F421627

General Info

Members Datasets Scaffolds Average Seq Length
359 196 353 194

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0103602|Ga0495629_0103602_1106_1792
Length 228
Sequence VTLPRLPGWLRRRSAPAGAPIQENDDMTGSTGSTSDVWLVVGLGNPGPSYAGHRHNVGYLVADVLAERMGSDFRAHKSGRAAVVEGRVTPPGVVGPRVVLARPRSYMNETGGPVKQLAAFYKVPHERIVVVHDELDLPFDTMRVKLGGGDNGHNGLRSVRQALGTGDFYRVRVGIGRPRGRQDVADFVLSDYSAGERRMLPLQVATAADAVESLLTEGLDRTQSRFNS

Samples

Sample ID Description Type Environment
1 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
2 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
3 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
4 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
5 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 2.23
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.75
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10055345 3300005327 Bacteria 3223
2 Ga0070658_10159697 3300005327 Bacteria 1891
3 Ga0070658_10207971 3300005327 Bacteria 1652
4 Ga0070683_100106926 3300005329 Bacteria 2638
5 Ga0070683_100330971 3300005329 Bacteria 1450
6 Ga0070683_100341351 3300005329 Bacteria 1426
7 Ga0070683_100414864 3300005329 Bacteria 1284
8 Ga0070683_100666932 3300005329 Bacteria 996
9 Ga0070690_100028652 3300005330 Bacteria 3450
10 Ga0068869_100146785 3300005334 Bacteria 1826
11 Ga0070666_10155150 3300005335 Bacteria 1599
12 Ga0070680_100001726 3300005336 Bacteria 16048
13 Ga0070680_100218819 3300005336 Bacteria 1607
14 Ga0070680_100270713 3300005336 Bacteria 1438
15 Ga0070680_100314551 3300005336 Bacteria 1329
16 Ga0070680_100392588 3300005336 Bacteria 1182
17 Ga0070682_100838122 3300005337 Bacteria 750
18 Ga0070660_100022174 3300005339 Bacteria 4693
19 Ga0070660_100233470 3300005339 Bacteria 1497
20 Ga0070660_100239452 3300005339 Bacteria 1478
21 Ga0070660_100485638 3300005339 Bacteria 1027
22 Ga0070660_100566953 3300005339 Bacteria 948
23 Ga0070687_100152294 3300005343 Bacteria 1358
24 Ga0070661_100480239 3300005344 Bacteria 992
25 Ga0070668_100617203 3300005347 Bacteria 950
26 Ga0070675_100779829 3300005354 Bacteria 873
27 Ga0070671_100004596 3300005355 Bacteria 10940
28 Ga0070674_101105372 3300005356 Bacteria 700
29 Ga0070659_100001340 3300005366 Bacteria 17722
30 Ga0070659_100023145 3300005366 Bacteria 4750
31 Ga0070659_100349818 3300005366 Bacteria 1239
32 Ga0070667_100118668 3300005367 Bacteria 2299
33 Ga0070709_10173044 3300005434 Bacteria 1510
34 Ga0070713_100049638 3300005436 Bacteria 3463
35 Ga0070705_100261041 3300005440 Bacteria 1221
36 Ga0070700_100000021 3300005441 Bacteria 130127
37 Ga0070700_100633708 3300005441 Bacteria 842
38 Ga0070663_100040703 3300005455 Bacteria 3255
39 Ga0070678_100120864 3300005456 Bacteria 2065
40 Ga0070681_10003785 3300005458 Bacteria 14216
41 Ga0070681_10004181 3300005458 Bacteria 13668
42 Ga0070681_10022088 3300005458 Bacteria 6386
43 Ga0070681_10449901 3300005458 Bacteria 1200
44 Ga0070681_10527782 3300005458 Bacteria 1094
45 Ga0070679_100000128 3300005530 Bacteria 60863
46 Ga0070679_100002298 3300005530 Bacteria 17283
47 Ga0070679_100011389 3300005530 Bacteria 8474
48 Ga0070679_100317604 3300005530 Bacteria 1507
49 Ga0070679_100412430 3300005530 Bacteria 1296
50 Ga0070679_100739027 3300005530 Bacteria 927
51 Ga0070684_100262900 3300005535 Bacteria 1579
52 Ga0070684_100785001 3300005535 Bacteria 890
53 Ga0068853_100166981 3300005539 Bacteria 1989
54 Ga0070665_100001490 3300005548 Bacteria 27321
55 Ga0068855_100618795 3300005563 Bacteria 1166
56 Ga0068855_100942143 3300005563 Bacteria 910
57 Ga0068855_101050446 3300005563 Bacteria 854
58 Ga0068852_101450171 3300005616 Bacteria 709
59 Ga0068859_100617693 3300005617 Bacteria 1177
60 Ga0068864_100511945 3300005618 Bacteria 1156
61 Ga0068866_10191254 3300005718 Bacteria 1216
62 Ga0068851_10074902 3300005834 Bacteria 1758
63 Ga0068870_10239699 3300005840 Bacteria 1119
64 Ga0068863_100001613 3300005841 Bacteria 22293
