F421908

General Info

Members Datasets Scaffolds Average Seq Length
360 199 360 277

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10004936|Ga0265338_1000493617
Length 309
Sequence MTRRIPVPPKCLPEQGCASGGHPVNPVLVGAGGNAYIAPMIPFLKMHGLGNDFAVFDARKQALVIDAALATKLADRRRGIGCDQLIVIEPSPVTDAFMRIRNNDGSEVETCGNAARCVARLLLNESGKSSVTLMTLAGALHCTDAGGGAVTVDMGAPEFAWKAIPLAEKMDTNMFALVVDDKLYMAAAVSMGNPHCVLFVEDADKAPVATLGPQLETHNMFPRRTNVEFVSVRDRSHLRMRVWERGAGITQACGSGTCAVAAAAHRRGLTDDKVEVELDGGILHIELKDGHVFMTGPTALSYRGEVAFS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 0.28
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10006530 3300003320 Bacteria 11340
2 Ga0070658_10007628 3300005327 Bacteria 8723
3 Ga0070690_100077083 3300005330 Bacteria 2175
4 Ga0070690_100139559 3300005330 Bacteria 1644
5 Ga0068869_100026271 3300005334 Bacteria 4052
6 Ga0070666_10002099 3300005335 Bacteria 12114
7 Ga0068868_100293033 3300005338 Bacteria 1380
8 Ga0070660_100034440 3300005339 Bacteria 3826
9 Ga0070689_100015658 3300005340 Bacteria 5534
10 Ga0070689_100263324 3300005340 Bacteria 1425
11 Ga0070689_100265880 3300005340 Unclassified 1419
12 Ga0070691_10001149 3300005341 Bacteria 11019
13 Ga0070661_100000076 3300005344 Bacteria 78818
14 Ga0070668_100232499 3300005347 Bacteria 1524
15 Ga0070674_100048817 3300005356 Bacteria 2907
16 Ga0070688_100050234 3300005365 Bacteria 2597
17 Ga0070709_10001503 3300005434 Bacteria 12611
18 Ga0070709_10110405 3300005434 Bacteria 1848
19 Ga0070709_10136171 3300005434 Bacteria 1682
20 Ga0070714_100121800 3300005435 Bacteria 2321
21 Ga0070714_100275336 3300005435 Bacteria 1562
22 Ga0070713_100000017 3300005436 Bacteria 120503
23 Ga0070713_100299068 3300005436 Bacteria 1481
24 Ga0070713_100542560 3300005436 Bacteria 1100
25 Ga0070701_10010430 3300005438 Bacteria 4109
26 Ga0070711_100113072 3300005439 Bacteria 1996
27 Ga0070705_100049572 3300005440 Bacteria 2439
28 Ga0070700_100177763 3300005441 Bacteria 1479
29 Ga0070694_100050696 3300005444 Bacteria 2799
30 Ga0070694_100107004 3300005444 Bacteria 1987
31 Ga0070708_100134496 3300005445 Bacteria 2289
32 Ga0070681_10214282 3300005458 Bacteria 1842
33 Ga0068867_100108349 3300005459 Bacteria 2131
34 Ga0070706_100024941 3300005467 Bacteria 5504
35 Ga0070706_100045757 3300005467 Bacteria 4041
36 Ga0070706_100315824 3300005467 Unclassified 1457
37 Ga0070706_100481119 3300005467 Unclassified 1155
38 Ga0070707_100015055 3300005468 Bacteria 7257
39 Ga0070707_100031809 3300005468 Bacteria 5026
40 Ga0070707_100285726 3300005468 Bacteria 1603
41 Ga0070698_100013159 3300005471 Bacteria 8756
42 Ga0070698_100016340 3300005471 Bacteria 7836
43 Ga0070698_100026790 3300005471 Bacteria 5996
44 Ga0070699_100005100 3300005518 Bacteria 11558
45 Ga0070699_100094857 3300005518 Bacteria 2612
46 Ga0070684_100081109 3300005535 Bacteria 2870
47 Ga0070697_100026936 3300005536 Bacteria 4596
48 Ga0068853_100002866 3300005539 Bacteria 13083
49 Ga0068853_100042847 3300005539 Bacteria 3872
50 Ga0068853_100108210 3300005539 Bacteria 2466
51 Ga0070672_100231166 3300005543 Bacteria 1553
52 Ga0070686_100078370 3300005544 Bacteria 2181
53 Ga0070695_100009207 3300005545 Bacteria 5871
54 Ga0070695_100040134 3300005545 Bacteria 2962
55 Ga0070696_100092631 3300005546 Bacteria 2154
56 Ga0070696_100247148 3300005546 Bacteria 1348
57 Ga0070704_100010403 3300005549 Bacteria 5658
58 Ga0070704_100063934 3300005549 Bacteria 2643
59 Ga0070704_100074114 3300005549 Bacteria 2482
60 Ga0070704_100221794 3300005549 Bacteria 1538
61 Ga0068855_100233438 3300005563 Bacteria 2058
62 Ga0068857_100001321 3300005577 Bacteria 19501
63 Ga0068854_100077431 3300005578 Bacteria 2447
64 Ga0068856_100005003 3300005614 Bacteria 13122
65 Ga0068856_100062959 3300005614 Bacteria 3664
66 Ga0070702_100028232 3300005615 Bacteria 3040
67 Ga0070702_100146067 3300005615 Bacteria 1512
68 Ga0068852_100096124 3300005616 Bacteria 2662
69 Ga0068852_100191814 3300005616 Bacteria 1928
70 Ga0068852_100838297 3300005616 Bacteria 935
71 Ga0068859_100019586 3300005617 Bacteria 6797
72 Ga0068864_100050602 3300005618 Bacteria 3577
73 Ga0068858_100008489 3300005842 Bacteria 9872
74 Ga0068858_100049333 3300005842 Bacteria 3898
75 Ga0068862_100065155 3300005844 Bacteria 3138
76 Ga0075365_10004957 3300006038 Bacteria 7124
77 Ga0075364_10012948 3300006051 Bacteria 5119
78 Ga0070712_100000178 3300006175 Bacteria 35205
79 Ga0070712_100001632 3300006175 Bacteria 13719
80 Ga0075367_10003320 3300006178 Bacteria 7637
81 Ga0075366_10001113 3300006195 Bacteria 13230
82 Ga0075428_100013548 3300006844 Bacteria 9079
83 Ga0075428_100016250 3300006844 Bacteria 8227
84 Ga0075428_100018469 3300006844 Bacteria 7709
85 Ga0075428_100085124 3300006844 Bacteria 3448
86 Ga0075431_100004914 3300006847 Bacteria 13166
87 Ga0075433_10041009 3300006852 Bacteria 4010
88 Ga0075434_100049446 3300006871 Bacteria 4175
89 Ga0075434_100066566 3300006871 Bacteria 3588
90 Ga0075434_100152384 3300006871 Bacteria 2332
91 Ga0075434_100205746 3300006871 Bacteria 1988
92 Ga0075434_100243001 3300006871 Unclassified 1820
93 Ga0075434_100337023 3300006871 Bacteria 1529
94 Ga0075434_100372284 3300006871 Bacteria 1449
95 Ga0075429_100014103 3300006880 Bacteria 6923
96 Ga0075429_100027543 3300006880 Bacteria 4933
