F421856

General Info

Members Datasets Scaffolds Average Seq Length
360 225 720 119

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11596337|Ga0111539_115963372
Length 137
Sequence MIDMQRHQQFRGKIGGSIMYVDGFVLPVPEKNLKAYRTIAQKAGKIWREHGALQYVEAVGDDLDNKWGVSFPKLIKVKPGEKPLFSFIVYKSRADRDKVNAKVMADPRMHKIMKKDAQMPFEIKRMAYGGFKFLVNL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
128 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
172 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
173 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
187 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
188 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
194 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
198 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
204 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
210 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
211 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
212 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
213 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 30.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11596337 3300009094 Unclassified 757
2 MBSR1b_contig_9220078 2162886012 Bacteria 3898
3 MBSR1b_contig_9543904 2162886012 Unclassified 814
4 CNAas_1001858 3300000532 Unclassified 1634
5 rootL2_10179430 3300003322 Bacteria 1280
6 Ga0065704_10148307 3300005289 Bacteria 1451
7 Ga0065712_10006013 3300005290 Bacteria 4270
8 Ga0065715_10093131 3300005293 Bacteria 4799
9 Ga0065715_10184322 3300005293 Unclassified 1455
10 Ga0065715_10265591 3300005293 Unclassified 1125
11 Ga0070676_10068583 3300005328 Unclassified 2123
12 Ga0070690_100001903 3300005330 Bacteria 11087
13 Ga0070690_100402038 3300005330 Unclassified 1006
14 Ga0070690_101710551 3300005330 Bacteria 512
15 Ga0070670_100164297 3300005331 Unclassified 1924
16 Ga0070677_10058221 3300005333 Unclassified 1586
17 Ga0068869_100097834 3300005334 Unclassified 2216
18 Ga0068869_100824262 3300005334 Bacteria 799
19 Ga0070666_10199044 3300005335 Unclassified 1409
20 Ga0070680_100086538 3300005336 Unclassified 2590
21 Ga0070680_100737339 3300005336 Bacteria 848
22 Ga0070680_101050917 3300005336 Bacteria 704
23 Ga0068868_102245961 3300005338 Bacteria 520
24 Ga0070689_100444865 3300005340 Bacteria 1102
25 Ga0070691_10089263 3300005341 Unclassified 1518
26 Ga0070687_100020143 3300005343 Bacteria 3114
27 Ga0070687_100020231 3300005343 Unclassified 3109
28 Ga0070661_101610040 3300005344 Unclassified 549
29 Ga0070692_10074699 3300005345 Bacteria 1814
30 Ga0070692_10128141 3300005345 Unclassified 1423
31 Ga0070692_10766826 3300005345 Bacteria 655
32 Ga0070669_100007429 3300005353 Bacteria 7852
33 Ga0070669_100080066 3300005353 Bacteria 2430
34 Ga0070675_100539315 3300005354 Unclassified 1054
35 Ga0070674_100957273 3300005356 Bacteria 749
36 Ga0070673_100071496 3300005364 Unclassified 2788
37 Ga0070673_100363922 3300005364 Bacteria 1286
38 Ga0070688_100224145 3300005365 Unclassified 1326
39 Ga0070667_100282147 3300005367 Bacteria 1491
40 Ga0070713_100538200 3300005436 Unclassified 1105
41 Ga0070701_10132849 3300005438 Bacteria 1416
42 Ga0070701_10165859 3300005438 Unclassified 1283
43 Ga0070705_100494801 3300005440 Bacteria 927
44 Ga0070705_101774397 3300005440 Unclassified 523
45 Ga0070700_100040681 3300005441 Bacteria 2847
46 Ga0070700_100190023 3300005441 Bacteria 1435
47 Ga0070700_100357414 3300005441 Bacteria 1085
48 Ga0070700_100403713 3300005441 Bacteria 1028
49 Ga0070694_100221683 3300005444 Bacteria 1419