65 Ga0068863_100007236 3300005841 Bacteria 10879
66 Ga0068863_100020259 3300005841 Bacteria 6361
67 Ga0068858_100128762 3300005842 Bacteria 2372
68 Ga0068860_100000195 3300005843 Bacteria 97163
69 Ga0081455_10003959 3300005937 Bacteria 16820
70 Ga0081455_10004443 3300005937 Bacteria 15732
71 Ga0081455_10037340 3300005937 Bacteria 4316
72 Ga0081455_10059691 3300005937 Bacteria 3219
73 Ga0070717_10067485 3300006028 Bacteria 2976
74 Ga0070716_100029457 3300006173 Bacteria 2968
75 Ga0097621_101053261 3300006237 Bacteria 762
76 Ga0075428_100000631 3300006844 Bacteria 36078
77 Ga0075430_100473990 3300006846 Bacteria 1033
78 Ga0075431_100000069 3300006847 Bacteria 59736
79 Ga0075433_10020028 3300006852 Bacteria 5587
80 Ga0075429_100246547 3300006880 Bacteria 1564
81 Ga0097620_100617650 3300006931 Bacteria 1177
82 Ga0075435_100008153 3300007076 Bacteria 7502
83 Ga0105240_10397625 3300009093 Bacteria 1553
84 Ga0105240_10425772 3300009093 Bacteria 1490
85 Ga0105245_10005593 3300009098 Bacteria 11040
86 Ga0105245_10019677 3300009098 Bacteria 5916
87 Ga0105247_10107819 3300009101 Bacteria 1789
88 Ga0105247_10201308 3300009101 Bacteria 1338
89 Ga0105243_10006420 3300009148 Bacteria 9088
90 Ga0105241_10209602 3300009174 Bacteria 1632
91 Ga0105242_10343434 3300009176 Bacteria 1376
92 Ga0105248_10272627 3300009177 Bacteria 1905
93 Ga0105237_10017439 3300009545 Bacteria 7443
94 Ga0105237_10085832 3300009545 Bacteria 3137
95 Ga0105237_10324807 3300009545 Bacteria 1542
96 Ga0105238_10061475 3300009551 Bacteria 3759
97 Ga0105238_10205943 3300009551 Bacteria 1943
98 Ga0105249_10007621 3300009553 Bacteria 9443
99 Ga0105249_10677807 3300009553 Bacteria 1090
100 Ga0105246_10009256 3300011119 Bacteria 6068
101 Ga0157371_10084184 3300013102 Bacteria 2252
102 Ga0157371_10941969 3300013102 Bacteria 656
103 Ga0157370_10026852 3300013104 Bacteria 5679
104 Ga0157370_10725106 3300013104 Bacteria 906
105 Ga0157369_10028377 3300013105 Bacteria 6194
106 Ga0157369_10032469 3300013105 Bacteria 5741
107 Ga0157369_10057105 3300013105 Bacteria 4212
108 Ga0157369_10123892 3300013105 Bacteria 2741
109 Ga0157369_10237859 3300013105 Bacteria 1902
110 Ga0157369_10257231 3300013105 Bacteria 1821
111 Ga0163162_10010160 3300013306 Bacteria 9144
112 Ga0163162_10169816 3300013306 Bacteria 2306
113 Ga0157372_10037238 3300013307 Bacteria 5364
114 Ga0157372_11003878 3300013307 Bacteria 967
115 Ga0157372_11482152 3300013307 Bacteria 782
116 Ga0157375_10000958 3300013308 Bacteria 24975
117 Ga0157375_10339586 3300013308 Bacteria 1667
118 Ga0163163_10133565 3300014325 Bacteria 2522
119 Ga0157380_10145822 3300014326 Bacteria 2040
120 Ga0157380_10939116 3300014326 Bacteria 894
121 Ga0157379_10018519 3300014968 Bacteria 6143
122 Ga0157379_10036370 3300014968 Bacteria 4391
123 Ga0157379_10200234 3300014968 Bacteria 1806
124 Ga0157376_10108525 3300014969 Bacteria 2438
125 Ga0157376_10143382 3300014969 Bacteria 2146
126 Ga0163161_10007157 3300017792 Bacteria 7714
127 Ga0206354_10521760 3300020081 Bacteria 1578
128 Ga0206353_10971152 3300020082 Bacteria 1684
129 Ga0206353_11016463 3300020082 Bacteria 2490
130 Ga0206353_11198684 3300020082 Bacteria 6998
131 Ga0206353_11260483 3300020082 Bacteria 768
132 Ga0206353_11569373 3300020082 Bacteria 1072
133 Ga0206353_11922679 3300020082 Bacteria 2280
134 Ga0224712_10051659 3300022467 Bacteria 1602
135 Ga0207642_10057002 3300025899 Bacteria 1795
136 Ga0207710_10002313 3300025900 Bacteria 8902
137 Ga0207710_10194203 3300025900 Bacteria 1000
138 Ga0207710_10255763 3300025900 Bacteria 877
139 Ga0207699_10201713 3300025906 Bacteria 1348
140 Ga0207705_10000417 3300025909 Bacteria 37398
141 Ga0207705_10131596 3300025909 Bacteria 1862
142 Ga0207707_10000199 3300025912 Bacteria 63720
143 Ga0207707_10023815 3300025912 Bacteria 5354
144 Ga0207707_10030550 3300025912 Bacteria 4714
145 Ga0207671_10014977 3300025914 Bacteria 6094
146 Ga0207693_10002732 3300025915 Bacteria 15275
147 Ga0207660_10001441 3300025917 Bacteria 15957
