F421836

General Info

Members Datasets Scaffolds Average Seq Length
360 228 309 456

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10004493|Ga0075366_100044932
Length 475
Sequence MSDLPDLIYTMHIANSIFKAYDIRGIVPTTVDEAVAEGIGRAFGTIALAEGEKVIAVGRDGRLSGPSLVAALIRGLVAVGVEVIDVGAATTPMLYFAAYTLCRSGIQVTGSHNPKDYNGFKMIMGGRAIHGEEIQALRRMMEAETWVFQAGGSVRQVDVLPAYTARIVSDIQLARPMKIVVDSGNGIAGASAPAILRAIGCEVVELFSEVDGNFPNHHPDPSKPENLEDLIAALKTTGAELGLAFDGDGDRLGIVTQDGSNIYPDRQMQLFAEDVLRRVPGGTILFDVKCSQRLAPAIAAAGGHPLMFKTGHSLIKAKMKEIEAAGGQAPLGGEMSGHIFFKERWFGFDDGTYAGCRLLEILSQSPDANAVLHALPTSFSTPELNVPCHEGEPPRVVAEALRLVDFAAPAVVSTIDGLRVDWPDGFGLIRASNTTPVLVLRFEGHTQAALDRIQADVLALLRRVKPDASFAASAH

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2643221717 Acidovorax sp. Root267 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543012 Acidovorax sp. CF301 Isolate Unclassified
16 2738543013 Variovorax sp. BT01 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2816332133 Acidovorax radicis 2721A Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
30 2899924645 Variovorax sp. 369 Isolate Unclassified
31 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
32 2904456579 Variovorax sp. 2002 Isolate Unclassified
33 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
34 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
35 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
36 2928037797 Variovorax sp. 1126 Isolate Unclassified
37 2928044640 Variovorax sp. 1128 Isolate Unclassified
38 2928051484 Variovorax sp. 1133 Isolate Unclassified
39 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
40 2928070936 Variovorax gossypii 1167 Isolate Unclassified
41 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
42 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
43 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
46 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
47 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
53 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
65 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
70 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
72 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
143 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.56
Metatranscriptomes 0.28
Isolates 14.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.22
Nodule 1.11
Rhizoplane 1.67
Rhizosphere 43.89
Stem 0
Stem Tuber 0
Unclassified 16.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017437 3300001979 Bacteria 2569
2 JGI24740J21852_10025072 3300001979 Bacteria 2015
3 JGI25155J39150_1000005 3300002704 Bacteria 261712
4 JGI25156J39149_1000006 3300002705 Bacteria 261778
5 JGI25154J39366_1000015 3300002738 Bacteria 261778
6 JGI25157J39369_1000016 3300002741 Bacteria 192349
7 JGI25159J45721_1000168 3300002987 Bacteria 30418
8 JGI25151J46595_10007160 3300003187 Bacteria 5498
9 JGI25160J50197_1000045 3300003354 Bacteria 142992
10 JGI25161J50226_1000008 3300003374 Bacteria 239245
11 JGI25161J50226_1005090 3300003374 Bacteria 2623
12 Ga0006562J51391_1024682 3300003578 Bacteria 3851
13 Ga0055535_1000086 3300003761 Bacteria 104327
14 Ga0055542_1000009 3300003762 Bacteria 416550
15 Ga0055526_1004380 3300003771 Bacteria 8514
16 Ga0055526_1005341 3300003771 Bacteria 7421
17 Ga0055537_1000108 3300003773 Bacteria 62351
18 Ga0055537_1000327 3300003773 Bacteria 32446
19 Ga0055524_1000107 3300003775 Bacteria 100962
20 Ga0055536_1011493 3300003781 Bacteria 3388
21 Ga0055536_1014695 3300003781 Bacteria 2726
22 Ga0055534_1000109 3300003784 Bacteria 60884
23 Ga0055534_1000576 3300003784 Bacteria 19306
24 Ga0055534_1002310 3300003784 Bacteria 6691
25 Ga0055534_1008831 3300003784 Bacteria 2246
26 Ga0055528_1000173 3300003790 Bacteria 54563
27 Ga0055528_1003838 3300003790 Bacteria 7392
28 Ga0055530_10000121 3300003791 Bacteria 67516
29 Ga0055530_10000442 3300003791 Bacteria 36800
30 Ga0055540_1000021 3300003792 Bacteria 208733
31 Ga0055540_1002132 3300003792 Bacteria 10796
32 Ga0055540_1007496 3300003792 Bacteria 4102
33 Ga0055531_10000721 3300003794 Bacteria 28144
34 Ga0055531_10001849 3300003794 Bacteria 14930
35 Ga0055531_10002252 3300003794 Bacteria 13057
36 Ga0068868_100039460 3300005338 Bacteria 3669
37 Ga0070660_100073031 3300005339 Bacteria 2682
38 Ga0070659_100064807 3300005366 Bacteria 2893
39 Ga0070679_100106847 3300005530 Bacteria 2784
40 Ga0070664_100254967 3300005564 Bacteria 1578
41 Ga0068852_100066459 3300005616 Bacteria 3149
42 Ga0068851_10071753 3300005834 Bacteria 1792
43 Ga0068862_100066861 3300005844 Bacteria 3098
44 Ga0075365_10000944 3300006038 Bacteria 12321
45 Ga0075365_10003885 3300006038 Bacteria 7817
46 Ga0075365_10093838 3300006038 Bacteria 2048
47 Ga0075363_100008702 3300006048 Bacteria 4740
48 Ga0075363_100023070 3300006048 Bacteria 3150
49 Ga0075432_10023177 3300006058 Bacteria 2125
50 Ga0075367_10046391 3300006178 Bacteria 2553
51 Ga0075367_10056335 3300006178 Bacteria 2335
52 Ga0075367_10071336 3300006178 Bacteria 2089
53 Ga0075366_10004493 3300006195 Bacteria 7483
54 Ga0075366_10038917 3300006195 Bacteria 2809
55 Ga0075370_10000181 3300006353 Bacteria 21913
56 Ga0075370_10005819 3300006353 Bacteria 6160
57 Ga0075370_10012844 3300006353 Bacteria 4437
58 Ga0075430_100073133 3300006846 Bacteria 2875
59 Ga0075429_100160141 3300006880 Bacteria 1971
60 Ga0099826_10000884 3300006948 Bacteria 16415
61 Ga0105244_10002707 3300009036 Bacteria 13250
62 Ga0105243_10002087 3300009148 Bacteria 16920
63 Ga0105243_10133795 3300009148 Bacteria 2107