50 Ga0070694_100262467 3300005444 Unclassified 1310
51 Ga0070694_100508918 3300005444 Bacteria 959
52 Ga0070708_101498690 3300005445 Bacteria 628
53 Ga0070662_100047026 3300005457 Bacteria 3102
54 Ga0070662_100052687 3300005457 Unclassified 2943
55 Ga0070662_100085587 3300005457 Bacteria 2356
56 Ga0070662_100890139 3300005457 Unclassified 759
57 Ga0068867_100030997 3300005459 Bacteria 3859
58 Ga0068867_100069614 3300005459 Bacteria 2628
59 Ga0070707_100106457 3300005468 Bacteria 2720
60 Ga0070707_100442475 3300005468 Bacteria 1260
61 Ga0070699_100281763 3300005518 Bacteria 1489
62 Ga0070697_100250797 3300005536 Unclassified 1513
63 Ga0070672_100278241 3300005543 Unclassified 1414
64 Ga0070672_100881433 3300005543 Bacteria 790
65 Ga0070686_100022385 3300005544 Bacteria 3764
66 Ga0070686_100053688 3300005544 Bacteria 2574
67 Ga0070686_100457616 3300005544 Unclassified 982
68 Ga0070686_101310829 3300005544 Unclassified 605
69 Ga0070695_100024710 3300005545 Unclassified 3704
70 Ga0070695_100053918 3300005545 Bacteria 2587
71 Ga0070695_100093782 3300005545 Unclassified 2009
72 Ga0070695_100359100 3300005545 Bacteria 1093
73 Ga0070696_100081541 3300005546 Bacteria 2292
74 Ga0070696_100164624 3300005546 Bacteria 1636
75 Ga0070693_100740813 3300005547 Unclassified 723
76 Ga0070665_100000095 3300005548 Bacteria 170459
77 Ga0070704_100024814 3300005549 Unclassified 3939
78 Ga0070704_100030716 3300005549 Bacteria 3603
79 Ga0070704_100064677 3300005549 Bacteria 2630
80 Ga0070704_100162356 3300005549 Bacteria 1768
81 Ga0070704_100567401 3300005549 Bacteria 994
82 Ga0070664_100112081 3300005564 Bacteria 2382
83 Ga0068857_101118075 3300005577 Unclassified 761
84 Ga0068857_101393532 3300005577 Unclassified 682
85 Ga0068854_100080618 3300005578 Unclassified 2402
86 Ga0068854_100240933 3300005578 Bacteria 1440
87 Ga0070702_100212598 3300005615 Unclassified 1288
88 Ga0070702_100518989 3300005615 Unclassified 878
89 Ga0068859_100047495 3300005617 Unclassified 4313
90 Ga0068859_100179983 3300005617 Unclassified 2197
91 Ga0068864_100291106 3300005618 Unclassified 1527
92 Ga0068864_101626943 3300005618 Unclassified 650
93 Ga0068864_102462225 3300005618 Unclassified 527
94 Ga0068866_10768881 3300005718 Bacteria 667
95 Ga0068861_100066719 3300005719 Bacteria 2775
96 Ga0068861_100264779 3300005719 Bacteria 1473
97 Ga0068861_100551047 3300005719 Bacteria 1051
98 Ga0068861_101230119 3300005719 Unclassified 725
99 Ga0068870_10057143 3300005840 Unclassified 2085
100 Ga0068863_100453218 3300005841 Bacteria 1259
101 Ga0068858_100254046 3300005842 Bacteria 1670
102 Ga0068860_100093542 3300005843 Bacteria 2865
103 Ga0068860_100137816 3300005843 Unclassified 2344
104 Ga0068860_100336607 3300005843 Bacteria 1483
105 Ga0068860_100431720 3300005843 Bacteria 1307
106 Ga0068862_100013011 3300005844 Bacteria 6881
107 Ga0068862_100048186 3300005844 Bacteria 3638
108 Ga0068862_100099142 3300005844 Unclassified 2546
109 Ga0068862_101043026 3300005844 Bacteria 810
110 Ga0081540_1004239 3300005983 Bacteria 11015
111 Ga0075366_10397040 3300006195 Bacteria 849
112 Ga0075428_100033160 3300006844 Bacteria 5703
113 Ga0075428_100558631 3300006844 Bacteria 1223
114 Ga0075430_100008748 3300006846 Bacteria 8545
115 Ga0075430_100316903 3300006846 Bacteria 1289
116 Ga0075430_100481043 3300006846 Bacteria 1024
117 Ga0075431_100032826 3300006847 Bacteria 5350
118 Ga0075431_100093005 3300006847 Bacteria 3112
119 Ga0075431_100131263 3300006847 Bacteria 2583
120 Ga0075431_100248584 3300006847 Bacteria 1807
121 Ga0075431_100520990 3300006847 Bacteria 1178