148 Ga0207660_10153857 3300025917 Bacteria 1769
149 Ga0207660_10386105 3300025917 Bacteria 1126
150 Ga0207660_10649756 3300025917 Bacteria 860
151 Ga0207662_10068731 3300025918 Bacteria 2140
152 Ga0207657_10029411 3300025919 Bacteria 5001
153 Ga0207657_10071855 3300025919 Bacteria 2929
154 Ga0207657_10085052 3300025919 Bacteria 2650
155 Ga0207657_10244744 3300025919 Bacteria 1431
156 Ga0207657_10248326 3300025919 Bacteria 1419
157 Ga0207652_10000199 3300025921 Bacteria 63364
158 Ga0207652_10004586 3300025921 Bacteria 11210
159 Ga0207652_10011781 3300025921 Bacteria 7058
160 Ga0207652_10310130 3300025921 Bacteria 1424
161 Ga0207652_10413229 3300025921 Bacteria 1217
162 Ga0207652_10752259 3300025921 Bacteria 867
163 Ga0207687_10226144 3300025927 Bacteria 1476
164 Ga0207687_10384489 3300025927 Bacteria 1151
165 Ga0207700_10081676 3300025928 Bacteria 2525
166 Ga0207690_10002301 3300025932 Bacteria 11642
167 Ga0207706_10011004 3300025933 Bacteria 8249
168 Ga0207709_10603325 3300025935 Bacteria 869
169 Ga0207704_10062725 3300025938 Bacteria 2313
170 Ga0207711_10489734 3300025941 Bacteria 1146
171 Ga0207661_10016854 3300025944 Bacteria 5396
172 Ga0207661_10115889 3300025944 Bacteria 2274
173 Ga0207661_10821212 3300025944 Bacteria 856
174 Ga0207679_10382397 3300025945 Bacteria 1234
175 Ga0207667_10294114 3300025949 Bacteria 1659
176 Ga0207667_10596855 3300025949 Bacteria 1114
177 Ga0207667_11014598 3300025949 Bacteria 816
178 Ga0207668_10102293 3300025972 Bacteria 2131
179 Ga0207658_10089789 3300025986 Bacteria 2380
180 Ga0207658_10103800 3300025986 Bacteria 2232
181 Ga0207677_10538921 3300026023 Bacteria 1015
182 Ga0207678_10035541 3300026067 Bacteria 4338
183 Ga0207678_10933606 3300026067 Bacteria 767
184 Ga0207708_10000025 3300026075 Bacteria 169896
185 Ga0207702_10145154 3300026078 Bacteria 2152
186 Ga0207702_10494578 3300026078 Bacteria 1192
187 Ga0207641_10020944 3300026088 Bacteria 5375
188 Ga0207641_10204571 3300026088 Bacteria 1822
189 Ga0207676_10146390 3300026095 Bacteria 2029
190 Ga0207676_10256190 3300026095 Bacteria 1577
191 Ga0207683_10000893 3300026121 Bacteria 27409
192 Ga0207698_10371238 3300026142 Bacteria 1358
193 Ga0268266_10002106 3300028379 Bacteria 21983
194 Ga0268266_11012021 3300028379 Bacteria 804
195 Ga0268264_10000239 3300028381 Bacteria 104914
196 Ga0265338_10065957 3300028800 Bacteria 3136
197 Ga0265325_10059261 3300031241 Bacteria 1947
198 Ga0265325_10214414 3300031241 Bacteria 883
199 Ga0265325_10236339 3300031241 Bacteria 831
200 Ga0265339_10010851 3300031249 Bacteria 5635
201 Ga0265316_10073469 3300031344 Bacteria 2634
202 Ga0265313_10032651 3300031595 Bacteria 2654
203 Ga0265314_10053473 3300031711 Bacteria 2800
204 Ga0265342_10242795 3300031712 Bacteria 964
205 Ga0265342_10270064 3300031712 Bacteria 903
206 Ga0307413_10731188 3300031824 Bacteria 825
207 Ga0307415_100255352 3300032126 Bacteria 1427
208 Ga0307507_10000732 3300033179 Bacteria 72083
209 Ga0307510_10069898 3300033180 Bacteria 3512
210 Ga0373930_0003350 3300034816 Bacteria 2536
211 Ga0373928_0026433 3300035084 Bacteria 1257
212 Ga0373940_0221513 3300035088 Bacteria 629
213 Ga0373952_0072333 3300035092 Bacteria 865
214 Ga0373923_0419919 3300035111 Bacteria 646
215 Ga0373942_0033053 3300035207 Bacteria 1378
216 Ga0373962_0139931 3300035242 Bacteria 785
217 Ga0373927_0029796 3300035695 Bacteria 3559
218 Ga0395900_0084948 3300037418 Bacteria 3253
219 Ga0395898_0467141 3300037466 Bacteria 1201
220 Ga0436364_0095699 3300037853 Bacteria 4117
221 Ga0395901_0299670 3300038443 Bacteria 1667
222 Ga0466969_0008121 3300044656 Bacteria 5571
223 Ga0466969_0015870 3300044656 Bacteria 3947
224 Ga0466969_0037936 3300044656 Bacteria 2428
225 Ga0466969_0045013 3300044656 Bacteria 2192
226 Ga0466969_0056127 3300044656 Bacteria 1924
227 Ga0466969_0063295 3300044656 Bacteria 1793
228 Ga0466972_0021218 3300044658 Bacteria 3240
229 Ga0466972_0039920 3300044658 Bacteria 2289
