F421865

General Info

Members Datasets Scaffolds Average Seq Length
360 239 333 213

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10234833|Ga0105238_102348332
Length 236
Sequence MVALRIRGLSILDRQNLARILRMMKTAFQYRPRFVDIRVRPPGPEATPEEEAVGLKPGERACDHEGCRQPGVARAPKSPELLNEHYWFCQPHAAEYNRHWNFYAGLTDDQIRARQAEEQVTGGRPTWSFKAGKGTREAAAQASRGFFRDAFGIFGQGKAATEAERAAHDKRLGKLERGALADLDLDATADGPTIRHRYTELLKRCHPDSNGGDRSAEHKLQRVIKAFRTLRKAKLV

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.5
Metatranscriptomes 0
Isolates 7.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.11
Nodule 0
Rhizoplane 2.5
Rhizosphere 64.17
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1010819 3300002741 Bacteria 1194
2 Ga0055526_1027788 3300003771 Bacteria 1735
3 Ga0055537_1002425 3300003773 Bacteria 6266
4 Ga0055537_1013828 3300003773 Bacteria 1495
5 Ga0055528_1013011 3300003790 Bacteria 3187
6 Ga0055540_1014892 3300003792 Bacteria 2293
7 Ga0055531_10001830 3300003794 Bacteria 15018
8 Ga0055531_10005789 3300003794 Bacteria 7156
9 Ga0065165_1001029 3300005262 Bacteria 33794
10 Ga0065165_1040477 3300005262 Bacteria 1390
11 Ga0065165_1049469 3300005262 Bacteria 1202
12 Ga0070658_10260544 3300005327 Bacteria 1473
13 Ga0070670_100348453 3300005331 Bacteria 1301
14 Ga0068869_100407480 3300005334 Bacteria 1119
15 Ga0070666_10196889 3300005335 Bacteria 1417
16 Ga0070666_10521923 3300005335 Bacteria 862
17 Ga0070661_100194936 3300005344 Bacteria 1546
18 Ga0070668_100002191 3300005347 Bacteria 14333
19 Ga0070668_100024435 3300005347 Bacteria 4579
20 Ga0070668_100053405 3300005347 Bacteria 3116
21 Ga0070668_100416803 3300005347 Bacteria 1149
22 Ga0070669_100383387 3300005353 Bacteria 1147
23 Ga0070671_100023990 3300005355 Bacteria 4992
24 Ga0070659_100048376 3300005366 Bacteria 3340
25 Ga0070667_100005948 3300005367 Bacteria 10151
26 Ga0070667_100022887 3300005367 Bacteria 5181
27 Ga0070684_100219402 3300005535 Bacteria 1735
28 Ga0068853_100080296 3300005539 Bacteria 2853
29 Ga0070695_100073892 3300005545 Bacteria 2239
30 Ga0070665_100000762 3300005548 Bacteria 42638
31 Ga0070665_100000831 3300005548 Bacteria 40349
32 Ga0070665_100099472 3300005548 Bacteria 2912
33 Ga0070665_100224744 3300005548 Bacteria 1878
34 Ga0070665_100242657 3300005548 Bacteria 1802
35 Ga0070665_100865630 3300005548 Bacteria 917
36 Ga0068855_100029843 3300005563 Bacteria 6521
37 Ga0068855_100420990 3300005563 Bacteria 1461
38 Ga0070664_100141091 3300005564 Bacteria 2122
39 Ga0068859_100000231 3300005617 Bacteria 55036
40 Ga0068859_100377484 3300005617 Bacteria 1513
41 Ga0068864_100218507 3300005618 Bacteria 1758
42 Ga0068863_100006931 3300005841 Bacteria 11106
43 Ga0068863_100135812 3300005841 Bacteria 2350
44 Ga0068858_100015412 3300005842 Bacteria 7188
45 Ga0068860_100084844 3300005843 Bacteria 3012
46 Ga0068860_100099864 3300005843 Bacteria 2768
47 Ga0068862_100046307 3300005844 Bacteria 3711
48 Ga0068862_100098087 3300005844 Bacteria 2559
49 Ga0068862_100180341 3300005844 Bacteria 1895
50 Ga0068862_100408991 3300005844 Bacteria 1271
51 Ga0081455_10126642 3300005937 Bacteria 2003
52 Ga0075365_10185045 3300006038 Bacteria 1457
53 Ga0075368_10004696 3300006042 Bacteria 4646
54 Ga0075364_10002235 3300006051 Bacteria 10852
55 Ga0070712_100733993 3300006175 Bacteria 844
56 Ga0075367_10003359 3300006178 Bacteria 7611
57 Ga0075366_10022236 3300006195 Bacteria 3688
58 Ga0075366_10056258 3300006195 Bacteria 2337
59 Ga0075370_10043784 3300006353 Bacteria 2530
60 Ga0075370_10108500 3300006353 Bacteria 1611
61 Ga0068871_100226635 3300006358 Bacteria 1621
62 Ga0097620_100000231 3300006931 Bacteria 55036
63 Ga0097620_100377484 3300006931 Bacteria 1513
64 Ga0105240_10012411 3300009093 Bacteria 11762
65 Ga0105240_10139469 3300009093 Bacteria 2900
66 Ga0105240_10934595 3300009093 Bacteria 931
67 Ga0105248_10001386 3300009177 Bacteria 26994
68 Ga0105248_10015078 3300009177 Bacteria 8510
69 Ga0105248_10510072 3300009177 Bacteria 1356
70 Ga0105238_10025171 3300009551 Bacteria 6065
71 Ga0105238_10234833 3300009551 Bacteria 1811
72 Ga0105238_10315249 3300009551 Bacteria 1549
73 Ga0105238_11133712 3300009551 Bacteria 805
74 Ga0105249_10048049 3300009553 Bacteria 3891
75 Ga0105239_11495770 3300010375 Bacteria 780
76 Ga0157373_10001950 3300013100 Bacteria 15645
77 Ga0157373_10002460 3300013100 Bacteria 14114
78 Ga0157369_10403028 3300013105 Bacteria 1419
79 Ga0157374_10181739 3300013296 Bacteria 2055
80 Ga0163162_10083135 3300013306 Bacteria 3275
81 Ga0157372_10364471 3300013307 Bacteria 1684
82 Ga0163163_10034426 3300014325 Bacteria 4905
83 Ga0182008_10211940 3300014497 Bacteria 989
84 Ga0157379_10326936 3300014968 Bacteria 1400
85 Ga0157379_10567023 3300014968 Bacteria 1057
86 Ga0157379_10677024 3300014968 Bacteria 967
87 Ga0157376_10988981 3300014969 Bacteria 863