97 Ga0068865_100042529 3300006881 Bacteria 3099
98 Ga0075436_100002284 3300006914 Bacteria 13220
99 Ga0075436_100028792 3300006914 Bacteria 3821
100 Ga0097620_100019586 3300006931 Bacteria 6797
101 Ga0075435_100012316 3300007076 Bacteria 6328
102 Ga0105240_10020413 3300009093 Bacteria 8838
103 Ga0105240_10021184 3300009093 Bacteria 8652
104 Ga0105240_10037415 3300009093 Bacteria 6238
105 Ga0111539_10007017 3300009094 Bacteria 14452
106 Ga0111539_10034411 3300009094 Bacteria 6142
107 Ga0111539_10035995 3300009094 Bacteria 5989
108 Ga0114129_10016605 3300009147 Bacteria 10486
109 Ga0114129_10056615 3300009147 Bacteria 5491
110 Ga0114129_10136023 3300009147 Bacteria 3372
111 Ga0114129_10155176 3300009147 Bacteria 3131
112 Ga0114129_10155745 3300009147 Bacteria 3124
113 Ga0114129_10451822 3300009147 Unclassified 1685
114 Ga0114129_10540990 3300009147 Unclassified 1516
115 Ga0114129_10658223 3300009147 Unclassified 1351
116 Ga0105243_10077093 3300009148 Bacteria 2710
117 Ga0105241_10022570 3300009174 Bacteria 4662
118 Ga0105242_10082887 3300009176 Bacteria 2684
119 Ga0105248_10075443 3300009177 Bacteria 3790
120 Ga0105248_10197031 3300009177 Bacteria 2270
121 Ga0105237_10008261 3300009545 Bacteria 11304
122 Ga0105238_10000620 3300009551 Bacteria 37357
123 Ga0105238_10017673 3300009551 Bacteria 7249
124 Ga0105238_10042704 3300009551 Bacteria 4590
125 Ga0105239_10003096 3300010375 Bacteria 20643
126 Ga0105239_10007784 3300010375 Bacteria 12260
127 Ga0105239_10224961 3300010375 Bacteria 2105
128 Ga0157370_10004316 3300013104 Bacteria 16343
129 Ga0157370_10007667 3300013104 Bacteria 11710
130 Ga0157369_10031396 3300013105 Bacteria 5850
131 Ga0157378_10477810 3300013297 Bacteria 1241
132 Ga0157372_10010532 3300013307 Bacteria 9838
133 Ga0157372_10014500 3300013307 Bacteria 8434
134 Ga0157372_10016162 3300013307 Bacteria 8007
135 Ga0157372_10033944 3300013307 Bacteria 5607
136 Ga0157372_10036160 3300013307 Bacteria 5442
137 Ga0157372_10132401 3300013307 Bacteria 2870
138 Ga0163163_10099202 3300014325 Bacteria 2934
139 Ga0163163_10133446 3300014325 Bacteria 2523
140 Ga0157380_10404604 3300014326 Bacteria 1296
141 Ga0157377_10124907 3300014745 Bacteria 1564
142 Ga0157379_10006327 3300014968 Bacteria 10196
143 Ga0157379_10020443 3300014968 Bacteria 5854
144 Ga0157379_10027446 3300014968 Bacteria 5070
145 Ga0157379_10034213 3300014968 Bacteria 4529
146 Ga0157379_10074531 3300014968 Bacteria 3038
147 Ga0213874_10003205 3300021377 Bacteria 3608
148 Ga0213876_10000223 3300021384 Bacteria 56685
149 Ga0207680_10000192 3300025903 Bacteria 29474
150 Ga0207699_10001191 3300025906 Bacteria 12311
151 Ga0207699_10101027 3300025906 Bacteria 1830
152 Ga0207705_10000326 3300025909 Bacteria 43356
153 Ga0207684_10005245 3300025910 Bacteria 12024
154 Ga0207684_10016894 3300025910 Bacteria 6267
155 Ga0207684_10358088 3300025910 Bacteria 1256
156 Ga0207654_10109591 3300025911 Bacteria 1715
157 Ga0207707_10001962 3300025912 Bacteria 18702
158 Ga0207707_10206009 3300025912 Bacteria 1714
159 Ga0207695_10004572 3300025913 Bacteria 18808
160 Ga0207695_10066578 3300025913 Bacteria 3699
161 Ga0207695_10138564 3300025913 Bacteria 2384
162 Ga0207671_10024378 3300025914 Bacteria 4550
163 Ga0207693_10000035 3300025915 Bacteria 110713
164 Ga0207693_10001208 3300025915 Bacteria 23029
165 Ga0207663_10099662 3300025916 Bacteria 1948
166 Ga0207660_10004375 3300025917 Bacteria 9211
167 Ga0207657_10000399 3300025919 Bacteria 45976
168 Ga0207649_10000109 3300025920 Bacteria 69042
169 Ga0207652_10006808 3300025921 Bacteria 9212
170 Ga0207646_10015358 3300025922 Bacteria 7234
171 Ga0207646_10078238 3300025922 Bacteria 2956
172 Ga0207694_10000010 3300025924 Bacteria 439722
173 Ga0207694_10008581 3300025924 Bacteria 7717
174 Ga0207694_10094291 3300025924 Bacteria 2365
175 Ga0207687_10116277 3300025927 Bacteria 1993
176 Ga0207700_10000034 3300025928 Bacteria 120519
177 Ga0207700_10389055 3300025928 Bacteria 1220
178 Ga0207664_10240760 3300025929 Bacteria 1576
179 Ga0207664_10469388 3300025929 Bacteria 1125
180 Ga0207706_10358949 3300025933 Bacteria 1266
181 Ga0207686_10021781 3300025934 Bacteria 3683
182 Ga0207670_10020121 3300025936 Bacteria 4093
183 Ga0207670_10268697 3300025936 Bacteria 1325
184 Ga0207704_10010510 3300025938 Bacteria 4520
185 Ga0207691_10016964 3300025940 Bacteria 6910
186 Ga0207691_10310629 3300025940 Bacteria 1353
187 Ga0207711_10008767 3300025941 Bacteria 8459
188 Ga0207711_10050056 3300025941 Bacteria 3577
189 Ga0207689_10016203 3300025942 Bacteria 6312
190 Ga0207689_10220261 3300025942 Bacteria 1568
191 Ga0207667_10015493 3300025949 Bacteria 8655
192 Ga0207667_10126180 3300025949 Bacteria 2636
193 Ga0207712_10048107 3300025961 Bacteria 2965
194 Ga0207640_10084960 3300025981 Bacteria 2175
195 Ga0207658_10338571 3300025986 Bacteria 1307
196 Ga0207703_10018556 3300026035 Bacteria 5431
197 Ga0207639_10012825 3300026041 Bacteria 5847
198 Ga0207639_10088105 3300026041 Bacteria 2476
199 Ga0207678_10017074 3300026067 Bacteria 6373
200 Ga0207708_10199562 3300026075 Bacteria 1596
201 Ga0207702_10000007 3300026078 Bacteria 332551
202 Ga0207702_10000012 3300026078 Bacteria 269770
203 Ga0207648_10037875 3300026089 Bacteria 4245
204 Ga0207676_10011247 3300026095 Bacteria 6395
