ga0495645_0760337 3300046543 Bacteria 584
279 Ga0495611_0283942 3300046648 Bacteria 764
280 Ga0495635_0346755 3300046663 Bacteria 991
281 Ga0495588_0201933 3300046674 Bacteria 1050
282 Ga0495599_0228134 3300046678 Bacteria 1138
283 Ga0495646_0067757 3300046680 Bacteria 2109
284 Ga0495589_0309682 3300046794 Bacteria 731
285 Ga0495604_0315064 3300047317 Bacteria 1047
286 Ga0495675_0114882 3300047444 Bacteria 1679
287 Ga0495684_0023321 3300047471 Bacteria 4758
288 Ga0495614_0233629 3300048089 Bacteria 838
289 Ga0496100_0906379 3300048903 Bacteria 692
290 Ga0496101_0082369 3300048904 Bacteria 2381
291 Ga0496101_1124533 3300048904 Bacteria 616
292 Ga0496102_0514054 3300048905 Bacteria 1120
293 Ga0496103_0940613 3300048906 Bacteria 540
294 Ga0496104_0045777 3300048907 Bacteria 4117
295 Ga0496104_1880264 3300048907 Bacteria 501
296 Ga0496105_0160170 3300048908 Bacteria 1848
297 Ga0496107_1236101 3300048910 Bacteria 536
298 Ga0496108_0389500 3300048911 Bacteria 1217
299 Ga0496110_0271459 3300048913 Bacteria 1544
300 Ga0496111_0298459 3300048914 Bacteria 1194
301 Ga0496112_0206095 3300048915 Bacteria 1924
302 Ga0496115_0099928 3300048918 Bacteria 2378
303 Ga0496115_1265791 3300048918 Bacteria 551
304 Ga0496126_0360267 3300048929 Bacteria 1188
305 Ga0501034_0490600 3300049571 Bacteria 1143
306 Ga0501046_0876905 3300049580 Bacteria 627
307 Ga0501047_0270254 3300049581 Bacteria 1546
308 Ga0501074_0951061 3300049590 Bacteria 604
309 Ga0501083_0808905 3300049744 Bacteria 610
310 nmdc:mga03683_285204_c1 3300050489 Bacteria 772
311 nmdc:mga03683_392019_c1 3300050489 Bacteria 662
312 nmdc:mga03683_674166_c1 3300050489 Bacteria 510
313 nmdc:mga03n38_399811_c1 3300050490 Unclassified 756
314 nmdc:mga03n38_925896_c1 3300050490 Bacteria 513
315 nmdc:mga0yw44_227855_c1 3300050492 Bacteria 1236
316 nmdc:mga0yw44_336630_c1 3300050492 Bacteria 1015
317 nmdc:mga0yw44_389028_c1 3300050492 Bacteria 942
318 nmdc:mga0yw44_43806_c1 3300050492 Bacteria 2674
319 nmdc:mga0yw44_566145_c1 3300050492 Bacteria 772
320 nmdc:mga0yw44_708068_c1 3300050492 Bacteria 684
321 nmdc:mga0k408_406352_c1 3300050493 Unclassified 810
322 nmdc:mga0k408_686801_c1 3300050493 Bacteria 600
323 nmdc:mga0k408_811718_c1 3300050493 Bacteria 545
324 nmdc:mga0k408_849372_c1 3300050493 Bacteria 531
325 nmdc:mga06z11_140342_c1 3300050494 Bacteria 1365
326 nmdc:mga06z11_38930_c1 3300050494 Bacteria 2364
327 nmdc:mga06z11_639235_c1 3300050494 Bacteria 648
328 nmdc:mga07m45_112767_c1 3300050496 Bacteria 1567
329 nmdc:mga07m45_210002_c1 3300050496 Bacteria 825
330 nmdc:mga09592_261565_c1 3300050508 Bacteria 1500
331 nmdc:mga08y16_1046794_c1 3300050511 Bacteria 794
332 nmdc:mga0sz30_290001_c1 3300050516 Bacteria 729
333 nmdc:mga0sz30_363591_c1 3300050516 Bacteria 647
334 nmdc:mga0sz30_823_c1 3300050516 Bacteria 11210
335 Ga0500635_0006128 3300053080 Bacteria 3197
336 Ga0495655_0088656 3300053083 Bacteria 898
337 Ga0500643_118045 3300053087 Bacteria 715
338 Ga0500566_0203857 3300053094 Bacteria 996
339 Ga0500641_0003156 3300053096 Bacteria 5839
340 Ga0500554_018039 3300053102 Bacteria 1898
341 Ga0500554_049547 3300053102 Bacteria 1318
342 Ga0500595_000650 3300053119 Bacteria 20929
343 Ga0500614_244783 3300053123 Bacteria 559
344 Ga0500559_0128063 3300053136 Bacteria 1185
345 Ga0500603_001657 3300053150 Bacteria 5012
346 Ga0500603_101357 3300053150 Bacteria 856
347 Ga0500638_018024 3300053162 Bacteria 3287
348 Ga0500636_0364719 3300053177 Bacteria 684