122 Ga0075431_101078800 3300006847 Bacteria 768
123 Ga0075433_11041026 3300006852 Unclassified 712
124 Ga0075434_100194634 3300006871 Bacteria 2048
125 Ga0075429_100067436 3300006880 Unclassified 3113
126 Ga0075429_100090166 3300006880 Bacteria 2673
127 Ga0075429_100233723 3300006880 Bacteria 1610
128 Ga0075429_100388808 3300006880 Bacteria 1221
129 Ga0075429_100838661 3300006880 Bacteria 805
130 Ga0068865_100685963 3300006881 Bacteria 874
131 Ga0097620_100047497 3300006931 Unclassified 4313
132 Ga0097620_100179987 3300006931 Unclassified 2197
133 Ga0105240_10584294 3300009093 Bacteria 1232
134 Ga0111539_10008723 3300009094 Bacteria 12862
135 Ga0111539_10184011 3300009094 Bacteria 2440
136 Ga0114129_10182101 3300009147 Bacteria 2858
137 Ga0114129_10195648 3300009147 Bacteria 2742
138 Ga0114129_10326780 3300009147 Bacteria 2038
139 Ga0114129_12692702 3300009147 Bacteria 592
140 Ga0114129_12768601 3300009147 Bacteria 583
141 Ga0114129_12958430 3300009147 Bacteria 560
142 Ga0105243_11398844 3300009148 Bacteria 720
143 Ga0105241_12703382 3300009174 Bacteria 500
144 Ga0105242_10310071 3300009176 Bacteria 1443
145 Ga0105242_11476691 3300009176 Bacteria 710
146 Ga0105242_12457515 3300009176 Bacteria 569
147 Ga0105249_10078676 3300009553 Bacteria 3060
148 Ga0105032_100608 3300009979 Bacteria 3500
149 Ga0105239_11905333 3300010375 Bacteria 689
150 Ga0105246_12538381 3300011119 Unclassified 505
151 Ga0157371_11154776 3300013102 Bacteria 595
152 Ga0157378_10017935 3300013297 Bacteria 6214
153 Ga0157378_10310767 3300013297 Bacteria 1528
154 Ga0157378_10388529 3300013297 Unclassified 1372
155 Ga0157378_11338255 3300013297 Bacteria 758
156 Ga0163162_10169160 3300013306 Bacteria 2310
157 Ga0157375_10034048 3300013308 Unclassified 4848
158 Ga0157375_10195548 3300013308 Bacteria 2177
159 Ga0163163_10690096 3300014325 Bacteria 1085
160 Ga0157380_10001347 3300014326 Bacteria 15989
161 Ga0157380_10026490 3300014326 Unclassified 4402
162 Ga0157380_10037741 3300014326 Bacteria 3745
163 Ga0157380_10278800 3300014326 Bacteria 1528
164 Ga0157377_10129688 3300014745 Unclassified 1538
165 Ga0163161_10035107 3300017792 Bacteria 3588
166 Ga0207642_10931854 3300025899 Bacteria 557
167 Ga0207688_10593960 3300025901 Unclassified 697
168 Ga0207680_11066729 3300025903 Unclassified 578
169 Ga0207645_10076893 3300025907 Bacteria 2138
170 Ga0207684_11062722 3300025910 Bacteria 675
171 Ga0207660_10135136 3300025917 Bacteria 1881
172 Ga0207660_10172568 3300025917 Unclassified 1675
173 Ga0207662_10083665 3300025918 Bacteria 1951
174 Ga0207662_10098308 3300025918 Bacteria 1811
175 Ga0207649_10721896 3300025920 Bacteria 774
176 Ga0207646_10122307 3300025922 Bacteria 2339
177 Ga0207646_10451523 3300025922 Bacteria 1160
178 Ga0207681_10176807 3300025923 Unclassified 1622
179 Ga0207650_10875278 3300025925 Bacteria 762
180 Ga0207659_10263599 3300025926 Unclassified 1403
181 Ga0207659_11778671 3300025926 Unclassified 524
182 Ga0207706_10019462 3300025933 Bacteria 6108
183 Ga0207706_10051142 3300025933 Unclassified 3650
184 Ga0207706_10065478 3300025933 Bacteria 3200
185 Ga0207706_11089174 3300025933 Bacteria 668
186 Ga0207686_11665037 3300025934 Bacteria 527
187 Ga0207709_10702626 3300025935 Bacteria 809
188 Ga0207670_10331430 3300025936 Bacteria 1200
189 Ga0207691_10627599 3300025940 Bacteria 909
190 Ga0207691_10802053 3300025940 Bacteria 791
191 Ga0207689_10114521 3300025942 Unclassified 2216
192 Ga0207679_12066083 3300025945 Unclassified 518
193 Ga0207651_10083978 3300025960 Unclassified 2305