64 Ga0105242_10026726 3300009176 Bacteria 4576
65 Ga0105237_10027104 3300009545 Bacteria 5853
66 Ga0105239_10049735 3300010375 Bacteria 4597
67 Ga0105246_10016843 3300011119 Bacteria 4637
68 Ga0105246_10184666 3300011119 Bacteria 1609
69 Ga0157369_10004009 3300013105 Bacteria 17461
70 Ga0163162_10118541 3300013306 Bacteria 2749
71 Ga0182008_10000969 3300014497 Bacteria 19939
72 Ga0182008_10008009 3300014497 Bacteria 5790
73 Ga0182008_10011886 3300014497 Bacteria 4615
74 Ga0182008_10013597 3300014497 Bacteria 4279
75 Ga0157376_10005269 3300014969 Bacteria 9032
76 Ga0182007_10001982 3300015262 Bacteria 10562
77 Ga0183362_10001 3300015683 Bacteria 2046624
78 Ga0163161_10000656 3300017792 Bacteria 27654
79 Ga0163161_10028098 3300017792 Bacteria 3992
80 Ga0213872_10001043 3300021361 Bacteria 19304
81 Ga0209435_100010 3300025206 Bacteria 475373
82 Ga0209672_100432 3300025228 Bacteria 24158
83 Ga0209147_100736 3300025229 Bacteria 16240
84 Ga0209258_100009 3300025242 Bacteria 996276
85 Ga0209646_1000001 3300025246 Bacteria 3092932
86 Ga0209026_1000001 3300025250 Bacteria 1228671
87 Ga0209148_1000007 3300025254 Bacteria 1592273
88 Ga0209759_1000001 3300025256 Bacteria 2799452
89 Ga0209129_1000013 3300025258 Bacteria 524874
90 Ga0209129_1003361 3300025258 Bacteria 7036
91 Ga0209565_1000028 3300025263 Bacteria 348536
92 Ga0209565_1000138 3300025263 Bacteria 101729
93 Ga0209565_1000289 3300025263 Bacteria 48879
94 Ga0209565_1000556 3300025263 Bacteria 25784
95 Ga0209673_1000035 3300025273 Bacteria 328411
96 Ga0209673_1000064 3300025273 Bacteria 254712
97 Ga0209673_1000188 3300025273 Bacteria 124010
98 Ga0209673_1000260 3300025273 Bacteria 99762
99 Ga0209673_1002602 3300025273 Bacteria 12166
100 Ga0209673_1017844 3300025273 Bacteria 2603
101 Ga0209130_1000112 3300025284 Bacteria 131607
102 Ga0209130_1000186 3300025284 Bacteria 87096
103 Ga0209130_1000249 3300025284 Bacteria 68232
104 Ga0209130_1000405 3300025284 Bacteria 47098
105 Ga0209130_1007896 3300025284 Bacteria 3213
106 Ga0209675_1000036 3300025291 Bacteria 254712
107 Ga0209675_1000086 3300025291 Bacteria 151270
108 Ga0209675_1000153 3300025291 Bacteria 90298
109 Ga0209675_1000182 3300025291 Bacteria 70962
110 Ga0209675_1000714 3300025291 Bacteria 22673
111 Ga0209675_1003810 3300025291 Bacteria 6961
112 Ga0209676_1000004 3300025292 Bacteria 1138360
113 Ga0209676_1000069 3300025292 Bacteria 312462
114 Ga0209676_1000105 3300025292 Bacteria 224151
115 Ga0209676_1000287 3300025292 Bacteria 103263
116 Ga0209676_1008548 3300025292 Bacteria 4545
117 Ga0209676_1008713 3300025292 Bacteria 4477
118 Ga0209676_1013710 3300025292 Bacteria 3099
119 Ga0209025_1000168 3300025294 Bacteria 162386
120 Ga0209025_1000220 3300025294 Bacteria 136977
121 Ga0209025_1000381 3300025294 Bacteria 92162
122 Ga0209025_1006216 3300025294 Bacteria 9369
123 Ga0209564_1000214 3300025295 Bacteria 132937
124 Ga0209564_1000267 3300025295 Bacteria 109962
125 Ga0209564_1000583 3300025295 Bacteria 57799
126 Ga0209564_1001455 3300025295 Bacteria 24120
127 Ga0209564_1005702 3300025295 Bacteria 6978
128 Ga0209758_1000134 3300025297 Bacteria 178294
129 Ga0209758_1008634 3300025297 Bacteria 6542
130 Ga0209050_1000002 3300025298 Bacteria 1792849
131 Ga0209050_1000023 3300025298 Bacteria 537172
132 Ga0209050_1000405 3300025298 Bacteria 80464
133 Ga0209050_1002419 3300025298 Bacteria 16091
134 Ga0209256_1000003 3300025299 Bacteria 1661127
135 Ga0209256_1000060 3300025299 Bacteria 262342
136 Ga0209256_1000222 3300025299 Bacteria 105596
137 Ga0207426_1000095 3300025302 Bacteria 274234
138 Ga0207426_1000100 3300025302 Bacteria 262342
139 Ga0207426_1000153 3300025302 Bacteria 182839
140 Ga0207426_1010285 3300025302 Bacteria 3640
141 Ga0209051_1000002 3300025303 Bacteria 1631846
142 Ga0209051_1000017 3300025303 Bacteria 537172
143 Ga0209051_1000064 3300025303 Bacteria 231735
144 Ga0209051_1000136 3300025303 Bacteria 138015
145 Ga0209051_1000248 3300025303 Bacteria 91104
146 Ga0209051_1000281 3300025303 Bacteria 83196
147 Ga0209051_1018765 3300025303 Bacteria 3046
148 Ga0209257_1000002 3300025304 Bacteria 1767052
149 Ga0209257_1000039 3300025304 Bacteria 591694
150 Ga0209257_1000041 3300025304 Bacteria 537172
151 Ga0209257_1000055 3300025304 Bacteria 415534
152 Ga0209257_1000109 3300025304 Bacteria 239439
153 Ga0209257_1000689 3300025304 Bacteria 52385
154 Ga0209257_1000996 3300025304 Bacteria 38379
155 Ga0209257_1004364 3300025304 Bacteria 11009
156 Ga0209257_1015237 3300025304 Bacteria 3219
157 Ga0207656_10026416 3300025321 Bacteria 2367
158 Ga0207655_1012419 3300025728 Bacteria 4978
159 Ga0207657_10100105 3300025919 Bacteria 2407
160 Ga0207709_10000168 3300025935 Bacteria 88059
161 Ga0207709_10009876 3300025935 Bacteria 5255
162 Ga0207689_10055742 3300025942 Bacteria 3253
163 Ga0207667_10192015 3300025949 Bacteria 2095
164 Ga0207658_10019329 3300025986 Bacteria 4711
165 Ga0207677_10008818 3300026023 Bacteria 5650
166 Ga0207702_10258725 3300026078 Bacteria 1638
167 Ga0207648_10086817 3300026089 Bacteria 2730
168 Ga0207674_10284811 3300026116 Bacteria 1601
169 Ga0207683_10103311 3300026121 Bacteria 2545
170 Ga0207698_10046378 3300026142 Bacteria 3281
171 Ga0209282_1000207 3300027666 Bacteria 31448
172 Ga0265334_10020636 3300028573 Bacteria 2698
173 Ga0307515_10000215 3300028794 Bacteria 142594
174 Ga0307515_10000485 3300028794 Bacteria 94915
175 Ga0307515_10049144 3300028794 Bacteria 6357
176 Ga0307515_10134863 3300028794 Bacteria 2692