205 Ga0207676_10576614 3300026095 Bacteria 1078
206 Ga0207674_10000107 3300026116 Bacteria 95635
207 Ga0207675_100311860 3300026118 Bacteria 1534
208 Ga0207683_10328926 3300026121 Bacteria 1401
209 Ga0207698_10051641 3300026142 Bacteria 3144
210 Ga0209813_10033903 3300027866 Bacteria 1520
211 Ga0207428_10000076 3300027907 Bacteria 137126
212 Ga0207428_10177454 3300027907 Bacteria 1610
213 Ga0268265_10026030 3300028380 Bacteria 4159
214 Ga0268265_10485391 3300028380 Bacteria 1161
215 Ga0268264_10617835 3300028381 Bacteria 1070
216 Ga0265318_10000225 3300028577 Bacteria 48793
217 Ga0265338_10004936 3300028800 Bacteria 17688
218 Ga0265338_10007757 3300028800 Bacteria 13206
219 Ga0265338_10044057 3300028800 Bacteria 4126
220 Ga0265338_10232506 3300028800 Bacteria 1370
221 Ga0265338_10285393 3300028800 Bacteria 1205
222 Ga0265330_10019436 3300031235 Bacteria 3113
223 Ga0265330_10150960 3300031235 Bacteria 987
224 Ga0265325_10001605 3300031241 Bacteria 15765
225 Ga0265325_10011332 3300031241 Bacteria 5124
226 Ga0265329_10083767 3300031242 Bacteria 1010
227 Ga0265340_10000024 3300031247 Bacteria 77206
228 Ga0265340_10000399 3300031247 Bacteria 23261
229 Ga0265340_10005214 3300031247 Bacteria 7219
230 Ga0265339_10016468 3300031249 Bacteria 4405
231 Ga0265339_10019121 3300031249 Bacteria 4025
232 Ga0265339_10024050 3300031249 Bacteria 3515
233 Ga0265331_10000668 3300031250 Bacteria 29543
234 Ga0265327_10000052 3300031251 Bacteria 256602
235 Ga0265316_10001878 3300031344 Bacteria 22055
236 Ga0265316_10020933 3300031344 Bacteria 5553
237 Ga0265316_10117207 3300031344 Bacteria 2013
238 Ga0265316_10241932 3300031344 Bacteria 1327
239 Ga0265316_10254412 3300031344 Bacteria 1289
240 Ga0265313_10000986 3300031595 Bacteria 28014
241 Ga0265313_10013688 3300031595 Bacteria 4846
242 Ga0265314_10008454 3300031711 Bacteria 8815
243 Ga0265314_10010905 3300031711 Bacteria 7553
244 Ga0265314_10032346 3300031711 Bacteria 3848
245 Ga0265314_10032571 3300031711 Bacteria 3833
246 Ga0265314_10047717 3300031711 Bacteria 3011
247 Ga0265314_10083648 3300031711 Bacteria 2097
248 Ga0265314_10095329 3300031711 Bacteria 1927
249 Ga0265314_10218121 3300031711 Bacteria 1115
250 Ga0265342_10031403 3300031712 Bacteria 3284
251 Ga0316576_10202365 3300031727 Bacteria 1496
252 Ga0373957_0071094 3300035120 Bacteria 1361
253 Ga0373935_0026720 3300035692 Bacteria 3566
254 Ga0373933_0046928 3300035724 Bacteria 2567
255 Ga0373937_0014515 3300036401 Bacteria 6955
256 Ga0373937_0050706 3300036401 Bacteria 3802
257 Ga0373925_0474385 3300037068 Bacteria 1026
258 Ga0395901_0000225 3300038443 Bacteria 70878
259 Ga0436365_0173869 3300039437 Bacteria 89108
260 Ga0436365_0412683 3300039437 Bacteria 137628
261 Ga0436365_0716652 3300039437 Bacteria 2828
262 Ga0436360_0502018 3300039438 Bacteria 1881
263 Ga0436363_1632833 3300039450 Bacteria 6734
264 Ga0436362_0424500 3300039453 Bacteria 1250
265 Ga0451577_0000036 3300042876 Bacteria 367683
266 Ga0453683_0007340 3300044673 Bacteria 7491
267 Ga0453684_0000244 3300044712 Bacteria 233555
268 Ga0453684_0000678 3300044712 Bacteria 122005
269 Ga0453684_0001243 3300044712 Bacteria 77315
270 Ga0453684_0001959 3300044712 Bacteria 53067
271 Ga0451576_0000981 3300045051 Bacteria 52879
272 Ga0466967_0130318 3300045976 Bacteria 2334
273 Ga0495580_0034571 3300046472 Bacteria 3639
274 Ga0495645_0102848 3300046543 Bacteria 2030
275 Ga0495669_0006222 3300046684 Bacteria 4979
276 Ga0495672_0000872 3300047320 Bacteria 31727
277 Ga0495602_0235104 3300048088 Bacteria 1374
278 Ga0496112_0177318 3300048915 Bacteria 2096
279 Ga0496126_0001016 3300048929 Bacteria 47635
280 Ga0496126_0182648 3300048929 Bacteria 1781
281 Ga0501033_0040945 3300049570 Bacteria 3458
282 Ga0501033_0259365 3300049570 Bacteria 1230
283 Ga0501033_0430921 3300049570 Bacteria 917
284 Ga0501036_0346192 3300049572 Bacteria 1241
285 Ga0501037_0045168 3300049573 Bacteria 3234
286 Ga0501041_0030726 3300049577 Bacteria 3243
287 Ga0501043_0022230 3300049579 Bacteria 4975
288 Ga0501043_0042065 3300049579 Bacteria 3590
289 Ga0501043_0141628 3300049579 Bacteria 1883
290 Ga0501046_0017784 3300049580 Bacteria 5930
291 Ga0501046_0023389 3300049580 Bacteria 5085
292 Ga0501047_0002100 3300049581 Bacteria 19058
293 Ga0501047_0072769 3300049581 Bacteria 3308
294 Ga0501047_0076253 3300049581 Bacteria 3227
295 Ga0501047_0199076 3300049581 Bacteria 1864
296 Ga0501047_0426693 3300049581 Bacteria 1157
297 Ga0501047_0445793 3300049581 Bacteria 1124
298 Ga0501048_0324411 3300049582 Bacteria 1097
299 Ga0501069_0030021 3300049585 Bacteria 2985
300 Ga0501069_0122356 3300049585 Bacteria 1487
301 Ga0501069_0190300 3300049585 Bacteria 1187
302 Ga0501070_0000118 3300049586 Bacteria 70586
303 Ga0501070_0030949 3300049586 Bacteria 4483
304 Ga0501071_0425406 3300049587 Bacteria 1015
305 Ga0501072_0122098 3300049588 Bacteria 2075
306 Ga0501073_0168192 3300049589 Bacteria 1518
307 Ga0501076_0177493 3300049592 Bacteria 1736
308 Ga0501077_0199827 3300049593 Bacteria 1270
309 Ga0501079_0062881 3300049741 Bacteria 2863
310 Ga0501079_0297400 3300049741 Bacteria 1263
311 Ga0501080_0000585 3300049742 Bacteria 28745
312 Ga0501080_0236982 3300049742 Bacteria 1667
313 Ga0501080_0241607 3300049742 Bacteria 1648