194 Ga0207651_10427890 3300025960 Bacteria 1131
195 Ga0207712_10323808 3300025961 Bacteria 1273
196 Ga0207640_10050374 3300025981 Unclassified 2701
197 Ga0207640_10078642 3300025981 Unclassified 2246
198 Ga0207658_10003277 3300025986 Bacteria 11499
199 Ga0207677_10194624 3300026023 Bacteria 1606
200 Ga0207703_10317825 3300026035 Bacteria 1425
201 Ga0207708_10030760 3300026075 Unclassified 4072
202 Ga0207708_10045599 3300026075 Bacteria 3340
203 Ga0207708_10266023 3300026075 Bacteria 1385
204 Ga0207708_10537584 3300026075 Bacteria 984
205 Ga0207641_10502506 3300026088 Bacteria 1178
206 Ga0207648_10055118 3300026089 Bacteria 3471
207 Ga0207648_10200021 3300026089 Unclassified 1772
208 Ga0207648_11096595 3300026089 Bacteria 747
209 Ga0207676_11021255 3300026095 Unclassified 815
210 Ga0207676_12304267 3300026095 Unclassified 536
211 Ga0207674_10202813 3300026116 Bacteria 1933
212 Ga0207674_11140780 3300026116 Unclassified 749
213 Ga0207675_100012390 3300026118 Bacteria 7965
214 Ga0207675_100083115 3300026118 Bacteria 3003
215 Ga0207675_100740923 3300026118 Unclassified 994
216 Ga0207675_101177385 3300026118 Unclassified 787
217 Ga0209967_1005451 3300027364 Bacteria 1707
218 Ga0209981_1023853 3300027378 Bacteria 882
219 Ga0209996_1083515 3300027395 Bacteria 502
220 Ga0209999_1018410 3300027543 Unclassified 1278
221 Ga0209970_1034498 3300027614 Bacteria 887
222 Ga0209998_10018315 3300027717 Unclassified 1486
223 Ga0209974_10008441 3300027876 Bacteria 3521
224 Ga0207428_10127340 3300027907 Bacteria 1950
225 Ga0268266_10000001 3300028379 Bacteria 4040580
226 Ga0268265_10019044 3300028380 Bacteria 4766
227 Ga0268265_10036080 3300028380 Bacteria 3619
228 Ga0268265_10094485 3300028380 Bacteria 2398
229 Ga0268265_10514728 3300028380 Unclassified 1130
230 Ga0268264_10058177 3300028381 Bacteria 3236
231 Ga0268264_10620243 3300028381 Unclassified 1068
232 Ga0268264_10747110 3300028381 Bacteria 974
233 Ga0314311_1218855 3300030733 Unclassified 1104
234 Ga0316178_1105280 3300030735 Unclassified 1436
235 Ga0307408_100044516 3300031548 Bacteria 3163
236 Ga0307408_101165668 3300031548 Bacteria 717
237 Ga0307405_10048882 3300031731 Bacteria 2611
238 Ga0307413_10054477 3300031824 Bacteria 2427
239 Ga0307410_10054096 3300031852 Bacteria 2719
240 Ga0307406_10017391 3300031901 Bacteria 4184
241 Ga0307407_10419250 3300031903 Bacteria 964
242 Ga0307412_10027464 3300031911 Bacteria 3549
243 Ga0307409_102578607 3300031995 Unclassified 537
244 Ga0307416_100035335 3300032002 Bacteria 3815
245 Ga0307416_101092488 3300032002 Bacteria 902
246 Ga0307414_10039293 3300032004 Bacteria 3186
247 Ga0307415_100009354 3300032126 Bacteria 5487
248 Ga0373923_0608046 3300035111 Bacteria 539
249 Ga0373955_0539689 3300035172 Bacteria 713
250 Ga0373931_0298820 3300035691 Bacteria 994
251 Ga0395899_0472532 3300037312 Bacteria 818
252 Ga0395900_0645537 3300037418 Bacteria 995
253 Ga0395898_0258165 3300037466 Bacteria 1662
254 Ga0395905_0898242 3300037471 Bacteria 789
255 Ga0242420_023627 3300038996 Bacteria 1110
256 Ga0439453_0039713 3300041408 Bacteria 919
257 Ga0439443_004873 3300042003 Bacteria 1773
258 Ga0439446_0114055 3300042156 Bacteria 864
259 Ga0439435_0007227 3300042436 Bacteria 2530
260 Ga0439444_0004100 3300042437 Bacteria 2095
261 Ga0439460_0010945 3300042461 Bacteria 2332
262 Ga0450916_041611 3300042530 Bacteria 700
263 Ga0451577_0761322 3300042876 Bacteria 876
264 Ga0453683_0642798 3300044673 Bacteria 693
265 Ga0453683_0946849 3300044673 Bacteria 570
266 Ga0451576_0052134 3300045051 Bacteria 4287
267 Ga0495582_0031405 3300046473 Bacteria 2919