230 Ga0466965_0015465 3300044683 Bacteria 3625
231 Ga0466966_0002957 3300044684 Bacteria 11182
232 Ga0466966_0006103 3300044684 Bacteria 7959
233 Ga0466966_0051716 3300044684 Bacteria 2611
234 Ga0466966_0154623 3300044684 Bacteria 1398
235 Ga0466966_0297432 3300044684 Bacteria 970
236 Ga0466961_0015642 3300044693 Bacteria 4868
237 Ga0466961_0026287 3300044693 Bacteria 3742
238 Ga0466961_0042486 3300044693 Bacteria 2914
239 Ga0466961_0104524 3300044693 Bacteria 1783
240 Ga0466961_0290363 3300044693 Bacteria 1000
241 Ga0466961_0511875 3300044693 Bacteria 724
242 Ga0466961_0532712 3300044693 Bacteria 708
243 Ga0466963_0011619 3300044694 Bacteria 5360
244 Ga0466963_0024570 3300044694 Bacteria 3835
245 Ga0466963_0027631 3300044694 Bacteria 3635
246 Ga0466963_0048266 3300044694 Bacteria 2812
247 Ga0466963_0064096 3300044694 Bacteria 2461
248 Ga0466963_0073306 3300044694 Bacteria 2308
249 Ga0466963_0423845 3300044694 Bacteria 938
250 Ga0466963_0524111 3300044694 Bacteria 837
251 Ga0466971_0007204 3300044719 Bacteria 4843
252 Ga0466971_0012838 3300044719 Bacteria 3672
253 Ga0466971_0103350 3300044719 Bacteria 1311
254 Ga0466968_0053549 3300044735 Bacteria 1729
255 Ga0466970_0018589 3300044765 Bacteria 3600
256 Ga0466970_0146484 3300044765 Bacteria 1303
257 Ga0466970_0636793 3300044765 Bacteria 620
258 Ga0466957_0023720 3300044842 Bacteria 3629
259 Ga0466957_0069977 3300044842 Bacteria 2168
260 Ga0466957_0241002 3300044842 Bacteria 1200
261 Ga0466960_0007176 3300044901 Bacteria 4510
262 Ga0466959_0100283 3300045049 Bacteria 2073
263 Ga0466959_0406315 3300045049 Bacteria 925
264 Ga0466958_0011749 3300045836 Bacteria 4943
265 Ga0466958_0370440 3300045836 Bacteria 923
266 Ga0466958_0624243 3300045836 Bacteria 701
267 Ga0466958_0737696 3300045836 Bacteria 642
268 Ga0466967_0001337 3300045976 Bacteria 14137
269 Ga0466967_0009716 3300045976 Bacteria 7163
270 Ga0466967_0102321 3300045976 Bacteria 2620
271 Ga0466967_0131502 3300045976 Bacteria 2324
272 Ga0466967_0362379 3300045976 Bacteria 1405
273 Ga0466967_0394175 3300045976 Bacteria 1346
274 Ga0466967_0431712 3300045976 Bacteria 1285
275 Ga0466967_0790247 3300045976 Bacteria 942
276 Ga0466967_0843883 3300045976 Bacteria 910
277 Ga0466967_0896667 3300045976 Bacteria 882
278 Ga0466967_1029886 3300045976 Bacteria 820
279 Ga0495603_0199295 3300046455 Bacteria 1157
280 Ga0495629_0103602 3300046459 Bacteria 1985
281 Ga0495641_0080842 3300046461 Bacteria 1456
282 Ga0495635_0281568 3300046663 Bacteria 1117
283 Ga0495658_0543632 3300046683 Bacteria 744
284 Ga0495674_0664400 3300047319 Bacteria 821
285 Ga0495676_0508712 3300047321 Bacteria 790
286 Ga0495593_0050793 3300047673 Bacteria 2196
287 Ga0496100_0068687 3300048903 Bacteria 2357
288 Ga0496100_0267982 3300048903 Bacteria 1269
289 Ga0496100_0623512 3300048903 Bacteria 839
290 Ga0496101_0015012 3300048904 Bacteria 5212
291 Ga0496101_0079797 3300048904 Bacteria 2416
292 Ga0496101_0178704 3300048904 Bacteria 1633
293 Ga0496102_0000048 3300048905 Bacteria 179713
294 Ga0496102_0000264 3300048905 Bacteria 67050
295 Ga0496102_0000324 3300048905 Bacteria 59699
296 Ga0496102_0068905 3300048905 Bacteria 3247
297 Ga0496102_0337659 3300048905 Bacteria 1419
298 Ga0496102_0508884 3300048905 Bacteria 1126
299 Ga0496103_0000018 3300048906 Bacteria 239585
300 Ga0496103_0001057 3300048906 Bacteria 19207
301 Ga0496103_0018301 3300048906 Bacteria 4202
302 Ga0496103_0133272 3300048906 Bacteria 1587
303 Ga0496104_0070678 3300048907 Bacteria 3319
304 Ga0496104_0087451 3300048907 Bacteria 2976
305 Ga0496105_0162355 3300048908 Bacteria 1834
306 Ga0496105_0523501 3300048908 Bacteria 928
307 Ga0496107_0081885 3300048910 Bacteria 2354
308 Ga0496108_0028490 3300048911 Bacteria 4621
309 Ga0496108_0078875 3300048911 Bacteria 2787
310 Ga0496109_0000602 3300048912 Bacteria 30110
311 Ga0496110_0067527 3300048913 Bacteria 3164
312 Ga0496110_0443671 3300048913 Bacteria 1183