349 Ga0500637_0028430 3300053178 Bacteria 3092
350 Ga0500637_0166750 3300053178 Bacteria 1267
351 Ga0500552_001503 3300053733 Bacteria 2230
352 Ga0500661_000165 3300055283 Bacteria 11427
353 Ga0587066_023694 3300059490 Bacteria 1039
354 Ga0587066_082531 3300059490 Bacteria 699
355 Ga0587073_0102507 3300059492 Unclassified 746
356 Ga0501082_1048091 3300060353 Bacteria 713
357 2586061534 2585427649 Bacteria 9053857
358 2809589357 2808606522 Bacteria 9488490
359 2885380074 2885374607 Bacteria 8927485
360 3005476108 3005474847 Bacteria 9259049
361 Ga0495634_0717984
362 rootH1_10107014
363 Ga0070683_100187891
364 Ga0070683_101812446
365 Ga0068868_101198906
366 Ga0070689_100082469
367 Ga0070689_100183708
368 Ga0070661_100048175
369 Ga0070661_100106967
370 Ga0070675_100205447
371 Ga0070671_100586211
372 Ga0070659_100746737
373 Ga0070659_102106035
374 Ga0070709_11689989
375 Ga0070714_100073525
376 Ga0070713_101587776
377 Ga0070713_101631532
378 Ga0070710_10961159
379 Ga0070711_100679094
380 Ga0070711_100710789
381 Ga0070708_100438161
382 Ga0070678_100980594
383 Ga0068867_100250902
384 Ga0068867_101499891
385 Ga0070706_100956355
386 Ga0070707_100194446
387 Ga0070707_101551737
388 Ga0070698_100037026
389 Ga0070699_100029858
390 Ga0070679_100435080
391 Ga0070679_101845907
392 Ga0070684_100024372
393 Ga0070684_102322549
394 Ga0070697_100021576
395 Ga0068853_100516674
396 Ga0070672_100250411
397 Ga0070672_101192776
398 Ga0070693_100756058
399 Ga0070693_101422031
400 Ga0070665_100003659
401 Ga0070665_100052241
402 Ga0070665_100225578
403 Ga0068855_100154313
404 Ga0068855_100862983
405 Ga0068855_101051802
406 Ga0070664_100074780
407 Ga0070664_100147751
408 Ga0070664_100516277
409 Ga0068857_100016904
410 Ga0068857_101487584
411 Ga0068854_100529412
412 Ga0068856_101193308
413 Ga0068856_102418874
414 Ga0070702_101581024
415 Ga0068852_100018894
416 Ga0068852_100204772
417 Ga0068859_100246980
418 Ga0068864_100250227
419 Ga0068866_10149684
420 Ga0068851_10232583
421 Ga0068863_101459821
422 Ga0068858_100168888
423 Ga0068860_100743484
424 Ga0068860_101969262
425 Ga0068860_102520767
426 Ga0081455_10001357
427 Ga0081455_10081681
428 Ga0081539_10001002
429 Ga0081539_10010747
430 Ga0070717_11148730
431 Ga0075365_10033578
432 Ga0075365_10297999
433 Ga0075365_10561483
434 Ga0075368_10530190
435 Ga0075363_100890505
436 Ga0075364_10453045
437 Ga0075364_10492028
438 Ga0075364_10720393
439 Ga0075364_10798977
440 Ga0070716_100446064
441 Ga0070712_100530877
442 Ga0075362_10029036
443 Ga0075362_10184274
444 Ga0075362_10208074
445 Ga0075362_10680821
446 Ga0075367_10048964
447 Ga0075367_10230224
448 Ga0075367_10416287
449 Ga0075367_10444493
450 Ga0075367_10570611
451 Ga0075369_10001393
452 Ga0075369_10010527
453 Ga0075369_10187791
454 Ga0075369_10299366
455 Ga0075369_10362376
456 Ga0075366_10126897
457 Ga0075366_10393724
458 Ga0075370_10288667
459 Ga0075370_10449999
460 Ga0075370_10699964
461 Ga0068871_100570148
462 Ga0068871_100905130
463 Ga0068871_100966969
464 Ga0075428_101512349
465 Ga0075430_100692381
466 Ga0075429_100397822
467 Ga0068865_101968714
468 Ga0075436_100435701
469 Ga0097620_100246992
470 Ga0099794_10127860
471 Ga0105240_10049816
472 Ga0105240_10577001
473 Ga0105240_12444464
474 Ga0111539_10381978
475 Ga0111539_11332043
476 Ga0111539_13151086
477 Ga0105245_11445146
478 Ga0105245_13089911
479 Ga0105247_10801250
480 Ga0105243_10823537
481 Ga0105243_11361058
482 Ga0105241_10043976