268 Ga0495662_0004491 3300046476 Bacteria 7001
269 Ga0495628_0128828 3300046516 Bacteria 1937
270 Ga0495643_0000329 3300046522 Bacteria 65145
271 Ga0495652_0303012 3300046529 Bacteria 1161
272 Ga0495640_0061982 3300046533 Bacteria 2539
273 Ga0495634_0113075 3300046642 Bacteria 1744
274 Ga0495635_0090870 3300046663 Bacteria 2088
275 Ga0495658_0171125 3300046683 Bacteria 1344
276 Ga0495624_0089763 3300046690 Bacteria 1896
277 Ga0495600_0205014 3300046809 Bacteria 1265
278 Ga0495581_0605502 3300047315 Bacteria 634
279 Ga0495674_0126005 3300047319 Bacteria 2161
280 Ga0501291_024053 3300049514 Unclassified 988
281 Ga0501292_083124 3300049515 Unclassified 612
282 Ga0501299_040145 3300049522 Unclassified 936
283 Ga0501040_0578215 3300049576 Bacteria 811
284 Ga0501042_0241982 3300049578 Bacteria 1302
285 Ga0501070_0260198 3300049586 Bacteria 1418
286 Ga0501071_0531626 3300049587 Bacteria 903
287 Ga0501072_0234691 3300049588 Bacteria 1461
288 Ga0501075_0337264 3300049591 Bacteria 1149
289 Ga0501076_0808606 3300049592 Bacteria 773
290 Ga0501077_0258193 3300049593 Unclassified 1108
291 Ga0501198_002842 3300049649 Bacteria 2350
292 Ga0501199_018574 3300049650 Unclassified 794
293 Ga0501202_001349 3300049652 Bacteria 3911
294 Ga0501207_002238 3300049654 Unclassified 2486
295 Ga0501207_112374 3300049654 Unclassified 558
296 Ga0501208_004347 3300049655 Bacteria 1663
297 Ga0501209_054133 3300049656 Bacteria 1103
298 Ga0501216_069098 3300049660 Unclassified 727
299 Ga0501217_006256 3300049661 Bacteria 2522
300 Ga0501223_006042 3300049663 Bacteria 2518
301 Ga0501223_007879 3300049663 Unclassified 2173
302 Ga0501224_000844 3300049664 Bacteria 3915
303 Ga0501227_000637 3300049665 Bacteria 7621
304 Ga0501227_001547 3300049665 Bacteria 5128
305 Ga0501228_061856 3300049666 Unclassified 531
306 Ga0501230_005015 3300049667 Bacteria 1853
307 Ga0501233_005034 3300049668 Unclassified 2443
308 Ga0501235_011858 3300049669 Bacteria 1914
309 Ga0501236_027958 3300049670 Bacteria 876
310 Ga0501240_018350 3300049673 Unclassified 1028
311 Ga0501243_000449 3300049675 Bacteria 5476
312 Ga0501253_126989 3300049683 Unclassified 623
313 Ga0501255_049591 3300049684 Unclassified 639
314 Ga0501257_037927 3300049686 Unclassified 1177
315 Ga0501219_013767 3300049703 Unclassified 640
316 Ga0501221_074688 3300049704 Bacteria 806
317 Ga0501225_0002723 3300049705 Bacteria 5425
318 Ga0501225_0265528 3300049705 Unclassified 570
319 Ga0501229_001551 3300049706 Bacteria 2691
320 Ga0501234_004351 3300049707 Bacteria 2223
321 Ga0501079_1182388 3300049741 Unclassified 602
322 Ga0501232_030687 3300049757 Unclassified 745
323 Ga0501262_030315 3300049759 Unclassified 777
324 Ga0501270_127123 3300049767 Unclassified 560
325 Ga0501276_037956 3300049773 Unclassified 527
326 Ga0501212_084701 3300049851 Unclassified 578
327 Ga0501226_000317 3300049853 Bacteria 7113
328 nmdc:mga05p37_344624_c1 3300050507 Bacteria 1756
329 nmdc:mga05p37_52817_c1 3300050507 Bacteria 4997
330 nmdc:mga05p37_610506_c1 3300050507 Bacteria 1229
331 nmdc:mga05p37_988621_c1 3300050507 Bacteria 895
332 nmdc:mga09592_1055910_c1 3300050508 Bacteria 677
333 nmdc:mga09592_172597_c1 3300050508 Bacteria 1870
334 nmdc:mga09592_1731354_c1 3300050508 Bacteria 503
335 nmdc:mga09592_177608_c1 3300050508 Bacteria 1842
336 nmdc:mga09592_338276_c1 3300050508 Bacteria 1303
337 nmdc:mga09592_461226_c1 3300050508 Bacteria 1096
338 nmdc:mga0qj67_104781_c1 3300050509 Bacteria 2282
339 nmdc:mga0qj67_215332_c1 3300050509 Bacteria 1560
340 nmdc:mga0qj67_6751_c1 3300050509 Bacteria 8435