177 Ga0316179_1031346 3300030734 Bacteria 2147
178 Ga0316178_1161940 3300030735 Bacteria 5772
179 Ga0265330_10000054 3300031235 Bacteria 101420
180 Ga0265332_10000002 3300031238 Bacteria 709510
181 Ga0265332_10000020 3300031238 Bacteria 219119
182 Ga0265320_10033444 3300031240 Bacteria 2625
183 Ga0265325_10012329 3300031241 Bacteria 4890
184 Ga0265327_10001016 3300031251 Bacteria 39662
185 Ga0265327_10003763 3300031251 Bacteria 14080
186 Ga0307513_10000004 3300031456 Bacteria 558931
187 Ga0307513_10000015 3300031456 Bacteria 296183
188 Ga0307513_10033071 3300031456 Bacteria 5819
189 Ga0307408_100000159 3300031548 Bacteria 75375
190 Ga0307408_100002565 3300031548 Bacteria 12675
191 Ga0307408_100063677 3300031548 Bacteria 2698
192 Ga0307514_10000696 3300031649 Bacteria 58844
193 Ga0307514_10025678 3300031649 Bacteria 4766
194 Ga0265314_10000012 3300031711 Bacteria 415184
195 Ga0265314_10002176 3300031711 Bacteria 20515
196 Ga0265342_10039517 3300031712 Bacteria 2866
197 Ga0307516_10000293 3300031730 Bacteria 65013
198 Ga0307516_10023994 3300031730 Bacteria 6238
199 Ga0307516_10119753 3300031730 Bacteria 2425
200 Ga0307405_10019183 3300031731 Bacteria 3792
201 Ga0307405_10107487 3300031731 Bacteria 1883
202 Ga0307406_10000216 3300031901 Bacteria 34752
203 Ga0307406_10001087 3300031901 Bacteria 15133
204 Ga0307412_10192615 3300031911 Bacteria 1542
205 Ga0307409_100008410 3300031995 Bacteria 6260
206 Ga0307416_100026768 3300032002 Bacteria 4256
207 Ga0307416_100085533 3300032002 Bacteria 2684
208 Ga0307414_10009100 3300032004 Bacteria 5686
209 Ga0307411_10005278 3300032005 Bacteria 6326
210 Ga0307411_10015216 3300032005 Bacteria 4314
211 Ga0307415_100005080 3300032126 Bacteria 6931
212 Ga0373931_0047109 3300035691 Bacteria 2281
213 Ga0395899_0005850 3300037312 Bacteria 9545
214 Ga0395899_0064441 3300037312 Bacteria 2694
215 Ga0395900_0037771 3300037418 Bacteria 4978
216 Ga0395900_0193586 3300037418 Bacteria 2061
217 Ga0395900_0194742 3300037418 Bacteria 2054
218 Ga0395898_0010409 3300037466 Bacteria 9726
219 Ga0395898_0013369 3300037466 Bacteria 8455
220 Ga0395898_0023976 3300037466 Bacteria 6157
221 Ga0395898_0224826 3300037466 Bacteria 1790
222 Ga0395905_0000065 3300037471 Bacteria 184928
223 Ga0395905_0001233 3300037471 Bacteria 31772
224 Ga0395905_0016997 3300037471 Bacteria 6908
225 Ga0395905_0048926 3300037471 Bacteria 3961
226 Ga0395905_0082601 3300037471 Bacteria 3010
227 Ga0395905_0126174 3300037471 Bacteria 2406
228 Ga0395901_0031613 3300038443 Bacteria 5457
229 Ga0395901_0102663 3300038443 Bacteria 3001
230 Ga0395901_0110279 3300038443 Bacteria 2889
231 Ga0395901_0167054 3300038443 Bacteria 2309
232 Ga0395901_0197110 3300038443 Bacteria 2111
233 Ga0395901_0228931 3300038443 Bacteria 1941
234 Ga0436361_0621953 3300039447 Bacteria 22352
235 Ga0439436_0000086 3300041404 Bacteria 22153
236 Ga0439436_0004415 3300041404 Bacteria 4305
237 Ga0439466_0001893 3300041411 Bacteria 8195
238 Ga0439465_0002556 3300041413 Bacteria 5923
239 Ga0439431_0002545 3300041997 Bacteria 4026
240 Ga0439442_007423 3300042002 Bacteria 2203
241 Ga0439442_017479 3300042002 Bacteria 1480
242 Ga0439445_0000680 3300042004 Bacteria 7054
243 Ga0439432_010774 3300042006 Bacteria 3160
244 Ga0439449_0000300 3300042007 Bacteria 17778
245 Ga0439449_0000887 3300042007 Bacteria 11681
246 Ga0439449_0012534 3300042007 Bacteria 3188
247 Ga0439452_001585 3300042010 Bacteria 9010
248 Ga0439462_0002903 3300042015 Bacteria 4056
249 Ga0439462_0005012 3300042015 Bacteria 3249
250 Ga0439446_0008767 3300042156 Bacteria 2694
251 Ga0451577_0000825 3300042876 Bacteria 46324
252 Ga0451577_0003034 3300042876 Bacteria 19097
253 Ga0451577_0154577 3300042876 Bacteria 2064
254 Ga0451577_0197267 3300042876 Bacteria 1817
255 Ga0466969_0002162 3300044656 Bacteria 10495
256 Ga0453683_0003744 3300044673 Bacteria 11094
257 Ga0453684_0002253 3300044712 Bacteria 47789
258 Ga0451576_0002908 3300045051 Bacteria 24421
259 Ga0451576_0003754 3300045051 Bacteria 20503
260 Ga0451576_0004976 3300045051 Bacteria 16907
261 Ga0495638_0026714 3300046460 Bacteria 3741
262 Ga0495631_0000146 3300046518 Bacteria 48263
263 Ga0495642_0006273 3300046528 Bacteria 4564
264 Ga0495654_0021732 3300046530 Bacteria 3336
265 Ga0495621_0018152 3300046539 Bacteria 2281
266 Ga0495625_0000254 3300046660 Bacteria 83637
267 Ga0495676_0107767 3300047321 Bacteria 2050
268 Ga0495677_0009773 3300047445 Bacteria 3535
269 Ga0495614_0001449 3300048089 Bacteria 10252
270 Ga0495615_0000349 3300048090 Bacteria 7387
271 Ga0496100_0017085 3300048903 Bacteria 4276
272 Ga0496101_0007355 3300048904 Bacteria 7132
273 Ga0496109_0187905 3300048912 Bacteria 1941
274 Ga0496116_0035448 3300048919 Bacteria 3504
275 Ga0496117_0030826 3300048920 Bacteria 4105
276 Ga0496118_0009158 3300048921 Bacteria 10062
277 Ga0496118_0034612 3300048921 Bacteria 4116
278 Ga0496121_0001088 3300048924 Bacteria 48017
279 Ga0496121_0040014 3300048924 Bacteria 4119
280 Ga0496122_0000450 3300048925 Bacteria 85686
281 Ga0496123_0000176 3300048926 Bacteria 130010
282 Ga0496125_0010646 3300048928 Bacteria 9286
283 Ga0496125_0104614 3300048928 Bacteria 2072
284 Ga0501031_0000769 3300049568 Bacteria 19277
285 Ga0501047_0049846 3300049581 Bacteria 4043
286 Ga0501262_000227 3300049759 Bacteria 6889
287 Ga0501044_0065263 3300049823 Bacteria 3713
288 Ga0501044_0326038 3300049823 Bacteria 1459
289 nmdc:mga03n38_378_c1 3300050490 Bacteria 10928
290 nmdc:mga0yw44_47344_c1 3300050492 Bacteria 2588
291 nmdc:mga0k408_4343_c1 3300050493 Bacteria 7530