314 Ga0501081_0162553 3300049743 Bacteria 1609
315 Ga0501083_0091637 3300049744 Bacteria 2007
316 Ga0501035_0027741 3300049822 Bacteria 5174
317 Ga0501035_0211885 3300049822 Bacteria 1657
318 Ga0501035_0258317 3300049822 Bacteria 1477
319 Ga0501044_0027630 3300049823 Bacteria 5993
320 Ga0501044_0035597 3300049823 Bacteria 5212
321 Ga0501045_0354870 3300049824 Bacteria 1091
322 nmdc:mga0yw44_62703_c1 3300050492 Bacteria 2284
323 nmdc:mga0k408_2606_c1 3300050493 Bacteria 9579
324 nmdc:mga06z11_60226_c1 3300050494 Bacteria 1976
325 nmdc:mga04h51_13934_c1 3300050495 Bacteria 2287
326 nmdc:mga05p37_204992_c1 3300050507 Bacteria 2386
327 nmdc:mga05p37_20751_c1 3300050507 Bacteria 7950
328 nmdc:mga05p37_265980_c1 3300050507 Bacteria 2050
329 nmdc:mga05p37_468526_c1 3300050507 Bacteria 1454
330 nmdc:mga05p37_47937_c1 3300050507 Bacteria 5254
331 nmdc:mga05p37_72853_c1 3300050507 Bacteria 4227
332 nmdc:mga09592_21686_c1 3300050508 Bacteria 5296
333 nmdc:mga09592_81585_c1 3300050508 Bacteria 2756
334 nmdc:mga06r32_2663_c1 3300050510 Bacteria 15966
335 nmdc:mga06r32_395084_c1 3300050510 Bacteria 1365
336 nmdc:mga08y16_280462_c1 3300050511 Bacteria 1719
337 nmdc:mga08y16_3446_c1 3300050511 Bacteria 16417
338 nmdc:mga08y16_44628_c1 3300050511 Bacteria 4644
339 nmdc:mga08y16_60996_c1 3300050511 Bacteria 3938
340 nmdc:mga08y16_724641_c1 3300050511 Bacteria 992
341 nmdc:mga0n895_123404_c1 3300050512 Bacteria 2612
342 nmdc:mga0n895_324937_c1 3300050512 Bacteria 1559
343 nmdc:mga0n895_32910_c1 3300050512 Bacteria 4978
344 nmdc:mga0n895_389673_c1 3300050512 Bacteria 1409
345 nmdc:mga0n895_43600_c1 3300050512 Bacteria 4372
346 nmdc:mga0n895_74093_c1 3300050512 Bacteria 3381
347 nmdc:mga0rr50_72052_c1 3300050513 Bacteria 2638
348 nmdc:mga0rr50_86537_c1 3300050513 Bacteria 2431
349 nmdc:mga08x19_18107_c1 3300050514 Bacteria 4315
350 nmdc:mga08x19_6138_c1 3300050514 Bacteria 7107
351 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
352 nmdc:mga0a205_211474_c1 3300050515 Bacteria 1828
353 nmdc:mga0a205_53997_c1 3300050515 Bacteria 3879
354 Ga0500595_015270 3300053119 Bacteria 2886
355 Ga0501084_0105076 3300054114 Bacteria 2372
356 Ga0501082_0072810 3300060353 Bacteria 2959
357 Ga0501082_0155046 3300060353 Bacteria 1990
358 Ga0501082_0310095 3300060353 Bacteria 1374
359 Ga0501082_0410153 3300060353 Bacteria 1183
360 Ga0530510_0154414 3300061734 Bacteria 1696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10338571 Ga0207658_103385712 218
2 3300050510 nmdc:mga06r32_395084_c1 nmdc:mga06r32_395084_c1_18_722 224
3 3300050507 nmdc:mga05p37_204992_c1 nmdc:mga05p37_204992_c1_1606_2313 225
4 3300049587 Ga0501071_0425406 Ga0501071_0425406_276_992 228
5 3300049592 Ga0501076_0177493 Ga0501076_0177493_77_802 231
6 3300050515 nmdc:mga0a205_211474_c1 nmdc:mga0a205_211474_c1_1074_1814 236
7 3300038443 Ga0395901_0000225 Ga0395901_0000225_14305_15054 245
8 3300031344 Ga0265316_10117207 Ga0265316_101172072 249
9 3300009147 Ga0114129_10540990 Ga0114129_105409902 251
10 3300050507 nmdc:mga05p37_468526_c1 nmdc:mga05p37_468526_c1_324_1109 251
11 3300006847 Ga0075431_100004914 Ga0075431_1000049144 253
12 3300009147 Ga0114129_10155176 Ga0114129_101551762 253
13 3300050507 nmdc:mga05p37_72853_c1 nmdc:mga05p37_72853_c1_1422_2210 253
14 3300050510 nmdc:mga06r32_2663_c1 nmdc:mga06r32_2663_c1_4870_5658 253
15 3300006871 Ga0075434_100243001 Ga0075434_1002430012 254
16 3300009147 Ga0114129_10658223 Ga0114129_106582231 254
17 3300050511 nmdc:mga08y16_724641_c1 nmdc:mga08y16_724641_c1_70_915 255
18 3300025940 Ga0207691_10310629 Ga0207691_103106292 258
19 3300031727 Ga0316576_10202365 Ga0316576_102023652 258
20 3300049588 Ga0501072_0122098 Ga0501072_0122098_708_1514 258
21 3300049570 Ga0501033_0430921 Ga0501033_0430921_42_851 260
22 3300049585 Ga0501069_0190300 Ga0501069_0190300_150_965 262
23 3300009176 Ga0105242_10082887 Ga0105242_100828872 265
24 3300025934 Ga0207686_10021781 Ga0207686_100217812 265
25 3300039437 Ga0436365_0173869 Ga0436365_0173869_11009_11809 265
26 3300005330 Ga0070690_100077083 Ga0070690_1000770832 266
27 3300005334 Ga0068869_100026271 Ga0068869_1000262714 266
28 3300005338 Ga0068868_100293033 Ga0068868_1002930331 266
29 3300005340 Ga0070689_100263324 Ga0070689_1002633242 266
30 3300005340 Ga0070689_100265880 Ga0070689_1002658802 266
31 3300005347 Ga0070668_100232499 Ga0070668_1002324992 266
32 3300005356 Ga0070674_100048817 Ga0070674_1000488172 266
33 3300005365 Ga0070688_100050234 Ga0070688_1000502342 266
34 3300005438 Ga0070701_10010430 Ga0070701_100104304 266
35 3300005441 Ga0070700_100177763 Ga0070700_1001777631 266
36 3300005444 Ga0070694_100107004 Ga0070694_1001070042 266
37 3300005459 Ga0068867_100108349 Ga0068867_1001083492 266
38 3300005543 Ga0070672_100231166 Ga0070672_1002311662 266
39 3300005544 Ga0070686_100078370 Ga0070686_1000783702 266
40 3300005545 Ga0070695_100009207 Ga0070695_1000092074 266
41 3300005546 Ga0070696_100092631 Ga0070696_1000926311 266
42 3300005549 Ga0070704_100063934 Ga0070704_1000639343 266
43 3300005549 Ga0070704_100221794 Ga0070704_1002217942 266
44 3300005615 Ga0070702_100028232 Ga0070702_1000282324 266
45 3300005617 Ga0068859_100019586 Ga0068859_1000195862 266