313 Ga0496110_0608855 3300048913 Bacteria 991
314 Ga0496111_0260403 3300048914 Bacteria 1287
315 Ga0496111_0265487 3300048914 Bacteria 1273
316 Ga0496112_0001815 3300048915 Bacteria 16806
317 Ga0496113_0007030 3300048916 Bacteria 7199
318 Ga0496114_0065415 3300048917 Bacteria 3046
319 Ga0496114_0317089 3300048917 Bacteria 1377
320 Ga0496114_0964044 3300048917 Bacteria 735
321 Ga0496115_0090505 3300048918 Bacteria 2499
322 Ga0496116_0000197 3300048919 Bacteria 120256
323 Ga0496117_0000879 3300048920 Bacteria 46401
324 Ga0496117_0389907 3300048920 Bacteria 706
325 Ga0496118_0000172 3300048921 Bacteria 116150
326 Ga0496119_0000253 3300048922 Bacteria 75779
327 Ga0496119_0048767 3300048922 Bacteria 2623
328 Ga0496120_0002248 3300048923 Bacteria 20168
329 Ga0496120_0006132 3300048923 Bacteria 9322
330 Ga0496121_0002921 3300048924 Bacteria 25037
331 Ga0496121_0042364 3300048924 Bacteria 3962
332 Ga0496122_0294392 3300048925 Bacteria 879
333 Ga0496125_0091940 3300048928 Bacteria 2270
334 Ga0496126_0000003 3300048929 Bacteria 961576
335 Ga0496126_0000040 3300048929 Bacteria 345144
336 Ga0496126_0000869 3300048929 Bacteria 53155
337 Ga0501047_0000037 3300049581 Bacteria 189750
338 Ga0501068_0233887 3300049584 Bacteria 1169
339 Ga0501069_0415029 3300049585 Bacteria 797
340 Ga0501070_0012548 3300049586 Bacteria 7146
341 Ga0501072_0590713 3300049588 Bacteria 876
342 Ga0501074_0022648 3300049590 Bacteria 4567
343 Ga0501079_0337213 3300049741 Bacteria 1181
344 Ga0501080_0003628 3300049742 Bacteria 13607
345 Ga0501080_0032493 3300049742 Bacteria 4868
346 Ga0501080_0335813 3300049742 Bacteria 1366
347 Ga0501045_0192914 3300049824 Bacteria 1518
348 nmdc:mga09592_161497_c1 3300050508 Bacteria 1936
349 nmdc:mga0qj67_401680_c1 3300050509 Bacteria 1106
350 nmdc:mga0rr50_71714_c1 3300050513 Bacteria 2644
351 nmdc:mga08x19_11020_c1 3300050514 Bacteria 5440
352 nmdc:mga0a205_476961_c1 3300050515 Bacteria 1106
353 Ga0466962_0044966 3300061719 Bacteria 2111

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_101053261 Ga0097621_1010532611 162
2 3300013308 Ga0157375_10339586 Ga0157375_103395862 162
3 3300014969 Ga0157376_10143382 Ga0157376_101433822 162
4 3300045836 Ga0466958_0737696 Ga0466958_0737696_43_534 163
5 3300048916 Ga0496113_0007030 Ga0496113_0007030_6676_7167 163
6 3300048917 Ga0496114_0065415 Ga0496114_0065415_15_506 163
7 3300013102 Ga0157371_10941969 Ga0157371_109419691 167
8 3300045976 Ga0466967_0843883 Ga0466967_0843883_130_744 178
9 3300044658 Ga0466972_0021218 Ga0466972_0021218_456_1052 182
10 3300044683 Ga0466965_0015465 Ga0466965_0015465_2086_2682 182
11 3300044719 Ga0466971_0103350 Ga0466971_0103350_75_671 182
12 3300044765 Ga0466970_0018589 Ga0466970_0018589_1423_2019 182
13 3300044842 Ga0466957_0023720 Ga0466957_0023720_1201_1797 182
14 3300044901 Ga0466960_0007176 Ga0466960_0007176_2150_2746 182
15 3300045836 Ga0466958_0624243 Ga0466958_0624243_80_676 182
16 3300048917 Ga0496114_0317089 Ga0496114_0317089_93_644 182
17 3300005434 Ga0070709_10173044 Ga0070709_101730441 186
18 3300034816 Ga0373930_0003350 Ga0373930_0003350_1914_2474 186
19 3300035088 Ga0373940_0221513 Ga0373940_0221513_47_607 186
20 3300035092 Ga0373952_0072333 Ga0373952_0072333_266_826 186
21 3300044694 Ga0466963_0073306 Ga0466963_0073306_922_1500 186
22 3300049590 Ga0501074_0022648 Ga0501074_0022648_2601_3200 186
23 3300049742 Ga0501080_0032493 Ga0501080_0032493_202_801 186
24 iso_pu_bacteria 2816332119 2816420640 186
25 iso_pu_bacteria 2974315732 2974318480 186
26 iso_pu_bacteria 2984523437 2984526690 186
27 3300005618 Ga0068864_100511945 Ga0068864_1005119452 187
28 3300005841 Ga0068863_100007236 Ga0068863_1000072367 187
29 3300009101 Ga0105247_10201308 Ga0105247_102013082 187
30 3300014968 Ga0157379_10036370 Ga0157379_100363702 187
31 3300025900 Ga0207710_10194203 Ga0207710_101942032 187
32 3300026088 Ga0207641_10204571 Ga0207641_102045713 187
33 3300026095 Ga0207676_10256190 Ga0207676_102561902 187