292 nmdc:mga0k408_8879_c1 3300050493 Bacteria 5406
293 nmdc:mga07m45_95_c1 3300050496 Bacteria 34317
294 Ga0500643_007203 3300053087 Bacteria 4539
295 Ga0500651_0000077 3300053093 Bacteria 62750
296 Ga0500571_000078 3300053110 Bacteria 30645
297 Ga0500593_000739 3300053117 Bacteria 12327
298 Ga0500594_0000357 3300053118 Bacteria 10197
299 Ga0500607_001060 3300053121 Bacteria 25894
300 Ga0500655_003821 3300053133 Bacteria 2717
301 Ga0500658_0000943 3300053134 Bacteria 11868
302 Ga0500658_0001129 3300053134 Bacteria 10916
303 Ga0500559_0001087 3300053136 Bacteria 16490
304 Ga0500573_0009245 3300053140 Bacteria 5461
305 Ga0500574_002478 3300053141 Bacteria 3049
306 Ga0500616_0028306 3300053153 Bacteria 3088
307 Ga0500634_0036810 3300053161 Bacteria 2664
308 Ga0500645_001146 3300053730 Bacteria 14361
309 Ga0590071_010935 3300059421 Bacteria 2122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0082601 Ga0395905_0082601_1853_2989 377
2 3300042002 Ga0439442_017479 Ga0439442_017479_330_1466 378
3 3300042876 Ga0451577_0154577 Ga0451577_0154577_896_2038 378
4 3300009176 Ga0105242_10026726 Ga0105242_100267263 399
5 3300049823 Ga0501044_0326038 Ga0501044_0326038_220_1434 403
6 3300021361 Ga0213872_10001043 Ga0213872_1000104315 428
7 3300039447 Ga0436361_0621953 Ga0436361_0621953_13059_14477 428
8 3300031731 Ga0307405_10019183 Ga0307405_100191833 431
9 3300031995 Ga0307409_100008410 Ga0307409_1000084105 431
10 3300032002 Ga0307416_100085533 Ga0307416_1000855332 431
11 3300032126 Ga0307415_100005080 Ga0307415_1000050803 431
12 3300003578 Ga0006562J51391_1024682 Ga0006562J51391_10246822 433
13 3300003792 Ga0055540_1002132 Ga0055540_100213212 433
14 3300003794 Ga0055531_10000721 Ga0055531_1000072118 433
15 3300014497 Ga0182008_10011886 Ga0182008_100118863 433
16 3300025303 Ga0209051_1000136 Ga0209051_100013699 433
17 3300025303 Ga0209051_1000248 Ga0209051_100024837 433
18 3300025304 Ga0209257_1000055 Ga0209257_1000055282 433
19 3300031649 Ga0307514_10025678 Ga0307514_100256784 433
20 3300031731 Ga0307405_10107487 Ga0307405_101074871 433
21 3300031901 Ga0307406_10001087 Ga0307406_1000108711 433
22 3300031911 Ga0307412_10192615 Ga0307412_101926151 433
23 3300042015 Ga0439462_0005012 Ga0439462_0005012_1394_2701 435
24 3300042876 Ga0451577_0000825 Ga0451577_0000825_12228_13616 435
25 3300044712 Ga0453684_0002253 Ga0453684_0002253_33940_35328 435
26 3300045051 Ga0451576_0004976 Ga0451576_0004976_12085_13473 435
27 3300042002 Ga0439442_007423 Ga0439442_007423_22_1404 437
28 3300015683 Ga0183362_10001 Ga0183362_10001450 438
29 3300031730 Ga0307516_10000293 Ga0307516_100002939 438
30 3300006038 Ga0075365_10003885 Ga0075365_100038852 441
31 3300006048 Ga0075363_100008702 Ga0075363_1000087023 441
32 3300006195 Ga0075366_10038917 Ga0075366_100389172 441
33 3300011119 Ga0105246_10184666 Ga0105246_101846661 441
34 3300017792 Ga0163161_10028098 Ga0163161_100280984 441
35 3300025273 Ga0209673_1002602 Ga0209673_10026022 441
36 3300025292 Ga0209676_1013710 Ga0209676_10137102 441
37 3300030734 Ga0316179_1031346 Ga0316179_10313462 441
38 3300030735 Ga0316178_1161940 Ga0316178_11619404 441
39 3300032004 Ga0307414_10009100 Ga0307414_100091003 441
40 3300032005 Ga0307411_10005278 Ga0307411_100052784 441
41 3300037466 Ga0395898_0010409 Ga0395898_0010409_178_1560 441
42 3300037471 Ga0395905_0126174 Ga0395905_0126174_844_2226 441
43 3300038443 Ga0395901_0197110 Ga0395901_0197110_314_1696 441
44 3300038443 Ga0395901_0228931 Ga0395901_0228931_369_1751 441
45 3300046660 Ga0495625_0000254 Ga0495625_0000254_27779_29170 441
46 3300049759 Ga0501262_000227 Ga0501262_000227_5330_6712 441
47 3300050490 nmdc:mga03n38_378_c1 nmdc:mga03n38_378_c1_2263_3645 441
48 3300050492 nmdc:mga0yw44_47344_c1 nmdc:mga0yw44_47344_c1_751_2133 441
49 3300050493 nmdc:mga0k408_8879_c1 nmdc:mga0k408_8879_c1_3320_4702 441
50 3300003773 Ga0055537_1000108 Ga0055537_100010818 442
51 3300003784 Ga0055534_1000109 Ga0055534_100010918 442
52 3300003790 Ga0055528_1000173 Ga0055528_100017318 442
53 3300006353 Ga0075370_10000181 Ga0075370_1000018118 442
54 3300006948 Ga0099826_10000884 Ga0099826_100008847 442
55 3300025263 Ga0209565_1000138 Ga0209565_100013866 442
56 3300025273 Ga0209673_1000064 Ga0209673_100006467 442
57 3300025291 Ga0209675_1000036 Ga0209675_100003667 442
58 3300027666 Ga0209282_1000207 Ga0209282_100020719 442
59 3300050496 nmdc:mga07m45_95_c1 nmdc:mga07m45_95_c1_17460_18842 442
60 3300031730 Ga0307516_10119753 Ga0307516_101197532 445
61 3300014497 Ga0182008_10008009 Ga0182008_100080092 452
62 3300015262 Ga0182007_10001982 Ga0182007_100019823 452
63 3300026121 Ga0207683_10103311 Ga0207683_101033112 452
64 3300031251 Ga0265327_10003763 Ga0265327_1000376314 456
65 iso_pu_bacteria 2511231002 2511243970 456
66 iso_pu_bacteria 2513020051 2513227242 456
67 iso_pu_bacteria 2547132374 2548497160 456
68 iso_pu_bacteria 2599185214 2599622616 456
69 iso_pu_bacteria 2599185226 2599671095 456
70 iso_pu_bacteria 2599185227 2599679868 456
71 iso_pu_bacteria 2599185229 2599691884 456
72 iso_pu_bacteria 2643221628 2644159964 456
73 iso_pu_bacteria 2643221658 2644324809 456
74 iso_pu_bacteria 2643221672 2644396679 456
75 iso_pu_bacteria 2643221683 2644467357 456
76 iso_pu_bacteria 2643221717 2644647482 456
77 iso_pu_bacteria 2738541277 2738718524 456
78 iso_pu_bacteria 2738541307 2738884643 456
79 iso_pu_bacteria 2738543012 2739242540 456
80 iso_pu_bacteria 2738543013 2739248504 456
81 iso_pu_bacteria 2738543019 2739280542 456