46 3300005842 Ga0068858_100049333 Ga0068858_1000493332 266
47 3300006038 Ga0075365_10004957 Ga0075365_100049574 266
48 3300006051 Ga0075364_10012948 Ga0075364_100129482 266
49 3300006178 Ga0075367_10003320 Ga0075367_100033204 266
50 3300006195 Ga0075366_10001113 Ga0075366_100011136 266
51 3300006844 Ga0075428_100085124 Ga0075428_1000851242 266
52 3300006871 Ga0075434_100205746 Ga0075434_1002057463 266
53 3300006880 Ga0075429_100027543 Ga0075429_1000275435 266
54 3300006881 Ga0068865_100042529 Ga0068865_1000425292 266
55 3300006931 Ga0097620_100019586 Ga0097620_1000195862 266
56 3300009147 Ga0114129_10016605 Ga0114129_100166055 266
57 3300009147 Ga0114129_10451822 Ga0114129_104518222 266
58 3300025927 Ga0207687_10116277 Ga0207687_101162772 266
59 3300025933 Ga0207706_10358949 Ga0207706_103589492 266
60 3300025936 Ga0207670_10268697 Ga0207670_102686971 266
61 3300025938 Ga0207704_10010510 Ga0207704_100105103 266
62 3300025940 Ga0207691_10016964 Ga0207691_100169642 266
63 3300025942 Ga0207689_10016203 Ga0207689_100162037 266
64 3300025961 Ga0207712_10048107 Ga0207712_100481074 266
65 3300026067 Ga0207678_10017074 Ga0207678_100170742 266
66 3300026075 Ga0207708_10199562 Ga0207708_101995621 266
67 3300026089 Ga0207648_10037875 Ga0207648_100378754 266
68 3300026118 Ga0207675_100311860 Ga0207675_1003118602 266
69 3300027907 Ga0207428_10000076 Ga0207428_1000007654 266
70 3300028380 Ga0268265_10485391 Ga0268265_104853912 266
71 3300042876 Ga0451577_0000036 Ga0451577_0000036_292602_293450 266
72 3300044673 Ga0453683_0007340 Ga0453683_0007340_4930_5778 266
73 3300044712 Ga0453684_0000244 Ga0453684_0000244_51724_52572 266
74 3300044712 Ga0453684_0000678 Ga0453684_0000678_67401_68249 266
75 3300044712 Ga0453684_0001243 Ga0453684_0001243_27545_28393 266
76 3300044712 Ga0453684_0001959 Ga0453684_0001959_48332_49180 266
77 3300045051 Ga0451576_0000981 Ga0451576_0000981_11599_12447 266
78 3300050507 nmdc:mga05p37_20751_c1 nmdc:mga05p37_20751_c1_1476_2306 266
79 3300050512 nmdc:mga0n895_123404_c1 nmdc:mga0n895_123404_c1_1156_1986 266
80 3300050513 nmdc:mga0rr50_72052_c1 nmdc:mga0rr50_72052_c1_410_1240 266
81 3300005440 Ga0070705_100049572 Ga0070705_1000495722 267
82 3300005467 Ga0070706_100045757 Ga0070706_1000457573 267
83 3300005467 Ga0070706_100481119 Ga0070706_1004811192 267
84 3300005468 Ga0070707_100015055 Ga0070707_1000150553 267
85 3300005471 Ga0070698_100016340 Ga0070698_1000163403 267
86 3300005844 Ga0068862_100065155 Ga0068862_1000651552 267
87 3300007076 Ga0075435_100012316 Ga0075435_1000123164 267
88 3300009093 Ga0105240_10020413 Ga0105240_1002041310 267
89 3300009094 Ga0111539_10007017 Ga0111539_100070172 267
90 3300009148 Ga0105243_10077093 Ga0105243_100770932 267
91 3300009177 Ga0105248_10197031 Ga0105248_101970312 267
92 3300010375 Ga0105239_10224961 Ga0105239_102249612 267
93 3300014326 Ga0157380_10404604 Ga0157380_104046041 267
94 3300014968 Ga0157379_10074531 Ga0157379_100745312 267
95 3300025910 Ga0207684_10358088 Ga0207684_103580881 267
96 3300025913 Ga0207695_10004572 Ga0207695_100045723 267
97 3300025922 Ga0207646_10078238 Ga0207646_100782383 267
98 3300025941 Ga0207711_10008767 Ga0207711_100087676 267
99 3300027866 Ga0209813_10033903 Ga0209813_100339031 267
100 3300028380 Ga0268265_10026030 Ga0268265_100260304 267
101 3300028800 Ga0265338_10285393 Ga0265338_102853932 267
102 3300031711 Ga0265314_10032571 Ga0265314_100325712 267
103 3300046684 Ga0495669_0006222 Ga0495669_0006222_1054_1887 267
104 3300049577 Ga0501041_0030726 Ga0501041_0030726_1076_1909 267
105 3300049582 Ga0501048_0324411 Ga0501048_0324411_113_946 267
106 3300049741 Ga0501079_0062881 Ga0501079_0062881_1014_1847 267
107 3300049742 Ga0501080_0241607 Ga0501080_0241607_613_1446 267
108 3300049743 Ga0501081_0162553 Ga0501081_0162553_567_1400 267
109 3300049824 Ga0501045_0354870 Ga0501045_0354870_16_849 267
110 3300050492 nmdc:mga0yw44_62703_c1 nmdc:mga0yw44_62703_c1_1078_1959 267
111 3300050493 nmdc:mga0k408_2606_c1 nmdc:mga0k408_2606_c1_950_1831 267
112 3300050494 nmdc:mga06z11_60226_c1 nmdc:mga06z11_60226_c1_851_1732 267
113 3300050495 nmdc:mga04h51_13934_c1 nmdc:mga04h51_13934_c1_521_1402 267
114 3300050508 nmdc:mga09592_81585_c1 nmdc:mga09592_81585_c1_749_1630 267
115 3300050511 nmdc:mga08y16_3446_c1 nmdc:mga08y16_3446_c1_14553_15434 267
116 3300054114 Ga0501084_0105076 Ga0501084_0105076_1423_2256 267
117 3300060353 Ga0501082_0072810 Ga0501082_0072810_1313_2146 267
118 3300005444 Ga0070694_100050696 Ga0070694_1000506961 268
119 3300005471 Ga0070698_100013159 Ga0070698_1000131592 268
120 3300005549 Ga0070704_100010403 Ga0070704_1000104033 268
121 3300005549 Ga0070704_100074114 Ga0070704_1000741142 268
122 3300006844 Ga0075428_100018469 Ga0075428_1000184697 268
123 3300006852 Ga0075433_10041009 Ga0075433_100410094 268
124 3300009147 Ga0114129_10155745 Ga0114129_101557452 268
125 3300026095 Ga0207676_10576614 Ga0207676_105766142 268
126 3300028381 Ga0268264_10617835 Ga0268264_106178351 268
127 3300028577 Ga0265318_10000225 Ga0265318_1000022519 268
128 3300049580 Ga0501046_0023389 Ga0501046_0023389_3775_4605 268
129 3300049586 Ga0501070_0030949 Ga0501070_0030949_424_1293 268
130 3300050507 nmdc:mga05p37_265980_c1 nmdc:mga05p37_265980_c1_449_1294 268