88 Ga0213872_10009694 3300021361 Bacteria 4608
89 Ga0213876_10000345 3300021384 Bacteria 40189
90 Ga0213876_10077873 3300021384 Bacteria 1751
91 Ga0209026_1004334 3300025250 Bacteria 4252
92 Ga0209026_1006849 3300025250 Bacteria 2695
93 Ga0209148_1017561 3300025254 Bacteria 1212
94 Ga0209565_1000384 3300025263 Bacteria 37478
95 Ga0209673_1001664 3300025273 Bacteria 19118
96 Ga0209675_1009123 3300025291 Bacteria 3538
97 Ga0209676_1000708 3300025292 Bacteria 46267
98 Ga0209676_1000872 3300025292 Bacteria 38628
99 Ga0209564_1002187 3300025295 Bacteria 16367
100 Ga0209758_1002837 3300025297 Bacteria 16843
101 Ga0209050_1000727 3300025298 Bacteria 47930
102 Ga0209050_1001246 3300025298 Bacteria 29439
103 Ga0209050_1022147 3300025298 Bacteria 2287
104 Ga0209256_1001055 3300025299 Bacteria 32004
105 Ga0209256_1007504 3300025299 Bacteria 5355
106 Ga0209051_1003538 3300025303 Bacteria 10180
107 Ga0209257_1000134 3300025304 Bacteria 207628
108 Ga0209257_1000246 3300025304 Bacteria 125942
109 Ga0209257_1003130 3300025304 Bacteria 14770
110 Ga0207705_10215582 3300025909 Bacteria 1457
111 Ga0207705_10336117 3300025909 Bacteria 1162
112 Ga0207705_10346466 3300025909 Bacteria 1144
113 Ga0207695_10011561 3300025913 Bacteria 10678
114 Ga0207695_10094222 3300025913 Bacteria 3002
115 Ga0207693_10495923 3300025915 Bacteria 953
116 Ga0207657_10054525 3300025919 Bacteria 3457
117 Ga0207649_10429237 3300025920 Bacteria 994
118 Ga0207681_10266288 3300025923 Bacteria 1344
119 Ga0207681_10406151 3300025923 Bacteria 1101
120 Ga0207694_10006417 3300025924 Bacteria 8961
121 Ga0207694_10007937 3300025924 Bacteria 8028
122 Ga0207650_10639752 3300025925 Bacteria 896
123 Ga0207644_10008478 3300025931 Bacteria 6730
124 Ga0207711_10001631 3300025941 Bacteria 20704
125 Ga0207711_10008220 3300025941 Bacteria 8735
126 Ga0207667_10010996 3300025949 Bacteria 10546
127 Ga0207667_10108061 3300025949 Bacteria 2870
128 Ga0207667_10185458 3300025949 Bacteria 2136
129 Ga0207712_10293240 3300025961 Bacteria 1332
130 Ga0207668_10000018 3300025972 Bacteria 158577
131 Ga0207668_10003470 3300025972 Bacteria 9248
132 Ga0207668_10003586 3300025972 Bacteria 9121
133 Ga0207658_10009178 3300025986 Bacteria 6708
134 Ga0207658_10052307 3300025986 Bacteria 3013
135 Ga0207703_10011403 3300026035 Bacteria 6913
136 Ga0207639_10272386 3300026041 Bacteria 1485
137 Ga0207641_10013819 3300026088 Bacteria 6621
138 Ga0207641_10663462 3300026088 Bacteria 1025
139 Ga0207676_10911535 3300026095 Bacteria 863
140 Ga0209981_1002264 3300027378 Bacteria 2448
141 Ga0209999_1002235 3300027543 Bacteria 3401
142 Ga0209983_1008218 3300027665 Bacteria 2134
143 Ga0209813_10008236 3300027866 Bacteria 2626
144 Ga0268266_10000003 3300028379 Bacteria 1701703
145 Ga0268266_10001678 3300028379 Bacteria 25491
146 Ga0268266_10136589 3300028379 Bacteria 2197
147 Ga0268266_10186714 3300028379 Bacteria 1891
148 Ga0268266_10323783 3300028379 Bacteria 1443
149 Ga0268265_10139115 3300028380 Bacteria 2030
150 Ga0268265_10172128 3300028380 Bacteria 1852
151 Ga0268264_10103349 3300028381 Bacteria 2481
152 Ga0265337_1047750 3300028556 Bacteria 1213
153 Ga0307517_10001099 3300028786 Bacteria 45677
154 Ga0307515_10012681 3300028794 Bacteria 15830
155 Ga0307515_10071810 3300028794 Bacteria 4684
156 Ga0265338_10047205 3300028800 Bacteria 3936
157 Ga0265338_10361688 3300028800 Bacteria 1041
158 Ga0265320_10180188 3300031240 Bacteria 947
159 Ga0265331_10141670 3300031250 Bacteria 1093
160 Ga0265327_10000740 3300031251 Bacteria 50953
161 Ga0265327_10004763 3300031251 Bacteria 11813
162 Ga0265327_10030795 3300031251 Bacteria 3026
163 Ga0265316_10195046 3300031344 Bacteria 1503
164 Ga0307513_10000208 3300031456 Bacteria 84906
165 Ga0307513_10001617 3300031456 Bacteria 32329
166 Ga0307513_10007553 3300031456 Bacteria 14058
167 Ga0307408_100117442 3300031548 Bacteria 2055
168 Ga0265314_10036838 3300031711 Bacteria 3550
169 Ga0265314_10201831 3300031711 Bacteria 1175
170 Ga0307405_10224850 3300031731 Bacteria 1380
171 Ga0307409_100420285 3300031995 Bacteria 1282
172 Ga0307414_10020699 3300032004 Bacteria 4107
173 Ga0307414_10387389 3300032004 Bacteria 1210
174 Ga0307510_10061230 3300033180 Bacteria 3862
175 Ga0307510_10150657 3300033180 Bacteria 1946
176 Ga0373935_0426437 3300035692 Bacteria 955
177 Ga0373927_0510209 3300035695 Bacteria 795
178 Ga0373947_0048401 3300035725 Bacteria 2551
179 Ga0373937_0354637 3300036401 Bacteria 1390
180 Ga0373937_0423461 3300036401 Bacteria 1264
181 Ga0373937_0507667 3300036401 Bacteria 1146
182 Ga0373937_1199551 3300036401 Bacteria 707
183 Ga0373925_0295275 3300037068 Bacteria 1307
184 Ga0395899_0000003 3300037312 Bacteria 1232684
185 Ga0395899_0068678 3300037312 Bacteria 2597
186 Ga0395899_0122177 3300037312 Bacteria 1864
187 Ga0395898_0644532 3300037466 Bacteria 1002