341 nmdc:mga06r32_137712_c1 3300050510 Bacteria 2416
342 nmdc:mga06r32_233618_c1 3300050510 Bacteria 1827
343 nmdc:mga06r32_45534_c1 3300050510 Bacteria 4183
344 nmdc:mga06r32_497341_c1 3300050510 Bacteria 1196
345 nmdc:mga08y16_176884_c1 3300050511 Bacteria 2216
346 nmdc:mga08y16_30513_c1 3300050511 Bacteria 5673
347 nmdc:mga08y16_666471_c1 3300050511 Unclassified 1043
348 nmdc:mga08y16_898684_c1 3300050511 Unclassified 872
349 nmdc:mga0n895_130940_c1 3300050512 Bacteria 2533
350 nmdc:mga0a205_139712_c2 3300050515 Unclassified 640
351 nmdc:mga0a205_465438_c1 3300050515 Bacteria 1123
352 Ga0495601_0263811 3300053077 Bacteria 1124
353 Ga0501084_0177903 3300054114 Bacteria 1796
354 Ga0501084_0238724 3300054114 Bacteria 1534
355 Ga0501084_1480562 3300054114 Unclassified 568
356 Ga0501082_0833168 3300060353 Bacteria 807
357 Ga0530510_0069945 3300061734 Bacteria 2547
358 Ga0530510_0346886 3300061734 Bacteria 1115
359 Ga0530510_0840201 3300061734 Unclassified 701
360 Ga0530510_1085788 3300061734 Bacteria 613
361 Ga0111539_11596337
362 MBSR1b_contig_9220078
363 MBSR1b_contig_9543904
364 CNAas_1001858
365 rootL2_10179430
366 Ga0065704_10148307
367 Ga0065712_10006013
368 Ga0065715_10093131
369 Ga0065715_10184322
370 Ga0065715_10265591
371 Ga0070676_10068583
372 Ga0070690_100001903
373 Ga0070690_100402038
374 Ga0070690_101710551
375 Ga0070670_100164297
376 Ga0070677_10058221
377 Ga0068869_100097834
378 Ga0068869_100824262
379 Ga0070666_10199044
380 Ga0070680_100086538
381 Ga0070680_100737339
382 Ga0070680_101050917
383 Ga0068868_102245961
384 Ga0070689_100444865
385 Ga0070691_10089263
386 Ga0070687_100020143
387 Ga0070687_100020231
388 Ga0070661_101610040
389 Ga0070692_10074699
390 Ga0070692_10128141
391 Ga0070692_10766826
392 Ga0070669_100007429
393 Ga0070669_100080066
394 Ga0070675_100539315
395 Ga0070674_100957273
396 Ga0070673_100071496
397 Ga0070673_100363922
398 Ga0070688_100224145
399 Ga0070667_100282147
400 Ga0070713_100538200
401 Ga0070701_10132849
402 Ga0070701_10165859
403 Ga0070705_100494801
404 Ga0070705_101774397
405 Ga0070700_100040681
406 Ga0070700_100190023
407 Ga0070700_100357414
408 Ga0070700_100403713
409 Ga0070694_100221683
410 Ga0070694_100262467
411 Ga0070694_100508918
412 Ga0070708_101498690
413 Ga0070662_100047026
414 Ga0070662_100052687
415 Ga0070662_100085587
416 Ga0070662_100890139
417 Ga0068867_100030997
418 Ga0068867_100069614
419 Ga0070707_100106457
420 Ga0070707_100442475
421 Ga0070699_100281763
422 Ga0070697_100250797
423 Ga0070672_100278241
424 Ga0070672_100881433
425 Ga0070686_100022385
426 Ga0070686_100053688
427 Ga0070686_100457616
428 Ga0070686_101310829
429 Ga0070695_100024710
430 Ga0070695_100053918
431 Ga0070695_100093782
432 Ga0070695_100359100
433 Ga0070696_100081541
434 Ga0070696_100164624
435 Ga0070693_100740813
436 Ga0070665_100000095
437 Ga0070704_100024814
438 Ga0070704_100030716
439 Ga0070704_100064677
440 Ga0070704_100162356
441 Ga0070704_100567401
442 Ga0070664_100112081
443 Ga0068857_101118075
444 Ga0068857_101393532
445 Ga0068854_100080618
446 Ga0068854_100240933
447 Ga0070702_100212598
448 Ga0070702_100518989
449 Ga0068859_100047495
450 Ga0068859_100179983
451 Ga0068864_100291106
452 Ga0068864_101626943
453 Ga0068864_102462225
454 Ga0068866_10768881
455 Ga0068861_100066719
456 Ga0068861_100264779
457 Ga0068861_100551047
458 Ga0068861_101230119
459 Ga0068870_10057143
460 Ga0068863_100453218
461 Ga0068858_100254046
462 Ga0068860_100093542
463 Ga0068860_100137816
464 Ga0068860_100336607
465 Ga0068860_100431720