131 3300060353 Ga0501082_0310095 Ga0501082_0310095_243_1079 268
132 3300006871 Ga0075434_100372284 Ga0075434_1003722842 269
133 3300009094 Ga0111539_10035995 Ga0111539_100359951 269
134 3300028800 Ga0265338_10004936 Ga0265338_1000493617 269
135 3300031711 Ga0265314_10095329 Ga0265314_100953292 269
136 3300046543 Ga0495645_0102848 Ga0495645_0102848_949_1782 269
137 3300047320 Ga0495672_0000872 Ga0495672_0000872_11419_12258 269
138 3300049589 Ga0501073_0168192 Ga0501073_0168192_312_1196 269
139 3300049593 Ga0501077_0199827 Ga0501077_0199827_329_1213 269
140 3300050511 nmdc:mga08y16_60996_c1 nmdc:mga08y16_60996_c1_3009_3857 269
141 3300005341 Ga0070691_10001149 Ga0070691_100011496 270
142 3300005434 Ga0070709_10001503 Ga0070709_100015034 270
143 3300005434 Ga0070709_10110405 Ga0070709_101104052 270
144 3300005435 Ga0070714_100121800 Ga0070714_1001218002 270
145 3300005435 Ga0070714_100275336 Ga0070714_1002753362 270
146 3300005436 Ga0070713_100000017 Ga0070713_10000001793 270
147 3300005439 Ga0070711_100113072 Ga0070711_1001130722 270
148 3300005445 Ga0070708_100134496 Ga0070708_1001344963 270
149 3300005467 Ga0070706_100024941 Ga0070706_1000249416 270
150 3300005467 Ga0070706_100315824 Ga0070706_1003158242 270
151 3300005468 Ga0070707_100031809 Ga0070707_1000318092 270
152 3300005468 Ga0070707_100285726 Ga0070707_1002857262 270
153 3300005471 Ga0070698_100026790 Ga0070698_1000267906 270
154 3300005518 Ga0070699_100005100 Ga0070699_1000051006 270
155 3300005518 Ga0070699_100094857 Ga0070699_1000948574 270
156 3300005535 Ga0070684_100081109 Ga0070684_1000811092 270
157 3300005536 Ga0070697_100026936 Ga0070697_1000269365 270
158 3300005539 Ga0068853_100002866 Ga0068853_1000028668 270
159 3300005545 Ga0070695_100040134 Ga0070695_1000401342 270
160 3300005546 Ga0070696_100247148 Ga0070696_1002471482 270
161 3300005577 Ga0068857_100001321 Ga0068857_10000132122 270
162 3300005614 Ga0068856_100062959 Ga0068856_1000629593 270
163 3300005615 Ga0070702_100146067 Ga0070702_1001460671 270
164 3300005842 Ga0068858_100008489 Ga0068858_1000084892 270
165 3300006175 Ga0070712_100001632 Ga0070712_10000163216 270
166 3300006871 Ga0075434_100337023 Ga0075434_1003370232 270
167 3300006914 Ga0075436_100028792 Ga0075436_1000287924 270
168 3300009147 Ga0114129_10136023 Ga0114129_101360234 270
169 3300025910 Ga0207684_10005245 Ga0207684_100052457 270
170 3300025910 Ga0207684_10016894 Ga0207684_100168946 270
171 3300025913 Ga0207695_10066578 Ga0207695_100665782 270
172 3300025914 Ga0207671_10024378 Ga0207671_100243783 270
173 3300025915 Ga0207693_10001208 Ga0207693_100012082 270
174 3300025922 Ga0207646_10015358 Ga0207646_100153588 270
175 3300025924 Ga0207694_10008581 Ga0207694_100085813 270
176 3300025929 Ga0207664_10240760 Ga0207664_102407602 270
177 3300025949 Ga0207667_10015493 Ga0207667_100154933 270
178 3300025981 Ga0207640_10084960 Ga0207640_100849602 270
179 3300026035 Ga0207703_10018556 Ga0207703_100185562 270
180 3300026041 Ga0207639_10012825 Ga0207639_100128253 270
181 3300026078 Ga0207702_10000012 Ga0207702_100000123 270
182 3300026116 Ga0207674_10000107 Ga0207674_1000010790 270
183 3300026121 Ga0207683_10328926 Ga0207683_103289262 270
184 3300028800 Ga0265338_10007757 Ga0265338_1000775711 270
185 3300028800 Ga0265338_10044057 Ga0265338_100440574 270
186 3300031241 Ga0265325_10001605 Ga0265325_1000160516 270
187 3300031249 Ga0265339_10019121 Ga0265339_100191212 270
188 3300031344 Ga0265316_10020933 Ga0265316_100209333 270
189 3300031344 Ga0265316_10241932 Ga0265316_102419322 270
190 3300031595 Ga0265313_10000986 Ga0265313_1000098619 270
191 3300031711 Ga0265314_10008454 Ga0265314_1000845413 270
192 3300031711 Ga0265314_10083648 Ga0265314_100836482 270
193 3300048915 Ga0496112_0177318 Ga0496112_0177318_685_1557 270
194 3300050512 nmdc:mga0n895_324937_c1 nmdc:mga0n895_324937_c1_207_1055 270
195 3300050515 nmdc:mga0a205_53997_c1 nmdc:mga0a205_53997_c1_981_1829 270
196 3300053119 Ga0500595_015270 Ga0500595_015270_1586_2419 270
197 3300006844 Ga0075428_100013548 Ga0075428_1000135482 271
198 3300006871 Ga0075434_100152384 Ga0075434_1001523842 271
199 3300006880 Ga0075429_100014103 Ga0075429_1000141033 271
200 3300009147 Ga0114129_10056615 Ga0114129_100566157 271
201 3300049741 Ga0501079_0297400 Ga0501079_0297400_118_963 271
202 3300050507 nmdc:mga05p37_47937_c1 nmdc:mga05p37_47937_c1_775_1629 271
203 3300050508 nmdc:mga09592_21686_c1 nmdc:mga09592_21686_c1_3510_4364 271
204 3300050511 nmdc:mga08y16_280462_c1 nmdc:mga08y16_280462_c1_33_887 271
205 3300050512 nmdc:mga0n895_389673_c1 nmdc:mga0n895_389673_c1_17_865 271
206 3300050514 nmdc:mga08x19_18107_c1 nmdc:mga08x19_18107_c1_2798_3646 271
207 3300060353 Ga0501082_0155046 Ga0501082_0155046_791_1636 271
208 3300060353 Ga0501082_0410153 Ga0501082_0410153_152_1000 271
209 3300061734 Ga0530510_0154414 Ga0530510_0154414_552_1397 271
210 3300031235 Ga0265330_10019436 Ga0265330_100194362 272
211 3300031235 Ga0265330_10150960 Ga0265330_101509601 272
212 3300031241 Ga0265325_10011332 Ga0265325_100113324 272
213 3300031242 Ga0265329_10083767 Ga0265329_100837671 272
214 3300031247 Ga0265340_10000024 Ga0265340_100000245 272
215 3300031247 Ga0265340_10005214 Ga0265340_100052143 272
216 3300031249 Ga0265339_10024050 Ga0265339_100240502 272