34 3300048903 Ga0496100_0068687 Ga0496100_0068687_972_1544 187
35 3300048904 Ga0496101_0015012 Ga0496101_0015012_3786_4358 187
36 3300048905 Ga0496102_0000048 Ga0496102_0000048_134166_134738 187
37 3300048906 Ga0496103_0000018 Ga0496103_0000018_160004_160576 187
38 3300048907 Ga0496104_0070678 Ga0496104_0070678_1064_1636 187
39 3300048913 Ga0496110_0067527 Ga0496110_0067527_1766_2338 187
40 3300048914 Ga0496111_0260403 Ga0496111_0260403_116_688 187
41 3300048919 Ga0496116_0000197 Ga0496116_0000197_74727_75299 187
42 3300048920 Ga0496117_0000879 Ga0496117_0000879_876_1448 187
43 3300048921 Ga0496118_0000172 Ga0496118_0000172_79012_79584 187
44 3300048922 Ga0496119_0048767 Ga0496119_0048767_1178_1750 187
45 3300048923 Ga0496120_0006132 Ga0496120_0006132_859_1431 187
46 3300048924 Ga0496121_0002921 Ga0496121_0002921_4207_4779 187
47 3300048925 Ga0496122_0294392 Ga0496122_0294392_250_822 187
48 3300048928 Ga0496125_0091940 Ga0496125_0091940_184_756 187
49 3300048929 Ga0496126_0000869 Ga0496126_0000869_36576_37148 187
50 3300005327 Ga0070658_10159697 Ga0070658_101596972 188
51 3300009101 Ga0105247_10107819 Ga0105247_101078193 188
52 3300020082 Ga0206353_11260483 Ga0206353_112604832 188
53 3300025900 Ga0207710_10002313 Ga0207710_100023136 188
54 3300025921 Ga0207652_10004586 Ga0207652_100045864 188
55 3300048904 Ga0496101_0178704 Ga0496101_0178704_931_1497 188
56 3300048905 Ga0496102_0000264 Ga0496102_0000264_10538_11104 188
57 3300048906 Ga0496103_0001057 Ga0496103_0001057_10550_11116 188
58 3300048920 Ga0496117_0389907 Ga0496117_0389907_40_606 188
59 3300048924 Ga0496121_0042364 Ga0496121_0042364_1627_2193 188
60 3300049586 Ga0501070_0012548 Ga0501070_0012548_6091_6657 188
61 3300005354 Ga0070675_100779829 Ga0070675_1007798291 189
62 3300005937 Ga0081455_10004443 Ga0081455_100044439 189
63 3300005937 Ga0081455_10059691 Ga0081455_100596913 189
64 3300006844 Ga0075428_100000631 Ga0075428_10000063115 189
65 3300006846 Ga0075430_100473990 Ga0075430_1004739902 189
66 3300006847 Ga0075431_100000069 Ga0075431_1000000696 189
67 3300006880 Ga0075429_100246547 Ga0075429_1002465472 189
68 3300025917 Ga0207660_10386105 Ga0207660_103861051 189
69 3300025921 Ga0207652_10310130 Ga0207652_103101302 189
70 3300033180 Ga0307510_10069898 Ga0307510_100698983 189
71 3300044656 Ga0466969_0008121 Ga0466969_0008121_4640_5215 189
72 3300044719 Ga0466971_0007204 Ga0466971_0007204_689_1264 189
73 3300045976 Ga0466967_0009716 Ga0466967_0009716_1448_2017 189
74 3300047321 Ga0495676_0508712 Ga0495676_0508712_67_690 189
75 3300048929 Ga0496126_0000003 Ga0496126_0000003_910104_910673 189
76 3300049585 Ga0501069_0415029 Ga0501069_0415029_57_650 189
77 3300049824 Ga0501045_0192914 Ga0501045_0192914_49_630 189
78 3300050508 nmdc:mga09592_161497_c1 nmdc:mga09592_161497_c1_804_1427 189
79 3300050509 nmdc:mga0qj67_401680_c1 nmdc:mga0qj67_401680_c1_405_986 189
80 3300005330 Ga0070690_100028652 Ga0070690_1000286523 190
81 3300005334 Ga0068869_100146785 Ga0068869_1001467853 190
82 3300005335 Ga0070666_10155150 Ga0070666_101551502 190
83 3300005336 Ga0070680_100314551 Ga0070680_1003145512 190
84 3300005339 Ga0070660_100233470 Ga0070660_1002334701 190
85 3300005339 Ga0070660_100239452 Ga0070660_1002394522 190
86 3300005339 Ga0070660_100485638 Ga0070660_1004856382 190
87 3300005343 Ga0070687_100152294 Ga0070687_1001522942 190
88 3300005344 Ga0070661_100480239 Ga0070661_1004802391 190
89 3300005355 Ga0070671_100004596 Ga0070671_1000045962 190
90 3300005366 Ga0070659_100001340 Ga0070659_1000013402 190
91 3300005366 Ga0070659_100023145 Ga0070659_1000231454 190
92 3300005366 Ga0070659_100349818 Ga0070659_1003498182 190
93 3300005367 Ga0070667_100118668 Ga0070667_1001186683 190
94 3300005436 Ga0070713_100049638 Ga0070713_1000496384 190
95 3300005440 Ga0070705_100261041 Ga0070705_1002610411 190
96 3300005441 Ga0070700_100000021 Ga0070700_10000002154 190
97 3300005455 Ga0070663_100040703 Ga0070663_1000407031 190