82 iso_pu_bacteria 2816332133 2816473139 456
83 iso_pu_bacteria 2818991446 2819600041 456
84 iso_pu_bacteria 2831265667 2831267082 456
85 iso_pu_bacteria 2838054893 2838056166 456
86 iso_pu_bacteria 2842677519 2842679145 456
87 iso_pu_bacteria 2842733646 2842734782 456
88 iso_pu_bacteria 2842747753 2842749054 456
89 iso_pu_bacteria 2881101125 2881105534 456
90 iso_pu_bacteria 2885192300 2885193431 456
91 iso_pu_bacteria 2885198086 2885204896 456
92 iso_pu_bacteria 2885211737 2885218417 456
93 iso_pu_bacteria 2894023352 2894025583 456
94 iso_pu_bacteria 2899924645 2899926012 456
95 iso_pu_bacteria 2904449895 2904452225 456
96 iso_pu_bacteria 2904456579 2904458631 456
97 iso_pu_bacteria 2904479285 2904480151 456
98 iso_pu_bacteria 2904541872 2904548584 456
99 iso_pu_bacteria 2919462493 2919466282 456
100 iso_pu_bacteria 2928037797 2928041592 456
101 iso_pu_bacteria 2928044640 2928049156 456
102 iso_pu_bacteria 2928051484 2928052236 456
103 iso_pu_bacteria 2928064002 2928065093 456
104 iso_pu_bacteria 2928070936 2928077502 456
105 iso_pu_bacteria 2928084124 2928087437 456
106 iso_pu_bacteria 2928115317 2928116173 456
107 iso_pu_bacteria 2929160207 2929164748 456
108 iso_pu_bacteria 2929520902 2929523234 456
109 iso_pu_bacteria 2939631187 2939632099 456
110 iso_pu_bacteria 2945909444 2945910639 456
111 iso_pu_bacteria 2945945610 2945946543 456
112 iso_pu_bacteria 2945972063 2945976270 456
113 iso_pu_bacteria 2945984333 2945987292 456
114 iso_pu_bacteria 2954767861 2954771312 456
115 3300037418 Ga0395900_0037771 Ga0395900_0037771_313_1716 457
116 3300038443 Ga0395901_0031613 Ga0395901_0031613_1529_2932 457
117 3300005844 Ga0068862_100066861 Ga0068862_1000668612 458
118 3300037471 Ga0395905_0048926 Ga0395905_0048926_184_1566 458
119 3300049823 Ga0501044_0065263 Ga0501044_0065263_1251_2627 458
120 3300059421 Ga0590071_010935 Ga0590071_010935_359_1747 458
121 3300001979 JGI24740J21852_10025072 JGI24740J21852_100250721 459
122 3300003792 Ga0055540_1007496 Ga0055540_10074962 459
123 3300003794 Ga0055531_10002252 Ga0055531_100022528 459
124 3300006038 Ga0075365_10093838 Ga0075365_100938382 459
125 3300006178 Ga0075367_10056335 Ga0075367_100563352 459
126 3300006846 Ga0075430_100073133 Ga0075430_1000731332 459
127 3300006880 Ga0075429_100160141 Ga0075429_1001601412 459
128 3300009036 Ga0105244_10002707 Ga0105244_100027075 459
129 3300025273 Ga0209673_1017844 Ga0209673_10178442 459
130 3300025303 Ga0209051_1000281 Ga0209051_100028142 459
131 3300025304 Ga0209257_1000039 Ga0209257_1000039140 459
132 3300026089 Ga0207648_10086817 Ga0207648_100868172 459
133 3300037312 Ga0395899_0005850 Ga0395899_0005850_6361_7743 459
134 3300037312 Ga0395899_0064441 Ga0395899_0064441_986_2368 459
135 3300037418 Ga0395900_0193586 Ga0395900_0193586_58_1581 459
136 3300037466 Ga0395898_0013369 Ga0395898_0013369_1509_2891 459
137 3300037466 Ga0395898_0023976 Ga0395898_0023976_1328_2710 459
138 3300038443 Ga0395901_0167054 Ga0395901_0167054_482_1864 459
139 3300045051 Ga0451576_0003754 Ga0451576_0003754_7799_9247 459
140 3300001979 JGI24740J21852_10017437 JGI24740J21852_100174372 460
141 3300002704 JGI25155J39150_1000005 JGI25155J39150_1000005143 460
142 3300002705 JGI25156J39149_1000006 JGI25156J39149_1000006143 460
143 3300002738 JGI25154J39366_1000015 JGI25154J39366_1000015103 460
144 3300002741 JGI25157J39369_1000016 JGI25157J39369_100001637 460
145 3300002987 JGI25159J45721_1000168 JGI25159J45721_100016821 460
146 3300003187 JGI25151J46595_10007160 JGI25151J46595_100071605 460
147 3300003354 JGI25160J50197_1000045 JGI25160J50197_100004524 460
148 3300003374 JGI25161J50226_1000008 JGI25161J50226_1000008196 460
149 3300003374 JGI25161J50226_1005090 JGI25161J50226_10050902 460
150 3300003761 Ga0055535_1000086 Ga0055535_10000865 460
151 3300003762 Ga0055542_1000009 Ga0055542_1000009343 460
152 3300003771 Ga0055526_1004380 Ga0055526_10043808 460
153 3300003771 Ga0055526_1005341 Ga0055526_10053417 460
154 3300003773 Ga0055537_1000327 Ga0055537_100032725 460
155 3300003775 Ga0055524_1000107 Ga0055524_100010752 460
156 3300003781 Ga0055536_1011493 Ga0055536_10114931 460
157 3300003781 Ga0055536_1014695 Ga0055536_10146952 460
158 3300003784 Ga0055534_1000576 Ga0055534_100057611 460
159 3300003784 Ga0055534_1002310 Ga0055534_10023106 460
160 3300003784 Ga0055534_1008831 Ga0055534_10088312 460
161 3300003790 Ga0055528_1003838 Ga0055528_10038383 460
162 3300003791 Ga0055530_10000121 Ga0055530_1000012110 460
163 3300003791 Ga0055530_10000442 Ga0055530_1000044218 460
164 3300003792 Ga0055540_1000021 Ga0055540_1000021154 460
165 3300003794 Ga0055531_10001849 Ga0055531_100018492 460
166 3300005338 Ga0068868_100039460 Ga0068868_1000394602 460
167 3300005339 Ga0070660_100073031 Ga0070660_1000730311 460
168 3300005366 Ga0070659_100064807 Ga0070659_1000648072 460
169 3300005530 Ga0070679_100106847 Ga0070679_1001068472 460
170 3300005564 Ga0070664_100254967 Ga0070664_1002549671 460
171 3300005616 Ga0068852_100066459 Ga0068852_1000664592 460
172 3300005834 Ga0068851_10071753 Ga0068851_100717532 460
173 3300006038 Ga0075365_10000944 Ga0075365_100009445 460
174 3300006048 Ga0075363_100023070 Ga0075363_1000230702 460
175 3300006058 Ga0075432_10023177 Ga0075432_100231772 460
176 3300006178 Ga0075367_10046391 Ga0075367_100463912 460
177 3300006178 Ga0075367_10071336 Ga0075367_100713362 460
178 3300006195 Ga0075366_10004493 Ga0075366_100044932 460
179 3300006353 Ga0075370_10005819 Ga0075370_100058195 460