188 Ga0395905_0145840 3300037471 Bacteria 2227
189 Ga0395905_0767353 3300037471 Bacteria 867
190 Ga0436364_0388745 3300037853 Bacteria 1746
191 Ga0436364_0393292 3300037853 Bacteria 3387
192 Ga0436364_0945080 3300037853 Bacteria 728
193 Ga0395901_0108825 3300038443 Bacteria 2909
194 Ga0395901_0154824 3300038443 Bacteria 2408
195 Ga0395901_0549086 3300038443 Bacteria 1171
196 Ga0395901_1083423 3300038443 Bacteria 772
197 Ga0436365_0017797 3300039437 Bacteria 1767
198 Ga0436365_0452232 3300039437 Bacteria 1547
199 Ga0436365_0749742 3300039437 Bacteria 107056
200 Ga0436365_1055230 3300039437 Bacteria 1509
201 Ga0436360_0757444 3300039438 Bacteria 1868
202 Ga0436360_1375320 3300039438 Bacteria 719
203 Ga0436361_0479516 3300039447 Bacteria 3138
204 Ga0436362_0535385 3300039453 Bacteria 1610
205 Ga0451853_0408274 3300041512 Bacteria 1798
206 Ga0451853_3209692 3300041512 Bacteria 2055
207 Ga0439459_0001730 3300042438 Bacteria 3266
208 Ga0466961_0276272 3300044693 Bacteria 1029
209 Ga0466970_0317980 3300044765 Bacteria 880
210 Ga0466959_0012121 3300045049 Bacteria 6222
211 Ga0495627_000337 3300046453 Bacteria 44248
212 Ga0495590_0007930 3300046457 Bacteria 4072
213 Ga0495638_0001603 3300046460 Bacteria 20194
214 Ga0495638_0003632 3300046460 Bacteria 12041
215 Ga0495638_0031802 3300046460 Bacteria 3388
216 Ga0495650_0000114 3300046471 Bacteria 192527
217 Ga0495583_0000013 3300046506 Bacteria 323372
218 Ga0495606_0027657 3300046507 Bacteria 4015
219 Ga0495610_0001221 3300046512 Bacteria 23127
220 Ga0495610_0007960 3300046512 Bacteria 6955
221 Ga0495610_0013155 3300046512 Bacteria 4932
222 Ga0495616_0000835 3300046513 Bacteria 22461
223 Ga0495620_0021704 3300046515 Bacteria 3111
224 Ga0495631_0009254 3300046518 Bacteria 4929
225 Ga0495631_0097277 3300046518 Bacteria 1267
226 Ga0495632_0025186 3300046519 Bacteria 3150
227 Ga0495637_0008888 3300046520 Bacteria 4916
228 Ga0495637_0071880 3300046520 Bacteria 1394
229 Ga0495648_0000090 3300046524 Bacteria 114445
230 Ga0495648_0037669 3300046524 Bacteria 3104
231 Ga0495663_0013806 3300046525 Bacteria 2259
232 Ga0495642_0045493 3300046528 Bacteria 1794
233 Ga0495654_0000082 3300046530 Bacteria 108599
234 Ga0495609_0051560 3300046538 Bacteria 1832
235 Ga0495597_0166599 3300046542 Bacteria 897
236 Ga0495668_0033605 3300046616 Bacteria 2880
237 Ga0495668_0036430 3300046616 Bacteria 2756
238 Ga0495625_0000290 3300046660 Bacteria 77650
239 Ga0495625_0005823 3300046660 Bacteria 11112
240 Ga0495625_0016778 3300046660 Bacteria 5752
241 Ga0495625_0257416 3300046660 Bacteria 1131
242 Ga0495625_0302054 3300046660 Bacteria 1024
243 Ga0495669_0000005 3300046684 Bacteria 193971
244 Ga0495669_0000467 3300046684 Bacteria 18809
245 Ga0495613_0006318 3300046689 Bacteria 8862
246 Ga0495670_0234088 3300046691 Bacteria 977
247 Ga0495649_0367597 3300046694 Bacteria 725
248 Ga0495589_0001405 3300046794 Bacteria 13953
249 Ga0495672_0002135 3300047320 Bacteria 18531
250 Ga0495677_0018208 3300047445 Bacteria 2546
251 Ga0495677_0059537 3300047445 Bacteria 1414
252 Ga0495679_004850 3300047446 Bacteria 6077
253 Ga0495673_0000025 3300047469 Bacteria 512352
254 Ga0495673_0000423 3300047469 Bacteria 48072
255 Ga0495673_0003186 3300047469 Bacteria 10967
256 Ga0495686_0000186 3300047472 Bacteria 116339
257 Ga0495686_0011582 3300047472 Bacteria 6208
258 Ga0495686_0032076 3300047472 Bacteria 3402
259 Ga0495686_0368455 3300047472 Bacteria 777
260 Ga0496106_0056837 3300048909 Bacteria 2958
261 Ga0496107_0000329 3300048910 Bacteria 25658
262 Ga0496110_0474223 3300048913 Bacteria 1140
263 Ga0496112_0012716 3300048915 Bacteria 7740
264 Ga0496115_0002467 3300048918 Bacteria 13293
265 Ga0496115_0029763 3300048918 Bacteria 4292
266 Ga0496115_0043409 3300048918 Bacteria 3586
267 Ga0496115_0095134 3300048918 Bacteria 2438
268 Ga0496115_0103513 3300048918 Bacteria 2335
269 Ga0496121_0001417 3300048924 Bacteria 40646
270 Ga0496124_0164024 3300048927 Bacteria 1729
271 Ga0496125_0159403 3300048928 Bacteria 1535
272 Ga0496126_0002940 3300048929 Bacteria 22137
273 Ga0496126_0382629 3300048929 Bacteria 1145
274 Ga0495678_005019 3300049459 Bacteria 7452
275 Ga0501032_0038214 3300049569 Bacteria 3271
276 Ga0501047_0000165 3300049581 Bacteria 81037
277 Ga0501047_0022497 3300049581 Bacteria 6054
278 Ga0501047_0258907 3300049581 Bacteria 1588
279 Ga0501048_0255742 3300049582 Bacteria 1244
280 Ga0501067_0162968 3300049583 Bacteria 1242
281 Ga0501070_0084929 3300049586 Bacteria 2621
282 Ga0501077_0107040 3300049593 Bacteria 1772
283 Ga0501238_004476 3300049671 Bacteria 1750
284 Ga0501080_0002627 3300049742 Bacteria 15730
285 Ga0501083_0041527 3300049744 Bacteria 3119
286 Ga0501083_0272576 3300049744 Bacteria 1101
287 Ga0501035_0144802 3300049822 Bacteria 2064
288 Ga0501035_0177449 3300049822 Bacteria 1837