466 Ga0068862_100013011
467 Ga0068862_100048186
468 Ga0068862_100099142
469 Ga0068862_101043026
470 Ga0081540_1004239
471 Ga0075366_10397040
472 Ga0075428_100033160
473 Ga0075428_100558631
474 Ga0075430_100008748
475 Ga0075430_100316903
476 Ga0075430_100481043
477 Ga0075431_100032826
478 Ga0075431_100093005
479 Ga0075431_100131263
480 Ga0075431_100248584
481 Ga0075431_100520990
482 Ga0075431_101078800
483 Ga0075433_11041026
484 Ga0075434_100194634
485 Ga0075429_100067436
486 Ga0075429_100090166
487 Ga0075429_100233723
488 Ga0075429_100388808
489 Ga0075429_100838661
490 Ga0068865_100685963
491 Ga0097620_100047497
492 Ga0097620_100179987
493 Ga0105240_10584294
494 Ga0111539_10008723
495 Ga0111539_10184011
496 Ga0114129_10182101
497 Ga0114129_10195648
498 Ga0114129_10326780
499 Ga0114129_12692702
500 Ga0114129_12768601
501 Ga0114129_12958430
502 Ga0105243_11398844
503 Ga0105241_12703382
504 Ga0105242_10310071
505 Ga0105242_11476691
506 Ga0105242_12457515
507 Ga0105249_10078676
508 Ga0105032_100608
509 Ga0105239_11905333
510 Ga0105246_12538381
511 Ga0157371_11154776
512 Ga0157378_10017935
513 Ga0157378_10310767
514 Ga0157378_10388529
515 Ga0157378_11338255
516 Ga0163162_10169160
517 Ga0157375_10034048
518 Ga0157375_10195548
519 Ga0163163_10690096
520 Ga0157380_10001347
521 Ga0157380_10026490
522 Ga0157380_10037741
523 Ga0157380_10278800
524 Ga0157377_10129688
525 Ga0163161_10035107
526 Ga0207642_10931854
527 Ga0207688_10593960
528 Ga0207680_11066729
529 Ga0207645_10076893
530 Ga0207684_11062722
531 Ga0207660_10135136
532 Ga0207660_10172568
533 Ga0207662_10083665
534 Ga0207662_10098308
535 Ga0207649_10721896
536 Ga0207646_10122307
537 Ga0207646_10451523
538 Ga0207681_10176807
539 Ga0207650_10875278
540 Ga0207659_10263599
541 Ga0207659_11778671
542 Ga0207706_10019462
543 Ga0207706_10051142
544 Ga0207706_10065478
545 Ga0207706_11089174
546 Ga0207686_11665037
547 Ga0207709_10702626
548 Ga0207670_10331430
549 Ga0207691_10627599
550 Ga0207691_10802053
551 Ga0207689_10114521
552 Ga0207679_12066083
553 Ga0207651_10083978
554 Ga0207651_10427890
555 Ga0207712_10323808
556 Ga0207640_10050374
557 Ga0207640_10078642
558 Ga0207658_10003277
559 Ga0207677_10194624
560 Ga0207703_10317825
561 Ga0207708_10030760
562 Ga0207708_10045599
563 Ga0207708_10266023
564 Ga0207708_10537584
565 Ga0207641_10502506
566 Ga0207648_10055118
567 Ga0207648_10200021
568 Ga0207648_11096595
569 Ga0207676_11021255
570 Ga0207676_12304267
571 Ga0207674_10202813
572 Ga0207674_11140780
573 Ga0207675_100012390
574 Ga0207675_100083115
575 Ga0207675_100740923
576 Ga0207675_101177385
577 Ga0209967_1005451
578 Ga0209981_1023853
579 Ga0209996_1083515
580 Ga0209999_1018410
581 Ga0209970_1034498
582 Ga0209998_10018315
583 Ga0209974_10008441
584 Ga0207428_10127340
585 Ga0268266_10000001
586 Ga0268265_10019044
587 Ga0268265_10036080
588 Ga0268265_10094485
589 Ga0268265_10514728
590 Ga0268264_10058177
591 Ga0268264_10620243
592 Ga0268264_10747110
593 Ga0314311_1218855
594 Ga0316178_1105280
595 Ga0307408_100044516
596 Ga0307408_101165668
597 Ga0307405_10048882
598 Ga0307413_10054477
599 Ga0307410_10054096
600 Ga0307406_10017391
601 Ga0307407_10419250
602 Ga0307412_10027464
603 Ga0307409_102578607
604 Ga0307416_100035335
605 Ga0307416_101092488
606 Ga0307414_10039293
607 Ga0307415_100009354
608 Ga0373923_0608046
609 Ga0373955_0539689
610 Ga0373931_0298820
611 Ga0395899_0472532
612 Ga0395900_0645537
613 Ga0395898_0258165
614 Ga0395905_0898242
615 Ga0242420_023627
616 Ga0439453_0039713
617 Ga0439443_004873
618 Ga0439446_0114055