98 3300005456 Ga0070678_100120864 Ga0070678_1001208643 190
99 3300005539 Ga0068853_100166981 Ga0068853_1001669813 190
100 3300005548 Ga0070665_100001490 Ga0070665_10000149014 190
101 3300005563 Ga0068855_100618795 Ga0068855_1006187952 190
102 3300005617 Ga0068859_100617693 Ga0068859_1006176932 190
103 3300005834 Ga0068851_10074902 Ga0068851_100749021 190
104 3300005840 Ga0068870_10239699 Ga0068870_102396992 190
105 3300005841 Ga0068863_100001613 Ga0068863_10000161312 190
106 3300005841 Ga0068863_100020259 Ga0068863_1000202597 190
107 3300005842 Ga0068858_100128762 Ga0068858_1001287622 190
108 3300005843 Ga0068860_100000195 Ga0068860_10000019521 190
109 3300005937 Ga0081455_10037340 Ga0081455_100373405 190
110 3300006028 Ga0070717_10067485 Ga0070717_100674853 190
111 3300006173 Ga0070716_100029457 Ga0070716_1000294572 190
112 3300006852 Ga0075433_10020028 Ga0075433_100200282 190
113 3300006931 Ga0097620_100617650 Ga0097620_1006176502 190
114 3300007076 Ga0075435_100008153 Ga0075435_1000081537 190
115 3300009093 Ga0105240_10425772 Ga0105240_104257721 190
116 3300009098 Ga0105245_10005593 Ga0105245_100055936 190
117 3300009148 Ga0105243_10006420 Ga0105243_100064203 190
118 3300009174 Ga0105241_10209602 Ga0105241_102096021 190
119 3300009176 Ga0105242_10343434 Ga0105242_103434341 190
120 3300009545 Ga0105237_10017439 Ga0105237_100174397 190
121 3300009545 Ga0105237_10085832 Ga0105237_100858323 190
122 3300009551 Ga0105238_10061475 Ga0105238_100614754 190
123 3300009551 Ga0105238_10205943 Ga0105238_102059432 190
124 3300009553 Ga0105249_10007621 Ga0105249_100076213 190
125 3300009553 Ga0105249_10677807 Ga0105249_106778072 190
126 3300011119 Ga0105246_10009256 Ga0105246_100092563 190
127 3300013102 Ga0157371_10084184 Ga0157371_100841842 190
128 3300013104 Ga0157370_10026852 Ga0157370_100268523 190
129 3300013105 Ga0157369_10028377 Ga0157369_100283773 190
130 3300013105 Ga0157369_10032469 Ga0157369_100324695 190
131 3300013105 Ga0157369_10123892 Ga0157369_101238922 190
132 3300013306 Ga0163162_10010160 Ga0163162_100101603 190
133 3300013307 Ga0157372_10037238 Ga0157372_100372382 190
134 3300014325 Ga0163163_10133565 Ga0163163_101335651 190
135 3300014326 Ga0157380_10145822 Ga0157380_101458222 190
136 3300014968 Ga0157379_10018519 Ga0157379_100185192 190
137 3300014968 Ga0157379_10200234 Ga0157379_102002343 190
138 3300014969 Ga0157376_10108525 Ga0157376_101085253 190
139 3300017792 Ga0163161_10007157 Ga0163161_100071571 190
140 3300020082 Ga0206353_11198684 Ga0206353_111986842 190
141 3300020082 Ga0206353_11922679 Ga0206353_119226794 190
142 3300025900 Ga0207710_10255763 Ga0207710_102557631 190
143 3300025906 Ga0207699_10201713 Ga0207699_102017132 190
144 3300025914 Ga0207671_10014977 Ga0207671_100149773 190
145 3300025915 Ga0207693_10002732 Ga0207693_100027329 190
146 3300025918 Ga0207662_10068731 Ga0207662_100687313 190
147 3300025919 Ga0207657_10244744 Ga0207657_102447443 190
148 3300025919 Ga0207657_10248326 Ga0207657_102483262 190
149 3300025927 Ga0207687_10384489 Ga0207687_103844891 190
150 3300025928 Ga0207700_10081676 Ga0207700_100816763 190
151 3300025932 Ga0207690_10002301 Ga0207690_100023013 190
152 3300025933 Ga0207706_10011004 Ga0207706_100110041 190
153 3300025938 Ga0207704_10062725 Ga0207704_100627253 190
154 3300025945 Ga0207679_10382397 Ga0207679_103823972 190
155 3300025949 Ga0207667_10294114 Ga0207667_102941142 190
156 3300025972 Ga0207668_10102293 Ga0207668_101022933 190
157 3300025986 Ga0207658_10089789 Ga0207658_100897893 190
158 3300025986 Ga0207658_10103800 Ga0207658_101038003 190
159 3300026067 Ga0207678_10035541 Ga0207678_100355412 190
160 3300026075 Ga0207708_10000025 Ga0207708_1000002583 190
161 3300026078 Ga0207702_10145154 Ga0207702_101451543 190
162 3300026088 Ga0207641_10020944 Ga0207641_100209443 190
163 3300026095 Ga0207676_10146390 Ga0207676_101463901 190
164 3300026121 Ga0207683_10000893 Ga0207683_100008937 190