483 Ga0105241_10455693
484 Ga0105242_11176551
485 Ga0105237_10197384
486 Ga0105237_11274484
487 Ga0105238_10165225
488 Ga0105238_11592676
489 Ga0105249_12279351
490 Ga0105035_105012
491 Ga0099796_10109681
492 Ga0105239_12745108
493 Ga0157373_10782382
494 Ga0157371_10178612
495 Ga0157370_10748177
496 Ga0157370_11152331
497 Ga0157369_10273200
498 Ga0157374_10864412
499 Ga0163162_10453862
500 Ga0163162_11953898
501 Ga0163162_13134465
502 Ga0163162_13391614
503 Ga0157372_12986866
504 Ga0157380_13141278
505 Ga0182008_10392077
506 Ga0157377_10321250
507 Ga0157376_10294670
508 Ga0157376_10371391
509 Ga0157376_10975935
510 Ga0197907_10961808
511 Ga0206356_10744336
512 Ga0206353_10685292
513 Ga0213872_10110061
514 Ga0213874_10019076
515 Ga0213871_10008300
516 Ga0207426_1050360
517 Ga0207656_10558419
518 Ga0207642_10491939
519 Ga0207699_10909641
520 Ga0207645_10113685
521 Ga0207643_10644809
522 Ga0207705_10631249
523 Ga0207654_10022838
524 Ga0207654_10740605
525 Ga0207693_10039417
526 Ga0207693_10108867
527 Ga0207663_10041428
528 Ga0207663_10820060
529 Ga0207657_10080691
530 Ga0207649_10050165
531 Ga0207649_10259246
532 Ga0207652_11437880
533 Ga0207646_10892014
534 Ga0207694_10176422
535 Ga0207659_10371771
536 Ga0207687_10031394
537 Ga0207687_10385002
538 Ga0207644_11153582
539 Ga0207706_10530614
540 Ga0207709_10817180
541 Ga0207670_10100466
542 Ga0207669_10586568
543 Ga0207669_10625734
544 Ga0207704_10699939
545 Ga0207691_10181756
546 Ga0207661_10125612
547 Ga0207679_10003441
548 Ga0207679_10106996
549 Ga0207667_10061599
550 Ga0207667_10109311
551 Ga0207667_11234782
552 Ga0207668_10369215
553 Ga0207640_10181238
554 Ga0207640_11849563
555 Ga0207640_12129310
556 Ga0207703_10327383
557 Ga0207703_10661510
558 Ga0207703_11080421
559 Ga0207639_10331867
560 Ga0207639_10447242
561 Ga0207702_10096552
562 Ga0207702_12175472
563 Ga0207648_10815189
564 Ga0207674_10010621
565 Ga0207674_10079633
566 Ga0207675_100634670
567 Ga0207683_10060434
568 Ga0207683_11365894
569 Ga0207698_10020199
570 Ga0207698_10298872
571 Ga0207428_10281325
572 Ga0268266_10056272
573 Ga0268266_10074490
574 Ga0268266_10516157
575 Ga0268266_10798506
576 Ga0268266_12270050
577 Ga0268264_11340607
578 Ga0268264_11592115
579 Ga0265334_10022820
580 Ga0265340_10029363
581 Ga0265316_10334695
582 Ga0307509_10040219
583 Ga0307509_10795941
584 Ga0265342_10323268
585 Ga0307518_10000210
586 Ga0307406_10599344
587 Ga0307416_101829219
588 Ga0373926_0012278
589 Ga0373934_0177835
590 Ga0373936_0006106
591 Ga0373936_0131993
592 Ga0373946_0165969
593 Ga0373955_1000757
594 Ga0373942_0016191
595 Ga0373931_0086051
596 Ga0373931_0735593
597 Ga0373931_1051278
598 Ga0373935_0492013
599 Ga0373927_0281115
600 Ga0373927_0477499
601 Ga0373947_0869314
602 Ga0373937_0117513
603 Ga0373937_0762265
604 Ga0373925_1296972
605 Ga0373925_1427544
606 Ga0395899_0043398
607 Ga0395900_0006685
608 Ga0395900_0061123
609 Ga0395900_1686364
610 Ga0395905_0190136
611 Ga0395901_0034241
612 Ga0395901_0082293
613 Ga0436365_0773672
614 Ga0436360_0053944
615 Ga0436360_0994378
616 Ga0436361_0769855
617 Ga0436361_1184843
618 Ga0436363_0076429
619 Ga0436363_0678303
620 Ga0436363_1204188
621 Ga0451797_0362583
622 Ga0451795_1676127
623 Ga0451849_1266050
624 Ga0451843_0061257
625 Ga0439448_0036496
626 Ga0466957_0035732
627 Ga0466958_0334341
628 Ga0466967_0333796
629 Ga0466967_0645661
630 Ga0495603_0080836
631 Ga0495629_1097025
632 Ga0495628_0034818
633 Ga0495628_0439599
634 Ga0495630_0775792