217 3300031344 Ga0265316_10001878 Ga0265316_1000187810 272
218 3300031595 Ga0265313_10013688 Ga0265313_100136882 272
219 3300035120 Ga0373957_0071094 Ga0373957_0071094_341_1183 272
220 3300035724 Ga0373933_0046928 Ga0373933_0046928_870_1712 272
221 3300036401 Ga0373937_0050706 Ga0373937_0050706_970_1812 272
222 3300039438 Ga0436360_0502018 Ga0436360_0502018_548_1423 272
223 3300005330 Ga0070690_100139559 Ga0070690_1001395591 273
224 3300005340 Ga0070689_100015658 Ga0070689_1000156584 273
225 3300005618 Ga0068864_100050602 Ga0068864_1000506022 273
226 3300006844 Ga0075428_100016250 Ga0075428_1000162505 273
227 3300006871 Ga0075434_100066566 Ga0075434_1000665663 273
228 3300009094 Ga0111539_10034411 Ga0111539_100344114 273
229 3300013307 Ga0157372_10033944 Ga0157372_100339442 273
230 3300014745 Ga0157377_10124907 Ga0157377_101249072 273
231 3300025936 Ga0207670_10020121 Ga0207670_100201212 273
232 3300025942 Ga0207689_10220261 Ga0207689_102202612 273
233 3300026095 Ga0207676_10011247 Ga0207676_100112477 273
234 3300027907 Ga0207428_10177454 Ga0207428_101774542 273
235 3300050511 nmdc:mga08y16_44628_c1 nmdc:mga08y16_44628_c1_1724_2584 273
236 3300050512 nmdc:mga0n895_43600_c1 nmdc:mga0n895_43600_c1_3353_4213 273
237 3300037068 Ga0373925_0474385 Ga0373925_0474385_142_969 274
238 3300005344 Ga0070661_100000076 Ga0070661_10000007674 275
239 3300005539 Ga0068853_100108210 Ga0068853_1001082102 275
240 3300005616 Ga0068852_100191814 Ga0068852_1001918141 275
241 3300005616 Ga0068852_100838297 Ga0068852_1008382971 275
242 3300009093 Ga0105240_10037415 Ga0105240_100374154 275
243 3300010375 Ga0105239_10003096 Ga0105239_1000309610 275
244 3300025913 Ga0207695_10138564 Ga0207695_101385642 275
245 3300025920 Ga0207649_10000109 Ga0207649_1000010910 275
246 3300025928 Ga0207700_10000034 Ga0207700_1000003441 275
247 3300026041 Ga0207639_10088105 Ga0207639_100881052 275
248 3300026142 Ga0207698_10051641 Ga0207698_100516412 275
249 3300028800 Ga0265338_10232506 Ga0265338_102325062 275
250 3300031250 Ga0265331_10000668 Ga0265331_1000066816 275
251 3300031251 Ga0265327_10000052 Ga0265327_1000005264 275
252 3300031711 Ga0265314_10047717 Ga0265314_100477173 275
253 3300031711 Ga0265314_10218121 Ga0265314_102181211 275
254 3300049570 Ga0501033_0259365 Ga0501033_0259365_312_1139 275
255 3300049572 Ga0501036_0346192 Ga0501036_0346192_348_1175 275
256 3300049579 Ga0501043_0042065 Ga0501043_0042065_949_1776 275
257 3300049579 Ga0501043_0141628 Ga0501043_0141628_104_934 275
258 3300049580 Ga0501046_0017784 Ga0501046_0017784_1749_2576 275
259 3300049581 Ga0501047_0002100 Ga0501047_0002100_11952_12782 275
260 3300049581 Ga0501047_0072769 Ga0501047_0072769_1426_2256 275
261 3300049581 Ga0501047_0199076 Ga0501047_0199076_252_1079 275
262 3300049581 Ga0501047_0445793 Ga0501047_0445793_249_1076 275
263 3300049585 Ga0501069_0122356 Ga0501069_0122356_298_1125 275
264 3300049742 Ga0501080_0236982 Ga0501080_0236982_750_1577 275
265 3300049744 Ga0501083_0091637 Ga0501083_0091637_671_1498 275
266 3300049822 Ga0501035_0258317 Ga0501035_0258317_264_1094 275
267 3300005335 Ga0070666_10002099 Ga0070666_1000209913 276
268 3300005434 Ga0070709_10136171 Ga0070709_101361712 276
269 3300005436 Ga0070713_100299068 Ga0070713_1002990682 276
270 3300005436 Ga0070713_100542560 Ga0070713_1005425601 276
271 3300005458 Ga0070681_10214282 Ga0070681_102142822 276
272 3300005539 Ga0068853_100042847 Ga0068853_1000428472 276
273 3300005563 Ga0068855_100233438 Ga0068855_1002334382 276
274 3300005578 Ga0068854_100077431 Ga0068854_1000774312 276
275 3300005614 Ga0068856_100005003 Ga0068856_10000500311 276
276 3300005616 Ga0068852_100096124 Ga0068852_1000961242 276
277 3300006175 Ga0070712_100000178 Ga0070712_10000017822 276
278 3300006871 Ga0075434_100049446 Ga0075434_1000494462 276
279 3300006914 Ga0075436_100002284 Ga0075436_1000022845 276
280 3300009093 Ga0105240_10021184 Ga0105240_100211843 276
281 3300009174 Ga0105241_10022570 Ga0105241_100225705 276
282 3300009177 Ga0105248_10075443 Ga0105248_100754432 276
283 3300009545 Ga0105237_10008261 Ga0105237_100082616 276
284 3300009551 Ga0105238_10000620 Ga0105238_100006207 276
285 3300009551 Ga0105238_10042704 Ga0105238_100427044 276
286 3300010375 Ga0105239_10007784 Ga0105239_100077843 276
287 3300013104 Ga0157370_10004316 Ga0157370_1000431612 276
288 3300013105 Ga0157369_10031396 Ga0157369_100313963 276
289 3300013297 Ga0157378_10477810 Ga0157378_104778102 276
290 3300013307 Ga0157372_10014500 Ga0157372_100145003 276
291 3300014325 Ga0163163_10099202 Ga0163163_100992022 276
292 3300014325 Ga0163163_10133446 Ga0163163_101334462 276
293 3300014968 Ga0157379_10006327 Ga0157379_100063274 276
294 3300014968 Ga0157379_10020443 Ga0157379_100204436 276
295 3300014968 Ga0157379_10027446 Ga0157379_100274462 276
296 3300014968 Ga0157379_10034213 Ga0157379_100342135 276
297 3300025903 Ga0207680_10000192 Ga0207680_100001923 276
298 3300025906 Ga0207699_10001191 Ga0207699_1000119112 276
299 3300025906 Ga0207699_10101027 Ga0207699_101010272 276
300 3300025911 Ga0207654_10109591 Ga0207654_101095912 276
301 3300025912 Ga0207707_10206009 Ga0207707_102060092 276
302 3300025915 Ga0207693_10000035 Ga0207693_1000003514 276