180 3300006353 Ga0075370_10012844 Ga0075370_100128444 460
181 3300009148 Ga0105243_10002087 Ga0105243_100020877 460
182 3300009148 Ga0105243_10133795 Ga0105243_101337952 460
183 3300009545 Ga0105237_10027104 Ga0105237_100271042 460
184 3300010375 Ga0105239_10049735 Ga0105239_100497353 460
185 3300011119 Ga0105246_10016843 Ga0105246_100168432 460
186 3300013105 Ga0157369_10004009 Ga0157369_100040098 460
187 3300013306 Ga0163162_10118541 Ga0163162_101185412 460
188 3300014497 Ga0182008_10000969 Ga0182008_1000096915 460
189 3300014497 Ga0182008_10013597 Ga0182008_100135972 460
190 3300014969 Ga0157376_10005269 Ga0157376_100052693 460
191 3300017792 Ga0163161_10000656 Ga0163161_100006563 460
192 3300025206 Ga0209435_100010 Ga0209435_100010154 460
193 3300025228 Ga0209672_100432 Ga0209672_1004328 460
194 3300025229 Ga0209147_100736 Ga0209147_1007362 460
195 3300025242 Ga0209258_100009 Ga0209258_100009311 460
196 3300025246 Ga0209646_1000001 Ga0209646_10000011988 460
197 3300025250 Ga0209026_1000001 Ga0209026_1000001643 460
198 3300025254 Ga0209148_1000007 Ga0209148_1000007311 460
199 3300025256 Ga0209759_1000001 Ga0209759_10000011619 460
200 3300025258 Ga0209129_1000013 Ga0209129_1000013328 460
201 3300025258 Ga0209129_1003361 Ga0209129_10033613 460
202 3300025263 Ga0209565_1000028 Ga0209565_1000028317 460
203 3300025263 Ga0209565_1000289 Ga0209565_100028938 460
204 3300025263 Ga0209565_1000556 Ga0209565_100055620 460
205 3300025273 Ga0209673_1000035 Ga0209673_100003518 460
206 3300025273 Ga0209673_1000188 Ga0209673_100018843 460
207 3300025273 Ga0209673_1000260 Ga0209673_100026048 460
208 3300025284 Ga0209130_1000112 Ga0209130_100011212 460
209 3300025284 Ga0209130_1000186 Ga0209130_100018649 460
210 3300025284 Ga0209130_1000249 Ga0209130_100024937 460
211 3300025284 Ga0209130_1000405 Ga0209130_100040535 460
212 3300025284 Ga0209130_1007896 Ga0209130_10078962 460
213 3300025291 Ga0209675_1000086 Ga0209675_100008664 460
214 3300025291 Ga0209675_1000153 Ga0209675_100015327 460
215 3300025291 Ga0209675_1000182 Ga0209675_100018235 460
216 3300025291 Ga0209675_1000714 Ga0209675_100071425 460
217 3300025291 Ga0209675_1003810 Ga0209675_10038106 460
218 3300025292 Ga0209676_1000004 Ga0209676_1000004190 460
219 3300025292 Ga0209676_1000069 Ga0209676_1000069143 460
220 3300025292 Ga0209676_1000105 Ga0209676_100010533 460
221 3300025292 Ga0209676_1000287 Ga0209676_100028730 460
222 3300025292 Ga0209676_1008548 Ga0209676_10085482 460
223 3300025292 Ga0209676_1008713 Ga0209676_10087133 460
224 3300025294 Ga0209025_1000168 Ga0209025_1000168111 460
225 3300025294 Ga0209025_1000220 Ga0209025_100022079 460
226 3300025294 Ga0209025_1000381 Ga0209025_100038166 460
227 3300025294 Ga0209025_1006216 Ga0209025_10062168 460
228 3300025295 Ga0209564_1000214 Ga0209564_1000214105 460
229 3300025295 Ga0209564_1000267 Ga0209564_100026780 460
230 3300025295 Ga0209564_1000583 Ga0209564_100058341 460
231 3300025295 Ga0209564_1001455 Ga0209564_100145522 460
232 3300025295 Ga0209564_1005702 Ga0209564_10057026 460
233 3300025297 Ga0209758_1000134 Ga0209758_100013438 460
234 3300025297 Ga0209758_1008634 Ga0209758_10086342 460
235 3300025298 Ga0209050_1000002 Ga0209050_1000002700 460
236 3300025298 Ga0209050_1000023 Ga0209050_1000023318 460
237 3300025298 Ga0209050_1000405 Ga0209050_100040533 460
238 3300025298 Ga0209050_1002419 Ga0209050_10024195 460
239 3300025299 Ga0209256_1000003 Ga0209256_10000031035 460
240 3300025299 Ga0209256_1000060 Ga0209256_1000060105 460
241 3300025299 Ga0209256_1000222 Ga0209256_100022252 460
242 3300025302 Ga0207426_1000095 Ga0207426_100009535 460
243 3300025302 Ga0207426_1000100 Ga0207426_1000100105 460
244 3300025302 Ga0207426_1000153 Ga0207426_1000153147 460
245 3300025302 Ga0207426_1010285 Ga0207426_10102852 460
246 3300025303 Ga0209051_1000002 Ga0209051_1000002468 460
247 3300025303 Ga0209051_1000017 Ga0209051_1000017318 460
248 3300025303 Ga0209051_1000064 Ga0209051_1000064188 460
249 3300025303 Ga0209051_1018765 Ga0209051_10187652 460
250 3300025304 Ga0209257_1000002 Ga0209257_1000002609 460
251 3300025304 Ga0209257_1000041 Ga0209257_1000041318 460
252 3300025304 Ga0209257_1000109 Ga0209257_1000109188 460
253 3300025304 Ga0209257_1000689 Ga0209257_10006893 460
254 3300025304 Ga0209257_1000996 Ga0209257_10009965 460
255 3300025304 Ga0209257_1004364 Ga0209257_10043643 460
256 3300025304 Ga0209257_1015237 Ga0209257_10152372 460
257 3300025321 Ga0207656_10026416 Ga0207656_100264162 460
258 3300025728 Ga0207655_1012419 Ga0207655_10124192 460
259 3300025919 Ga0207657_10100105 Ga0207657_101001051 460
260 3300025935 Ga0207709_10000168 Ga0207709_1000016846 460
261 3300025935 Ga0207709_10009876 Ga0207709_100098762 460
262 3300025942 Ga0207689_10055742 Ga0207689_100557422 460
263 3300025949 Ga0207667_10192015 Ga0207667_101920152 460
264 3300025986 Ga0207658_10019329 Ga0207658_100193294 460
265 3300026023 Ga0207677_10008818 Ga0207677_100088185 460
266 3300026078 Ga0207702_10258725 Ga0207702_102587252 460
267 3300026116 Ga0207674_10284811 Ga0207674_102848112 460
268 3300026142 Ga0207698_10046378 Ga0207698_100463782 460
269 3300028573 Ga0265334_10020636 Ga0265334_100206361 460
270 3300028794 Ga0307515_10000215 Ga0307515_1000021562 460
271 3300028794 Ga0307515_10000485 Ga0307515_1000048532 460
272 3300028794 Ga0307515_10049144 Ga0307515_100491444 460
273 3300028794 Ga0307515_10134863 Ga0307515_101348632 460
274 3300031235 Ga0265330_10000054 Ga0265330_1000005446 460