635 Ga0495631_0422105
636 Ga0495640_0879940
637 Ga0495645_0025049
638 Ga0495645_0760337
639 Ga0495611_0283942
640 Ga0495635_0346755
641 Ga0495588_0201933
642 Ga0495599_0228134
643 Ga0495646_0067757
644 Ga0495589_0309682
645 Ga0495604_0315064
646 Ga0495675_0114882
647 Ga0495684_0023321
648 Ga0495614_0233629
649 Ga0496100_0906379
650 Ga0496101_0082369
651 Ga0496101_1124533
652 Ga0496102_0514054
653 Ga0496103_0940613
654 Ga0496104_0045777
655 Ga0496104_1880264
656 Ga0496105_0160170
657 Ga0496107_1236101
658 Ga0496108_0389500
659 Ga0496110_0271459
660 Ga0496111_0298459
661 Ga0496112_0206095
662 Ga0496115_0099928
663 Ga0496115_1265791
664 Ga0496126_0360267
665 Ga0501034_0490600
666 Ga0501046_0876905
667 Ga0501047_0270254
668 Ga0501074_0951061
669 Ga0501083_0808905
670 nmdc:mga03683_285204_c1
671 nmdc:mga03683_392019_c1
672 nmdc:mga03683_674166_c1
673 nmdc:mga03n38_399811_c1
674 nmdc:mga03n38_925896_c1
675 nmdc:mga0yw44_227855_c1
676 nmdc:mga0yw44_336630_c1
677 nmdc:mga0yw44_389028_c1
678 nmdc:mga0yw44_43806_c1
679 nmdc:mga0yw44_566145_c1
680 nmdc:mga0yw44_708068_c1
681 nmdc:mga0k408_406352_c1
682 nmdc:mga0k408_686801_c1
683 nmdc:mga0k408_811718_c1
684 nmdc:mga0k408_849372_c1
685 nmdc:mga06z11_140342_c1
686 nmdc:mga06z11_38930_c1
687 nmdc:mga06z11_639235_c1
688 nmdc:mga07m45_112767_c1
689 nmdc:mga07m45_210002_c1
690 nmdc:mga09592_261565_c1
691 nmdc:mga08y16_1046794_c1
692 nmdc:mga0sz30_290001_c1
693 nmdc:mga0sz30_363591_c1
694 nmdc:mga0sz30_823_c1
695 Ga0500635_0006128
696 Ga0495655_0088656
697 Ga0500643_118045
698 Ga0500566_0203857
699 Ga0500641_0003156
700 Ga0500554_018039
701 Ga0500554_049547
702 Ga0500595_000650
703 Ga0500614_244783
704 Ga0500559_0128063
705 Ga0500603_001657
706 Ga0500603_101357
707 Ga0500638_018024
708 Ga0500636_0364719
709 Ga0500637_0028430
710 Ga0500637_0166750
711 Ga0500552_001503
712 Ga0500661_000165
713 Ga0587066_023694
714 Ga0587066_082531
715 Ga0587073_0102507
716 Ga0501082_1048091
717 2586061534
718 2809589357
719 2885380074
720 3005476108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

27

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.9407 19 102
8ffz-assembly1.cif.gz_B tfiiia-tfiiic-brf1-tbp complex bound to 5s rrna gene 0.9302 31 83
8r57-assembly1.cif.gz_T cryoem structure of wheat 40s ribosomal subunit, head domain 0.9298 56 88
5hs9-assembly1.cif.gz_B crystal structure of the quinone-bound yodb from b. subtilis 0.921 19 102
8b2l-assembly1.cif.gz_E1 cryo-em structure of the plant 80s ribosome 0.9205 56 88
ID Description Score Start End Superfamily
af_P71983_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 18 103 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9407 19 102 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.921 19 102 1.10.10.10
af_A0A1D6IJX7_668_823_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9103 54 89 1.20.120.1080
af_Q59048_168_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9086 31 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R9M9G6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9893 20 109 GO:0003677
AF-A0A378WQG8-F1-model_v4 Uncharacterized HTH-type transcriptional regulator ytcD 0.9854 18 103 GO:0003677
AF-A0A1H4SED5-F1-model_v4 DNA-binding transcriptional regulator, HxlR family 0.9841 20 108 GO:0003677
AF-S4AS27-F1-model_v4 HTH hxlR-type domain-containing protein 0.9818 20 108 GO:0003677
AF-A0A3D4VTC9-F1-model_v4 Transcriptional regulator 0.9787 19 102 GO:0003677

Map