303 3300025916 Ga0207663_10099662 Ga0207663_100996622 276
304 3300025924 Ga0207694_10000010 Ga0207694_1000001071 276
305 3300025928 Ga0207700_10389055 Ga0207700_103890552 276
306 3300025929 Ga0207664_10469388 Ga0207664_104693882 276
307 3300025941 Ga0207711_10050056 Ga0207711_100500562 276
308 3300025949 Ga0207667_10126180 Ga0207667_101261802 276
309 3300026078 Ga0207702_10000007 Ga0207702_1000000772 276
310 3300031249 Ga0265339_10016468 Ga0265339_100164683 276
311 3300031344 Ga0265316_10254412 Ga0265316_102544122 276
312 3300031711 Ga0265314_10032346 Ga0265314_100323464 276
313 3300035692 Ga0373935_0026720 Ga0373935_0026720_1577_2410 276
314 3300036401 Ga0373937_0014515 Ga0373937_0014515_1784_2617 276
315 3300039437 Ga0436365_0716652 Ga0436365_0716652_1004_1837 276
316 3300039453 Ga0436362_0424500 Ga0436362_0424500_155_988 276
317 3300046472 Ga0495580_0034571 Ga0495580_0034571_1551_2384 276
318 3300048088 Ga0495602_0235104 Ga0495602_0235104_224_1057 276
319 3300048929 Ga0496126_0001016 Ga0496126_0001016_29141_29974 276
320 3300050512 nmdc:mga0n895_32910_c1 nmdc:mga0n895_32910_c1_630_1463 276
321 3300050512 nmdc:mga0n895_74093_c1 nmdc:mga0n895_74093_c1_1834_2667 276
322 3300050513 nmdc:mga0rr50_86537_c1 nmdc:mga0rr50_86537_c1_169_1002 276
323 3300050514 nmdc:mga08x19_6138_c1 nmdc:mga08x19_6138_c1_3386_4219 276
324 3300050514 nmdc:mga08x19_99_c1 nmdc:mga08x19_99_c1_16581_17414 276
325 3300013307 Ga0157372_10010532 Ga0157372_100105326 278
326 3300013307 Ga0157372_10016162 Ga0157372_100161626 278
327 3300013307 Ga0157372_10132401 Ga0157372_101324013 279
328 3300021384 Ga0213876_10000223 Ga0213876_1000022316 279
329 3300039437 Ga0436365_0412683 Ga0436365_0412683_79280_80119 279
330 3300045976 Ga0466967_0130318 Ga0466967_0130318_1303_2142 279
331 3300003320 rootH2_10006530 rootH2_100065304 280
332 3300005327 Ga0070658_10007628 Ga0070658_1000762813 280
333 3300005339 Ga0070660_100034440 Ga0070660_1000344402 280
334 3300009551 Ga0105238_10017673 Ga0105238_100176738 280
335 3300013104 Ga0157370_10007667 Ga0157370_100076672 280
336 3300013307 Ga0157372_10036160 Ga0157372_100361603 280
337 3300021377 Ga0213874_10003205 Ga0213874_100032052 280
338 3300025909 Ga0207705_10000326 Ga0207705_1000032626 280
339 3300025912 Ga0207707_10001962 Ga0207707_1000196213 280
340 3300025917 Ga0207660_10004375 Ga0207660_100043752 280
341 3300025919 Ga0207657_10000399 Ga0207657_1000039937 280
342 3300025921 Ga0207652_10006808 Ga0207652_100068082 280
343 3300025924 Ga0207694_10094291 Ga0207694_100942912 280
344 3300031247 Ga0265340_10000399 Ga0265340_1000039913 280
345 3300031711 Ga0265314_10010905 Ga0265314_100109053 280
346 3300031712 Ga0265342_10031403 Ga0265342_100314032 280
347 3300039450 Ga0436363_1632833 Ga0436363_1632833_4141_5001 280
348 3300048929 Ga0496126_0182648 Ga0496126_0182648_486_1328 280
349 3300049570 Ga0501033_0040945 Ga0501033_0040945_1044_1886 280
350 3300049573 Ga0501037_0045168 Ga0501037_0045168_722_1564 280
351 3300049579 Ga0501043_0022230 Ga0501043_0022230_3192_4034 280
352 3300049581 Ga0501047_0076253 Ga0501047_0076253_1388_2230 280
353 3300049581 Ga0501047_0426693 Ga0501047_0426693_158_1000 280
354 3300049585 Ga0501069_0030021 Ga0501069_0030021_1458_2300 280
355 3300049586 Ga0501070_0000118 Ga0501070_0000118_23978_24820 280
356 3300049742 Ga0501080_0000585 Ga0501080_0000585_7292_8134 280
357 3300049822 Ga0501035_0027741 Ga0501035_0027741_2699_3541 280
358 3300049822 Ga0501035_0211885 Ga0501035_0211885_368_1210 280
359 3300049823 Ga0501044_0027630 Ga0501044_0027630_2764_3606 280
360 3300049823 Ga0501044_0035597 Ga0501044_0035597_2434_3276 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

43

160

0.96

PF01678

DAP_epimerase

Diaminopimelate epimerase

187

301

0.96

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

87

283

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9269 2 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9058 1 271
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8919 2 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8781 1 271
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8761 3 274
ID Description Score Start End Superfamily
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9733 150 252 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.968 151 261 3.10.310.10
2gkjA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9431 114 261 3.10.310.10
af_I1NA10_49_204_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9234 1 126 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9192 151 261 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7Z9VGR8-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.986 1 116 GO:0005829
GO:0008837
GO:0009089
AF-A0A3D5US96-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9807 4 89 GO:0005829
GO:0008837
GO:0009089
AF-A0A2P8K6K3-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9803 165 274 GO:0005829
GO:0008837
GO:0009089
AF-A0A5N8HNT1-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9771 186 274 GO:0005829
GO:0008837
GO:0009089
AF-A5G1F7-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9714 2 278 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
95.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map