289 Ga0501035_0520982 3300049822 Bacteria 977
290 Ga0501044_0003119 3300049823 Bacteria 18782
291 Ga0501044_0351194 3300049823 Bacteria 1394
292 nmdc:mga00v17_1417_c1 3300050491 Bacteria 10795
293 nmdc:mga0yw44_221725_c1 3300050492 Bacteria 1253
294 nmdc:mga0k408_20327_c1 3300050493 Bacteria 3718
295 nmdc:mga06z11_8733_c1 3300050494 Bacteria 4243
296 nmdc:mga04h51_36011_c1 3300050495 Bacteria 1590
297 nmdc:mga07m45_92332_c1 3300050496 Bacteria 1735
298 Ga0495655_0106475 3300053083 Bacteria 837
299 Ga0500578_0000494 3300053086 Bacteria 47968
300 Ga0500578_0144258 3300053086 Bacteria 1487
301 Ga0500643_110573 3300053087 Bacteria 742
302 Ga0500644_0000272 3300053088 Bacteria 28888
303 Ga0500644_0024808 3300053088 Bacteria 1837
304 Ga0500646_0136986 3300053090 Bacteria 801
305 Ga0500641_0001480 3300053096 Bacteria 8373
306 Ga0500554_009475 3300053102 Bacteria 2333
307 Ga0500556_0000558 3300053104 Bacteria 24866
308 Ga0500562_001279 3300053108 Bacteria 6209
309 Ga0500562_004209 3300053108 Bacteria 3636
310 Ga0500572_000285 3300053111 Bacteria 18407
311 Ga0500593_116586 3300053117 Bacteria 1089
312 Ga0500594_0000068 3300053118 Bacteria 32501
313 Ga0500595_019118 3300053119 Bacteria 2492
314 Ga0500595_030092 3300053119 Bacteria 1834
315 Ga0500608_064343 3300053122 Bacteria 1750
316 Ga0500608_092337 3300053122 Bacteria 1413
317 Ga0500614_003600 3300053123 Bacteria 3324
318 Ga0500618_000093 3300053125 Bacteria 73010
319 Ga0500658_0004174 3300053134 Bacteria 5424
320 Ga0500559_0000006 3300053136 Bacteria 229895
321 Ga0500559_0000280 3300053136 Bacteria 39387
322 Ga0500559_0006607 3300053136 Bacteria 5227
323 Ga0500564_000360 3300053138 Bacteria 12843
324 Ga0500577_0000720 3300053142 Bacteria 8467
325 Ga0500603_054751 3300053150 Bacteria 1101
326 Ga0500616_0042902 3300053153 Bacteria 2420
327 Ga0500622_0001052 3300053156 Bacteria 23008
328 Ga0500627_0010263 3300053158 Bacteria 3408
329 Ga0500639_070322 3300053163 Bacteria 1785
330 Ga0500636_0057678 3300053177 Bacteria 2272
331 Ga0500611_003903 3300053727 Bacteria 1958
332 Ga0500645_003884 3300053730 Bacteria 5906
333 Ga0501082_0029675 3300060353 Bacteria 4712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10677024 Ga0157379_106770242 164
2 3300046460 Ga0495638_0001603 Ga0495638_0001603_17710_18366 164
3 3300046691 Ga0495670_0234088 Ga0495670_0234088_132_788 166
4 3300049822 Ga0501035_0144802 Ga0501035_0144802_41_586 173
5 3300021384 Ga0213876_10000345 Ga0213876_1000034526 174
6 3300037853 Ga0436364_0393292 Ga0436364_0393292_1060_1695 174
7 3300039437 Ga0436365_0749742 Ga0436365_0749742_1209_1844 174
8 3300003792 Ga0055540_1014892 Ga0055540_10148923 178
9 3300003794 Ga0055531_10005789 Ga0055531_100057894 178
10 3300025292 Ga0209676_1000708 Ga0209676_100070841 178
11 3300025292 Ga0209676_1000872 Ga0209676_100087232 178
12 3300025298 Ga0209050_1000727 Ga0209050_100072715 178
13 3300025298 Ga0209050_1001246 Ga0209050_100124618 178
14 3300025303 Ga0209051_1003538 Ga0209051_10035388 178
15 3300025304 Ga0209257_1000134 Ga0209257_100013432 178
16 3300048928 Ga0496125_0159403 Ga0496125_0159403_849_1505 178
17 3300048929 Ga0496126_0002940 Ga0496126_0002940_7604_8260 178
18 3300039438 Ga0436360_1375320 Ga0436360_1375320_45_704 181
19 3300025915 Ga0207693_10495923 Ga0207693_104959231 184
20 3300036401 Ga0373937_1199551 Ga0373937_1199551_96_695 185
21 3300049742 Ga0501080_0002627 Ga0501080_0002627_5164_5796 186
22 3300049744 Ga0501083_0041527 Ga0501083_0041527_2451_3083 186
23 3300003771 Ga0055526_1027788 Ga0055526_10277882 188
24 3300005937 Ga0081455_10126642 Ga0081455_101266422 188
25 3300025923 Ga0207681_10406151 Ga0207681_104061512 188
26 3300039437 Ga0436365_1055230 Ga0436365_1055230_713_1384 188
27 3300003794 Ga0055531_10001830 Ga0055531_100018305 189
28 3300005262 Ga0065165_1001029 Ga0065165_10010296 189
29 3300025295 Ga0209564_1002187 Ga0209564_10021879 189
30 3300025297 Ga0209758_1002837 Ga0209758_10028379 189
31 3300025304 Ga0209257_1000246 Ga0209257_100024626 189
32 3300037466 Ga0395898_0644532 Ga0395898_0644532_12_626 189
33 3300042438 Ga0439459_0001730 Ga0439459_0001730_105_761 189
34 3300048929 Ga0496126_0382629 Ga0496126_0382629_341_997 189
35 3300025298 Ga0209050_1022147 Ga0209050_10221471 190
36 3300005545 Ga0070695_100073892 Ga0070695_1000738922 191
37 3300005844 Ga0068862_100098087 Ga0068862_1000980873 191
38 3300049581 Ga0501047_0000165 Ga0501047_0000165_17873_18493 191
39 3300031250 Ga0265331_10141670 Ga0265331_101416702 192
40 3300031251 Ga0265327_10030795 Ga0265327_100307953 192
41 3300031711 Ga0265314_10036838 Ga0265314_100368383 192
42 3300049593 Ga0501077_0107040 Ga0501077_0107040_745_1368 192
43 3300049744 Ga0501083_0272576 Ga0501083_0272576_242_865 192
44 3300053087 Ga0500643_110573 Ga0500643_110573_42_698 192