275 3300031238 Ga0265332_10000002 Ga0265332_10000002240 460
276 3300031238 Ga0265332_10000020 Ga0265332_1000002094 460
277 3300031240 Ga0265320_10033444 Ga0265320_100334441 460
278 3300031241 Ga0265325_10012329 Ga0265325_100123292 460
279 3300031251 Ga0265327_10001016 Ga0265327_1000101613 460
280 3300031456 Ga0307513_10000004 Ga0307513_10000004181 460
281 3300031456 Ga0307513_10000015 Ga0307513_10000015133 460
282 3300031456 Ga0307513_10033071 Ga0307513_100330714 460
283 3300031548 Ga0307408_100000159 Ga0307408_10000015942 460
284 3300031548 Ga0307408_100002565 Ga0307408_10000256510 460
285 3300031548 Ga0307408_100063677 Ga0307408_1000636772 460
286 3300031649 Ga0307514_10000696 Ga0307514_1000069637 460
287 3300031711 Ga0265314_10000012 Ga0265314_10000012145 460
288 3300031711 Ga0265314_10002176 Ga0265314_1000217619 460
289 3300031712 Ga0265342_10039517 Ga0265342_100395171 460
290 3300031730 Ga0307516_10023994 Ga0307516_100239946 460
291 3300031901 Ga0307406_10000216 Ga0307406_1000021620 460
292 3300032002 Ga0307416_100026768 Ga0307416_1000267683 460
293 3300032005 Ga0307411_10015216 Ga0307411_100152163 460
294 3300035691 Ga0373931_0047109 Ga0373931_0047109_202_1629 460
295 3300037418 Ga0395900_0194742 Ga0395900_0194742_479_1861 460
296 3300037466 Ga0395898_0224826 Ga0395898_0224826_368_1750 460
297 3300037471 Ga0395905_0000065 Ga0395905_0000065_154325_155710 460
298 3300037471 Ga0395905_0001233 Ga0395905_0001233_1180_2568 460
299 3300037471 Ga0395905_0016997 Ga0395905_0016997_5510_6895 460
300 3300038443 Ga0395901_0102663 Ga0395901_0102663_1306_2691 460
301 3300038443 Ga0395901_0110279 Ga0395901_0110279_1013_2395 460
302 3300041404 Ga0439436_0000086 Ga0439436_0000086_142_1524 460
303 3300041404 Ga0439436_0004415 Ga0439436_0004415_1753_3135 460
304 3300041411 Ga0439466_0001893 Ga0439466_0001893_2944_4326 460
305 3300041413 Ga0439465_0002556 Ga0439465_0002556_4446_5828 460
306 3300041997 Ga0439431_0002545 Ga0439431_0002545_268_1650 460
307 3300042004 Ga0439445_0000680 Ga0439445_0000680_4452_5834 460
308 3300042006 Ga0439432_010774 Ga0439432_010774_102_1484 460
309 3300042007 Ga0439449_0000300 Ga0439449_0000300_16208_17590 460
310 3300042007 Ga0439449_0000887 Ga0439449_0000887_10178_11563 460
311 3300042007 Ga0439449_0012534 Ga0439449_0012534_1561_2943 460
312 3300042010 Ga0439452_001585 Ga0439452_001585_4436_5818 460
313 3300042015 Ga0439462_0002903 Ga0439462_0002903_111_1496 460
314 3300042156 Ga0439446_0008767 Ga0439446_0008767_188_1570 460
315 3300042876 Ga0451577_0003034 Ga0451577_0003034_17693_19075 460
316 3300042876 Ga0451577_0197267 Ga0451577_0197267_277_1665 460
317 3300044656 Ga0466969_0002162 Ga0466969_0002162_4771_6156 460
318 3300044673 Ga0453683_0003744 Ga0453683_0003744_868_2250 460
319 3300045051 Ga0451576_0002908 Ga0451576_0002908_22139_23521 460
320 3300046460 Ga0495638_0026714 Ga0495638_0026714_96_1478 460
321 3300046518 Ga0495631_0000146 Ga0495631_0000146_42155_43537 460
322 3300046528 Ga0495642_0006273 Ga0495642_0006273_2854_4236 460
323 3300046530 Ga0495654_0021732 Ga0495654_0021732_242_1624 460
324 3300046539 Ga0495621_0018152 Ga0495621_0018152_42_1463 460
325 3300047321 Ga0495676_0107767 Ga0495676_0107767_321_1703 460
326 3300047445 Ga0495677_0009773 Ga0495677_0009773_197_1579 460
327 3300048089 Ga0495614_0001449 Ga0495614_0001449_7979_9361 460
328 3300048090 Ga0495615_0000349 Ga0495615_0000349_3581_4963 460
329 3300048903 Ga0496100_0017085 Ga0496100_0017085_2103_3485 460
330 3300048904 Ga0496101_0007355 Ga0496101_0007355_1185_2567 460
331 3300048912 Ga0496109_0187905 Ga0496109_0187905_439_1860 460
332 3300048919 Ga0496116_0035448 Ga0496116_0035448_974_2356 460
333 3300048920 Ga0496117_0030826 Ga0496117_0030826_43_1425 460
334 3300048921 Ga0496118_0009158 Ga0496118_0009158_4339_5721 460
335 3300048921 Ga0496118_0034612 Ga0496118_0034612_825_2207 460
336 3300048924 Ga0496121_0001088 Ga0496121_0001088_7739_9136 460
337 3300048924 Ga0496121_0040014 Ga0496121_0040014_2007_3389 460
338 3300048925 Ga0496122_0000450 Ga0496122_0000450_39651_41033 460
339 3300048926 Ga0496123_0000176 Ga0496123_0000176_73273_74655 460
340 3300048928 Ga0496125_0010646 Ga0496125_0010646_2633_4030 460
341 3300048928 Ga0496125_0104614 Ga0496125_0104614_339_1721 460
342 3300049568 Ga0501031_0000769 Ga0501031_0000769_13110_14516 460
343 3300049581 Ga0501047_0049846 Ga0501047_0049846_1230_2615 460
344 3300050493 nmdc:mga0k408_4343_c1 nmdc:mga0k408_4343_c1_1075_2502 460
345 3300053087 Ga0500643_007203 Ga0500643_007203_427_1809 460
346 3300053093 Ga0500651_0000077 Ga0500651_0000077_41893_43275 460
347 3300053110 Ga0500571_000078 Ga0500571_000078_10669_12051 460
348 3300053117 Ga0500593_000739 Ga0500593_000739_59_1444 460
349 3300053118 Ga0500594_0000357 Ga0500594_0000357_838_2220 460
350 3300053121 Ga0500607_001060 Ga0500607_001060_9185_10567 460
351 3300053133 Ga0500655_003821 Ga0500655_003821_757_2139 460
352 3300053134 Ga0500658_0000943 Ga0500658_0000943_4070_5452 460
353 3300053134 Ga0500658_0001129 Ga0500658_0001129_5525_6907 460
354 3300053136 Ga0500559_0001087 Ga0500559_0001087_13820_15202 460
355 3300053140 Ga0500573_0009245 Ga0500573_0009245_2603_3985 460
356 3300053141 Ga0500574_002478 Ga0500574_002478_728_2110 460
357 3300053153 Ga0500616_0028306 Ga0500616_0028306_1447_2829 460
358 3300053161 Ga0500634_0036810 Ga0500634_0036810_140_1522 460
359 3300053730 Ga0500645_001146 Ga0500645_001146_6626_8011 460
360 iso_pu_bacteria 2932422444 2932426178 460