619 Ga0439435_0007227
620 Ga0439444_0004100
621 Ga0439460_0010945
622 Ga0450916_041611
623 Ga0451577_0761322
624 Ga0453683_0642798
625 Ga0453683_0946849
626 Ga0451576_0052134
627 Ga0495582_0031405
628 Ga0495662_0004491
629 Ga0495628_0128828
630 Ga0495643_0000329
631 Ga0495652_0303012
632 Ga0495640_0061982
633 Ga0495634_0113075
634 Ga0495635_0090870
635 Ga0495658_0171125
636 Ga0495624_0089763
637 Ga0495600_0205014
638 Ga0495581_0605502
639 Ga0495674_0126005
640 Ga0501291_024053
641 Ga0501292_083124
642 Ga0501299_040145
643 Ga0501040_0578215
644 Ga0501042_0241982
645 Ga0501070_0260198
646 Ga0501071_0531626
647 Ga0501072_0234691
648 Ga0501075_0337264
649 Ga0501076_0808606
650 Ga0501077_0258193
651 Ga0501198_002842
652 Ga0501199_018574
653 Ga0501202_001349
654 Ga0501207_002238
655 Ga0501207_112374
656 Ga0501208_004347
657 Ga0501209_054133
658 Ga0501216_069098
659 Ga0501217_006256
660 Ga0501223_006042
661 Ga0501223_007879
662 Ga0501224_000844
663 Ga0501227_000637
664 Ga0501227_001547
665 Ga0501228_061856
666 Ga0501230_005015
667 Ga0501233_005034
668 Ga0501235_011858
669 Ga0501236_027958
670 Ga0501240_018350
671 Ga0501243_000449
672 Ga0501253_126989
673 Ga0501255_049591
674 Ga0501257_037927
675 Ga0501219_013767
676 Ga0501221_074688
677 Ga0501225_0002723
678 Ga0501225_0265528
679 Ga0501229_001551
680 Ga0501234_004351
681 Ga0501079_1182388
682 Ga0501232_030687
683 Ga0501262_030315
684 Ga0501270_127123
685 Ga0501276_037956
686 Ga0501212_084701
687 Ga0501226_000317
688 nmdc:mga05p37_344624_c1
689 nmdc:mga05p37_52817_c1
690 nmdc:mga05p37_610506_c1
691 nmdc:mga05p37_988621_c1
692 nmdc:mga09592_1055910_c1
693 nmdc:mga09592_172597_c1
694 nmdc:mga09592_1731354_c1
695 nmdc:mga09592_177608_c1
696 nmdc:mga09592_338276_c1
697 nmdc:mga09592_461226_c1
698 nmdc:mga0qj67_104781_c1
699 nmdc:mga0qj67_215332_c1
700 nmdc:mga0qj67_6751_c1
701 nmdc:mga06r32_137712_c1
702 nmdc:mga06r32_233618_c1
703 nmdc:mga06r32_45534_c1
704 nmdc:mga06r32_497341_c1
705 nmdc:mga08y16_176884_c1
706 nmdc:mga08y16_30513_c1
707 nmdc:mga08y16_666471_c1
708 nmdc:mga08y16_898684_c1
709 nmdc:mga0n895_130940_c1
710 nmdc:mga0a205_139712_c2
711 nmdc:mga0a205_465438_c1
712 Ga0495601_0263811
713 Ga0501084_0177903
714 Ga0501084_0238724
715 Ga0501084_1480562
716 Ga0501082_0833168
717 Ga0530510_0069945
718 Ga0530510_0346886
719 Ga0530510_0840201
720 Ga0530510_1085788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

19

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8914 2 117
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8591 2 119
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8426 2 117
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.7762 2 119
8avi-assembly1.cif.gz_B crystal structure of isdg from bacillus cereus in complex with heme 0.7354 1 119
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.886 2 119 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8652 2 119 3.30.70.100
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7362 2 119 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.718 1 119 3.30.70.100
af_P78833_2_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7174 2 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6N6ZDC4-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9789 2 119
AF-A0A6L4B2E0-F1-model_v4 DUF1428 domain-containing protein 0.9769 2 119
AF-A0A7M3MIR8-F1-model_v4 DUF1428 domain-containing protein 0.9763 2 119
AF-A0A6M4H6S5-F1-model_v4 DUF1428 domain-containing protein 0.9752 2 119
AF-A0A3D3LRA2-F1-model_v4 DUF1428 domain-containing protein 0.9725 2 119

Map