45 3300005262 Ga0065165_1040477 Ga0065165_10404773 193
46 3300031344 Ga0265316_10195046 Ga0265316_101950462 193
47 3300047446 Ga0495679_004850 Ga0495679_004850_1471_2127 193
48 3300053122 Ga0500608_064343 Ga0500608_064343_437_1093 193
49 3300032004 Ga0307414_10020699 Ga0307414_100206993 194
50 3300036401 Ga0373937_0354637 Ga0373937_0354637_699_1346 194
51 3300049583 Ga0501067_0162968 Ga0501067_0162968_321_953 194
52 3300053125 Ga0500618_000093 Ga0500618_000093_15179_15835 194
53 3300053136 Ga0500559_0000280 Ga0500559_0000280_19283_19939 194
54 3300060353 Ga0501082_0029675 Ga0501082_0029675_326_958 194
55 3300005335 Ga0070666_10196889 Ga0070666_101968892 195
56 3300005347 Ga0070668_100416803 Ga0070668_1004168032 195
57 3300005563 Ga0068855_100420990 Ga0068855_1004209902 195
58 3300006358 Ga0068871_100226635 Ga0068871_1002266352 195
59 3300009093 Ga0105240_10012411 Ga0105240_1001241111 195
60 3300009177 Ga0105248_10510072 Ga0105248_105100722 195
61 3300009551 Ga0105238_10234833 Ga0105238_102348332 195
62 3300021361 Ga0213872_10009694 Ga0213872_100096943 195
63 3300025913 Ga0207695_10011561 Ga0207695_100115614 195
64 3300025949 Ga0207667_10185458 Ga0207667_101854582 195
65 3300028800 Ga0265338_10047205 Ga0265338_100472052 195
66 3300035695 Ga0373927_0510209 Ga0373927_0510209_85_720 195
67 3300039447 Ga0436361_0479516 Ga0436361_0479516_1599_2231 195
68 3300046689 Ga0495613_0006318 Ga0495613_0006318_6456_7103 195
69 3300005331 Ga0070670_100348453 Ga0070670_1003484532 196
70 3300005347 Ga0070668_100024435 Ga0070668_1000244352 196
71 3300005353 Ga0070669_100383387 Ga0070669_1003833871 196
72 3300005617 Ga0068859_100377484 Ga0068859_1003774842 196
73 3300005841 Ga0068863_100135812 Ga0068863_1001358122 196
74 3300005843 Ga0068860_100084844 Ga0068860_1000848443 196
75 3300005844 Ga0068862_100408991 Ga0068862_1004089912 196
76 3300006931 Ga0097620_100377484 Ga0097620_1003774842 196
77 3300025254 Ga0209148_1017561 Ga0209148_10175612 196
78 3300025923 Ga0207681_10266288 Ga0207681_102662883 196
79 3300025925 Ga0207650_10639752 Ga0207650_106397521 196
80 3300025972 Ga0207668_10003586 Ga0207668_100035863 196
81 3300026088 Ga0207641_10663462 Ga0207641_106634621 196
82 3300028379 Ga0268266_10136589 Ga0268266_101365892 196
83 3300028380 Ga0268265_10172128 Ga0268265_101721282 196
84 3300028381 Ga0268264_10103349 Ga0268264_101033493 196
85 3300028800 Ga0265338_10361688 Ga0265338_103616881 196
86 3300039438 Ga0436360_0757444 Ga0436360_0757444_862_1503 196
87 iso_pu_bacteria 2510917020 2511121694 196
88 iso_pu_bacteria 2582581279 2585146374 196
89 iso_pu_bacteria 2585428106 2587917533 196
90 iso_pu_bacteria 2643221545 2643749247 196
91 iso_pu_bacteria 2643221552 2643781367 196
92 iso_pu_bacteria 2643221583 2643922955 196
93 iso_pu_bacteria 2643221584 2643927052 196
94 iso_pu_bacteria 2643221640 2644226942 196
95 iso_pu_bacteria 2643221642 2644233590 196
96 iso_pu_bacteria 2643221691 2644508978 196
97 iso_pu_bacteria 2791355048 2792459969 196
98 iso_pu_bacteria 2843744320 2843744439 196
99 iso_pu_bacteria 2849560528 2849565022 196
100 iso_pu_bacteria 2849573788 2849575041 196
101 iso_pu_bacteria 2851153111 2851155913 196
102 iso_pu_bacteria 2857504554 2857507217 196
103 iso_pu_bacteria 2884960567 2884961906 196
104 iso_pu_bacteria 2898329390 2898332470 196
105 iso_pu_bacteria 2928531327 2928535972 196
106 3300010375 Ga0105239_11495770 Ga0105239_114957701 197
107 3300028794 Ga0307515_10012681 Ga0307515_100126817 197
108 3300039453 Ga0436362_0535385 Ga0436362_0535385_674_1312 197
109 3300053136 Ga0500559_0000006 Ga0500559_0000006_205337_205972 197
110 3300053163 Ga0500639_070322 Ga0500639_070322_719_1354 197
111 iso_pu_bacteria 2582581280 2585151591 197
112 iso_pu_bacteria 2582581293 2585195535 197
113 iso_pu_bacteria 2818991435 2819536349 197
114 iso_pu_bacteria 2818991454 2819644604 197
115 3300005548 Ga0070665_100865630 Ga0070665_1008656301 198
116 3300005844 Ga0068862_100180341 Ga0068862_1001803413 198
117 3300014969 Ga0157376_10988981 Ga0157376_109889811 198
118 3300021384 Ga0213876_10077873 Ga0213876_100778732 198
119 3300025909 Ga0207705_10346466 Ga0207705_103464661 198
120 3300028380 Ga0268265_10139115 Ga0268265_101391153 198
121 3300031251 Ga0265327_10000740 Ga0265327_1000074021 198
122 3300036401 Ga0373937_0423461 Ga0373937_0423461_466_1104 198
123 3300037471 Ga0395905_0145840 Ga0395905_0145840_140_820 198
124 3300039437 Ga0436365_0017797 Ga0436365_0017797_292_927 198
125 3300049671 Ga0501238_004476 Ga0501238_004476_33_683 198
126 3300053096 Ga0500641_0001480 Ga0500641_0001480_2977_3621 198
127 3300053177 Ga0500636_0057678 Ga0500636_0057678_877_1518 198
128 iso_pu_bacteria 2643221614 2644088455 198
129 iso_pu_bacteria 2643221661 2644343691 198
130 iso_pu_bacteria 2643221666 2644368831 198