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

15

148

0.96

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

161

259

0.95

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

263

379

0.87

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

383

460

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fkm-assembly1.cif.gz_X pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound 0.9687 4 454
1p5g-assembly1.cif.gz_X enzyme-ligand complex of p. aeruginosa pmm/pgm 0.9682 3 454
2fkm-assembly1.cif.gz_X pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound 0.9603 4 454
1p5g-assembly1.cif.gz_X enzyme-ligand complex of p. aeruginosa pmm/pgm 0.9599 3 454
4il8-assembly1.cif.gz_A crystal structure of an h329a mutant of p. aeruginosa pmm/pgm 0.95 1 454
ID Description Score Start End Superfamily
1k35A01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9711 3 148 3.40.120.10
1k35A01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9645 3 148 3.40.120.10
af_O86374_10_144_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9503 7 137 3.40.120.10
3uw2A02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9424 169 245 3.40.120.10
3rsmA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9421 21 148 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A4Q5UNU9-F1-model_v4 deleted 1.001 1 156
AF-A0A4Q5UNU9-F1-model_v4 deleted 0.9883 1 156
AF-F3CEA9-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.988 1 109 GO:0000287
GO:0005975
GO:0016868
AF-A0A357HDU5-F1-model_v4 Phosphomannomutase/phosphoglucomutase 0.985 1 124 GO:0000287
GO:0005975
GO:0016868
AF-A0A800LRG5-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9801 3 270 GO:0000287
GO:0005975
GO:0016868

Feature Viewer

pLDDT pTM Quality
92.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map