131 3300005344 Ga0070661_100194936 Ga0070661_1001949362 199
132 3300005539 Ga0068853_100080296 Ga0068853_1000802963 199
133 3300005564 Ga0070664_100141091 Ga0070664_1001410911 199
134 3300006175 Ga0070712_100733993 Ga0070712_1007339931 199
135 3300013100 Ga0157373_10001950 Ga0157373_1000195016 199
136 3300013100 Ga0157373_10002460 Ga0157373_100024601 199
137 3300025920 Ga0207649_10429237 Ga0207649_104292371 199
138 3300031240 Ga0265320_10180188 Ga0265320_101801881 199
139 3300031711 Ga0265314_10201831 Ga0265314_102018312 199
140 3300037471 Ga0395905_0767353 Ga0395905_0767353_192_833 199
141 3300041512 Ga0451853_0408274 Ga0451853_0408274_33_677 199
142 3300048918 Ga0496115_0095134 Ga0496115_0095134_1376_2026 199
143 iso_pu_bacteria 2643221598 2644000589 199
144 3300003773 Ga0055537_1002425 Ga0055537_10024253 200
145 3300003773 Ga0055537_1013828 Ga0055537_10138282 200
146 3300003790 Ga0055528_1013011 Ga0055528_10130114 200
147 3300005334 Ga0068869_100407480 Ga0068869_1004074801 200
148 3300005535 Ga0070684_100219402 Ga0070684_1002194022 200
149 3300005548 Ga0070665_100224744 Ga0070665_1002247443 200
150 3300006353 Ga0075370_10108500 Ga0075370_101085002 200
151 3300013296 Ga0157374_10181739 Ga0157374_101817393 200
152 3300025263 Ga0209565_1000384 Ga0209565_10003849 200
153 3300025273 Ga0209673_1001664 Ga0209673_100166416 200
154 3300025291 Ga0209675_1009123 Ga0209675_10091234 200
155 3300025299 Ga0209256_1001055 Ga0209256_10010553 200
156 3300025299 Ga0209256_1007504 Ga0209256_10075042 200
157 3300025949 Ga0207667_10108061 Ga0207667_101080612 200
158 3300028379 Ga0268266_10186714 Ga0268266_101867142 200
159 3300028794 Ga0307515_10071810 Ga0307515_100718105 200
160 3300031548 Ga0307408_100117442 Ga0307408_1001174423 200
161 3300031731 Ga0307405_10224850 Ga0307405_102248501 200
162 3300031995 Ga0307409_100420285 Ga0307409_1004202852 200
163 3300037312 Ga0395899_0122177 Ga0395899_0122177_158_805 200
164 3300037853 Ga0436364_0388745 Ga0436364_0388745_42_692 200
165 3300038443 Ga0395901_0108825 Ga0395901_0108825_136_783 200
166 3300038443 Ga0395901_0154824 Ga0395901_0154824_110_757 200
167 3300039437 Ga0436365_0452232 Ga0436365_0452232_800_1450 200
168 3300041512 Ga0451853_3209692 Ga0451853_3209692_316_966 200
169 3300046453 Ga0495627_000337 Ga0495627_000337_23166_23816 200
170 3300046457 Ga0495590_0007930 Ga0495590_0007930_2682_3335 200
171 3300046460 Ga0495638_0003632 Ga0495638_0003632_9209_9859 200
172 3300046471 Ga0495650_0000114 Ga0495650_0000114_24297_24947 200
173 3300046506 Ga0495583_0000013 Ga0495583_0000013_154971_155621 200
174 3300046507 Ga0495606_0027657 Ga0495606_0027657_1364_2014 200
175 3300046512 Ga0495610_0001221 Ga0495610_0001221_9360_10010 200
176 3300046512 Ga0495610_0007960 Ga0495610_0007960_366_1016 200
177 3300046512 Ga0495610_0013155 Ga0495610_0013155_3807_4460 200
178 3300046515 Ga0495620_0021704 Ga0495620_0021704_285_935 200
179 3300046518 Ga0495631_0009254 Ga0495631_0009254_922_1575 200
180 3300046518 Ga0495631_0097277 Ga0495631_0097277_295_945 200
181 3300046519 Ga0495632_0025186 Ga0495632_0025186_2142_2792 200
182 3300046520 Ga0495637_0008888 Ga0495637_0008888_222_872 200
183 3300046520 Ga0495637_0071880 Ga0495637_0071880_58_708 200
184 3300046524 Ga0495648_0000090 Ga0495648_0000090_60555_61208 200
185 3300046524 Ga0495648_0037669 Ga0495648_0037669_91_747 200
186 3300046525 Ga0495663_0013806 Ga0495663_0013806_114_764 200
187 3300046530 Ga0495654_0000082 Ga0495654_0000082_93710_94360 200
188 3300046542 Ga0495597_0166599 Ga0495597_0166599_214_864 200
189 3300046616 Ga0495668_0033605 Ga0495668_0033605_1914_2567 200
190 3300046616 Ga0495668_0036430 Ga0495668_0036430_1383_2033 200
191 3300046660 Ga0495625_0000290 Ga0495625_0000290_29823_30479 200
192 3300046660 Ga0495625_0005823 Ga0495625_0005823_9502_10152 200
193 3300046660 Ga0495625_0016778 Ga0495625_0016778_4148_4798 200
194 3300046794 Ga0495589_0001405 Ga0495589_0001405_73_723 200
195 3300047320 Ga0495672_0002135 Ga0495672_0002135_4421_5071 200
196 3300047469 Ga0495673_0000025 Ga0495673_0000025_277047_277697 200
197 3300047469 Ga0495673_0000423 Ga0495673_0000423_28885_29538 200
198 3300047469 Ga0495673_0003186 Ga0495673_0003186_164_814 200
199 3300047472 Ga0495686_0000186 Ga0495686_0000186_90713_91366 200
200 3300047472 Ga0495686_0011582 Ga0495686_0011582_3516_4166 200
201 3300047472 Ga0495686_0032076 Ga0495686_0032076_1099_1749 200
202 3300047472 Ga0495686_0368455 Ga0495686_0368455_55_705 200
203 3300048909 Ga0496106_0056837 Ga0496106_0056837_1575_2225 200
204 3300048910 Ga0496107_0000329 Ga0496107_0000329_18027_18677 200
205 3300048918 Ga0496115_0043409 Ga0496115_0043409_1837_2484 200
206 3300048918 Ga0496115_0103513 Ga0496115_0103513_811_1461 200
207 3300048924 Ga0496121_0001417 Ga0496121_0001417_20716_21366 200
208 3300048927 Ga0496124_0164024 Ga0496124_0164024_628_1278 200
209 3300049459 Ga0495678_005019 Ga0495678_005019_4167_4820 200
210 3300050496 nmdc:mga07m45_92332_c1 nmdc:mga07m45_92332_c1_248_898 200
211 3300053086 Ga0500578_0000494 Ga0500578_0000494_11995_12648 200
212 3300053086 Ga0500578_0144258 Ga0500578_0144258_481_1131 200
213 3300053088 Ga0500644_0000272 Ga0500644_0000272_17136_17789 200
214 3300053088 Ga0500644_0024808 Ga0500644_0024808_305_958 200
215 3300053090 Ga0500646_0136986 Ga0500646_0136986_129_782 200
216 3300053102 Ga0500554_009475 Ga0500554_009475_44_694 200
217 3300053104 Ga0500556_0000558 Ga0500556_0000558_7863_8513 200
218 3300053108 Ga0500562_004209 Ga0500562_004209_2071_2724 200
219 3300053111 Ga0500572_000285 Ga0500572_000285_12690_13334 200
220 3300053118 Ga0500594_0000068 Ga0500594_0000068_11561_12214 200
221 3300053119 Ga0500595_019118 Ga0500595_019118_401_1048 200
222 3300053123 Ga0500614_003600 Ga0500614_003600_844_1494 200
223 3300053134 Ga0500658_0004174 Ga0500658_0004174_770_1420 200
224 3300053136 Ga0500559_0006607 Ga0500559_0006607_4200_4856 200
225 3300053138 Ga0500564_000360 Ga0500564_000360_3363_4016 200
226 3300053142 Ga0500577_0000720 Ga0500577_0000720_3887_4537 200
227 3300053153 Ga0500616_0042902 Ga0500616_0042902_1550_2200 200
228 3300053156 Ga0500622_0001052 Ga0500622_0001052_9975_10628 200
229 3300053158 Ga0500627_0010263 Ga0500627_0010263_1045_1695 200
230 3300053730 Ga0500645_003884 Ga0500645_003884_2888_3538 200
231 3300006195 Ga0075366_10056258 Ga0075366_100562582 201
232 3300028556 Ga0265337_1047750 Ga0265337_10477502 201
233 3300037312 Ga0395899_0000003 Ga0395899_0000003_958005_958652 201
234 3300037853 Ga0436364_0945080 Ga0436364_0945080_11_664 201
235 3300045049 Ga0466959_0012121 Ga0466959_0012121_569_1216 201
236 3300046460 Ga0495638_0031802 Ga0495638_0031802_199_855 201
237 3300046513 Ga0495616_0000835 Ga0495616_0000835_4100_4756 201
238 3300046538 Ga0495609_0051560 Ga0495609_0051560_283_939 201
239 3300046660 Ga0495625_0302054 Ga0495625_0302054_316_972 201
240 3300047445 Ga0495677_0018208 Ga0495677_0018208_1482_2120 201
241 3300049586 Ga0501070_0084929 Ga0501070_0084929_1198_1860 201
242 3300049822 Ga0501035_0177449 Ga0501035_0177449_461_1123 201
243 3300049823 Ga0501044_0351194 Ga0501044_0351194_549_1211 201
244 3300050493 nmdc:mga0k408_20327_c1 nmdc:mga0k408_20327_c1_78_734 201
245 3300053727 Ga0500611_003903 Ga0500611_003903_834_1490 201
246 3300009093 Ga0105240_10934595 Ga0105240_109345951 202
247 3300032004 Ga0307414_10387389 Ga0307414_103873892 202
248 3300049822 Ga0501035_0520982 Ga0501035_0520982_131_793 202
249 3300049823 Ga0501044_0003119 Ga0501044_0003119_15815_16465 202
250 3300005262 Ga0065165_1049469 Ga0065165_10494693 203
251 3300009177 Ga0105248_10001386 Ga0105248_1000138610 203
252 3300009551 Ga0105238_10025171 Ga0105238_100251716 203
253 3300014497 Ga0182008_10211940 Ga0182008_102119402 203
254 3300014968 Ga0157379_10567023 Ga0157379_105670232 203
255 3300025924 Ga0207694_10007937 Ga0207694_100079373 203
256 3300025941 Ga0207711_10001631 Ga0207711_1000163111 203
257 3300026095 Ga0207676_10911535 Ga0207676_109115351 203
258 3300027378 Ga0209981_1002264 Ga0209981_10022643 203
259 3300027543 Ga0209999_1002235 Ga0209999_10022353 203
260 3300027665 Ga0209983_1008218 Ga0209983_10082182 203
261 3300033180 Ga0307510_10150657 Ga0307510_101506574 203
262 3300036401 Ga0373937_0507667 Ga0373937_0507667_196_843 203
263 3300049569 Ga0501032_0038214 Ga0501032_0038214_2570_3217 203
264 3300049581 Ga0501047_0258907 Ga0501047_0258907_534_1181 203
265 3300053119 Ga0500595_030092 Ga0500595_030092_293_937 203
266 3300053150 Ga0500603_054751 Ga0500603_054751_180_827 203
267 3300005335 Ga0070666_10521923 Ga0070666_105219231 204
268 3300005347 Ga0070668_100002191 Ga0070668_10000219112 204
269 3300005347 Ga0070668_100053405 Ga0070668_1000534052 204
270 3300005355 Ga0070671_100023990 Ga0070671_1000239904 204
271 3300005366 Ga0070659_100048376 Ga0070659_1000483764 204
272 3300005367 Ga0070667_100005948 Ga0070667_1000059488 204
273 3300005367 Ga0070667_100022887 Ga0070667_1000228872 204
274 3300005548 Ga0070665_100000762 Ga0070665_10000076219 204
275 3300005548 Ga0070665_100000831 Ga0070665_10000083124 204
276 3300005548 Ga0070665_100099472 Ga0070665_1000994724 204
277 3300005548 Ga0070665_100242657 Ga0070665_1002426573 204
278 3300005617 Ga0068859_100000231 Ga0068859_10000023125 204
279 3300005618 Ga0068864_100218507 Ga0068864_1002185073 204
280 3300005841 Ga0068863_100006931 Ga0068863_10000693113 204
281 3300005842 Ga0068858_100015412 Ga0068858_1000154127 204
282 3300005843 Ga0068860_100099864 Ga0068860_1000998642 204
283 3300005844 Ga0068862_100046307 Ga0068862_1000463072 204
284 3300006042 Ga0075368_10004696 Ga0075368_100046964 204
285 3300006051 Ga0075364_10002235 Ga0075364_1000223510 204
286 3300006178 Ga0075367_10003359 Ga0075367_100033596 204
287 3300006195 Ga0075366_10022236 Ga0075366_100222362 204
288 3300006353 Ga0075370_10043784 Ga0075370_100437845 204
289 3300006931 Ga0097620_100000231 Ga0097620_10000023125 204
290 3300009177 Ga0105248_10015078 Ga0105248_1001507810 204
291 3300009551 Ga0105238_10315249 Ga0105238_103152491 204
292 3300009553 Ga0105249_10048049 Ga0105249_100480492 204
293 3300013306 Ga0163162_10083135 Ga0163162_100831353 204
294 3300013307 Ga0157372_10364471 Ga0157372_103644712 204
295 3300014325 Ga0163163_10034426 Ga0163163_100344263 204
296 3300014968 Ga0157379_10326936 Ga0157379_103269362 204
297 3300025250 Ga0209026_1006849 Ga0209026_10068494 204
298 3300025919 Ga0207657_10054525 Ga0207657_100545252 204
299 3300025924 Ga0207694_10006417 Ga0207694_1000641710 204
300 3300025931 Ga0207644_10008478 Ga0207644_100084785 204
301 3300025941 Ga0207711_10008220 Ga0207711_100082204 204
302 3300025961 Ga0207712_10293240 Ga0207712_102932402 204
303 3300025972 Ga0207668_10000018 Ga0207668_1000001882 204
304 3300025972 Ga0207668_10003470 Ga0207668_100034707 204
305 3300025986 Ga0207658_10009178 Ga0207658_100091787 204
306 3300025986 Ga0207658_10052307 Ga0207658_100523073 204
307 3300026035 Ga0207703_10011403 Ga0207703_100114032 204
308 3300026041 Ga0207639_10272386 Ga0207639_102723861 204
309 3300026088 Ga0207641_10013819 Ga0207641_100138193 204
310 3300027866 Ga0209813_10008236 Ga0209813_100082364 204
311 3300028379 Ga0268266_10000003 Ga0268266_10000003280 204
312 3300028379 Ga0268266_10001678 Ga0268266_1000167819 204
313 3300028379 Ga0268266_10323783 Ga0268266_103237833 204
314 3300028786 Ga0307517_10001099 Ga0307517_1000109927 204
315 3300031251 Ga0265327_10004763 Ga0265327_100047639 204
316 3300031456 Ga0307513_10000208 Ga0307513_1000020835 204
317 3300031456 Ga0307513_10001617 Ga0307513_100016173 204
318 3300031456 Ga0307513_10007553 Ga0307513_100075536 204
319 3300033180 Ga0307510_10061230 Ga0307510_100612302 204
320 3300044765 Ga0466970_0317980 Ga0466970_0317980_116_769 204
321 3300046528 Ga0495642_0045493 Ga0495642_0045493_941_1591 204
322 3300046660 Ga0495625_0257416 Ga0495625_0257416_167_814 204
323 3300046684 Ga0495669_0000005 Ga0495669_0000005_158854_159504 204
324 3300046684 Ga0495669_0000467 Ga0495669_0000467_12720_13367 204
325 3300046694 Ga0495649_0367597 Ga0495649_0367597_13_660 204
326 3300047445 Ga0495677_0059537 Ga0495677_0059537_155_805 204
327 3300048915 Ga0496112_0012716 Ga0496112_0012716_2227_2877 204
328 3300048918 Ga0496115_0002467 Ga0496115_0002467_12251_12901 204
329 3300048918 Ga0496115_0029763 Ga0496115_0029763_1397_2047 204
330 3300049582 Ga0501048_0255742 Ga0501048_0255742_502_1152 204
331 3300050491 nmdc:mga00v17_1417_c1 nmdc:mga00v17_1417_c1_3293_3961 204
332 3300050494 nmdc:mga06z11_8733_c1 nmdc:mga06z11_8733_c1_1573_2241 204
333 3300050495 nmdc:mga04h51_36011_c1 nmdc:mga04h51_36011_c1_786_1454 204
334 3300053122 Ga0500608_092337 Ga0500608_092337_245_904 204
335 3300002741 JGI25157J39369_1010819 JGI25157J39369_10108192 205
336 3300005327 Ga0070658_10260544 Ga0070658_102605442 205
337 3300005563 Ga0068855_100029843 Ga0068855_1000298436 205
338 3300006038 Ga0075365_10185045 Ga0075365_101850452 205
339 3300009093 Ga0105240_10139469 Ga0105240_101394693 205
340 3300009551 Ga0105238_11133712 Ga0105238_111337121 205
341 3300013105 Ga0157369_10403028 Ga0157369_104030282 205
342 3300025250 Ga0209026_1004334 Ga0209026_10043344 205
343 3300025304 Ga0209257_1003130 Ga0209257_100313012 205
344 3300025909 Ga0207705_10215582 Ga0207705_102155822 205
345 3300025909 Ga0207705_10336117 Ga0207705_103361171 205
346 3300025913 Ga0207695_10094222 Ga0207695_100942224 205
347 3300025949 Ga0207667_10010996 Ga0207667_100109963 205
348 3300035692 Ga0373935_0426437 Ga0373935_0426437_43_696 205
349 3300035725 Ga0373947_0048401 Ga0373947_0048401_234_887 205
350 3300037068 Ga0373925_0295275 Ga0373925_0295275_60_713 205
351 3300037312 Ga0395899_0068678 Ga0395899_0068678_986_1639 205
352 3300038443 Ga0395901_0549086 Ga0395901_0549086_55_708 205
353 3300038443 Ga0395901_1083423 Ga0395901_1083423_17_670 205
354 3300044693 Ga0466961_0276272 Ga0466961_0276272_292_945 205
355 3300048913 Ga0496110_0474223 Ga0496110_0474223_446_1105 205
356 3300049581 Ga0501047_0022497 Ga0501047_0022497_1532_2185 205
357 3300050492 nmdc:mga0yw44_221725_c1 nmdc:mga0yw44_221725_c1_251_907 205
358 3300053083 Ga0495655_0106475 Ga0495655_0106475_71_724 205
359 3300053108 Ga0500562_001279 Ga0500562_001279_2580_3236 205
360 3300053117 Ga0500593_116586 Ga0500593_116586_287_943 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

181

235

0.94

Feature Viewer

pLDDT pTM Quality
75.36 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map