165 3300028379 Ga0268266_10002106 Ga0268266_100021062 190
166 3300028379 Ga0268266_11012021 Ga0268266_110120211 190
167 3300028381 Ga0268264_10000239 Ga0268264_1000023921 190
168 3300031241 Ga0265325_10214414 Ga0265325_102144142 190
169 3300031824 Ga0307413_10731188 Ga0307413_107311881 190
170 3300032126 Ga0307415_100255352 Ga0307415_1002553521 190
171 3300035084 Ga0373928_0026433 Ga0373928_0026433_564_1190 190
172 3300035111 Ga0373923_0419919 Ga0373923_0419919_38_610 190
173 3300035207 Ga0373942_0033053 Ga0373942_0033053_70_696 190
174 3300035242 Ga0373962_0139931 Ga0373962_0139931_121_747 190
175 3300035695 Ga0373927_0029796 Ga0373927_0029796_1613_2185 190
176 3300037853 Ga0436364_0095699 Ga0436364_0095699_3441_4013 190
177 3300044656 Ga0466969_0045013 Ga0466969_0045013_1543_2115 190
178 3300044656 Ga0466969_0056127 Ga0466969_0056127_92_664 190
179 3300044656 Ga0466969_0063295 Ga0466969_0063295_596_1168 190
180 3300044658 Ga0466972_0039920 Ga0466972_0039920_87_662 190
181 3300044684 Ga0466966_0002957 Ga0466966_0002957_3373_3945 190
182 3300044684 Ga0466966_0051716 Ga0466966_0051716_1566_2138 190
183 3300044684 Ga0466966_0154623 Ga0466966_0154623_62_634 190
184 3300044684 Ga0466966_0297432 Ga0466966_0297432_262_834 190
185 3300044693 Ga0466961_0015642 Ga0466961_0015642_3876_4448 190
186 3300044693 Ga0466961_0026287 Ga0466961_0026287_2515_3087 190
187 3300044693 Ga0466961_0532712 Ga0466961_0532712_14_592 190
188 3300044694 Ga0466963_0011619 Ga0466963_0011619_2918_3499 190
189 3300044694 Ga0466963_0024570 Ga0466963_0024570_105_677 190
190 3300044694 Ga0466963_0027631 Ga0466963_0027631_790_1377 190
191 3300044694 Ga0466963_0064096 Ga0466963_0064096_505_1077 190
192 3300044694 Ga0466963_0423845 Ga0466963_0423845_347_919 190
193 3300044735 Ga0466968_0053549 Ga0466968_0053549_560_1132 190
194 3300044765 Ga0466970_0636793 Ga0466970_0636793_24_596 190
195 3300044842 Ga0466957_0069977 Ga0466957_0069977_1240_1812 190
196 3300045049 Ga0466959_0100283 Ga0466959_0100283_223_840 190
197 3300045049 Ga0466959_0406315 Ga0466959_0406315_141_713 190
198 3300045836 Ga0466958_0011749 Ga0466958_0011749_4137_4709 190
199 3300045836 Ga0466958_0370440 Ga0466958_0370440_173_760 190
200 3300045976 Ga0466967_0001337 Ga0466967_0001337_87_659 190
201 3300045976 Ga0466967_0131502 Ga0466967_0131502_1693_2265 190
202 3300045976 Ga0466967_0362379 Ga0466967_0362379_312_896 190
203 3300045976 Ga0466967_0394175 Ga0466967_0394175_249_821 190
204 3300045976 Ga0466967_0431712 Ga0466967_0431712_680_1252 190
205 3300046459 Ga0495629_0103602 Ga0495629_0103602_1106_1792 190
206 3300046461 Ga0495641_0080842 Ga0495641_0080842_111_713 190
207 3300046663 Ga0495635_0281568 Ga0495635_0281568_64_636 190
208 3300047319 Ga0495674_0664400 Ga0495674_0664400_72_644 190
209 3300047673 Ga0495593_0050793 Ga0495593_0050793_1319_2005 190
210 3300048903 Ga0496100_0623512 Ga0496100_0623512_227_814 190
211 3300048904 Ga0496101_0079797 Ga0496101_0079797_191_817 190
212 3300048905 Ga0496102_0000324 Ga0496102_0000324_14578_15150 190
213 3300048905 Ga0496102_0337659 Ga0496102_0337659_338_964 190
214 3300048905 Ga0496102_0508884 Ga0496102_0508884_101_679 190
215 3300048906 Ga0496103_0018301 Ga0496103_0018301_1500_2072 190
216 3300048906 Ga0496103_0133272 Ga0496103_0133272_554_1126 190
217 3300048907 Ga0496104_0087451 Ga0496104_0087451_397_1023 190
218 3300048908 Ga0496105_0523501 Ga0496105_0523501_154_780 190
219 3300048911 Ga0496108_0028490 Ga0496108_0028490_3382_4008 190
220 3300048913 Ga0496110_0443671 Ga0496110_0443671_341_925 190
221 3300048913 Ga0496110_0608855 Ga0496110_0608855_275_901 190
222 3300048914 Ga0496111_0265487 Ga0496111_0265487_168_794 190
223 3300048917 Ga0496114_0964044 Ga0496114_0964044_43_669 190
224 3300048918 Ga0496115_0090505 Ga0496115_0090505_1783_2409 190
225 3300048922 Ga0496119_0000253 Ga0496119_0000253_13098_13670 190
226 3300048923 Ga0496120_0002248 Ga0496120_0002248_2661_3233 190
227 3300049581 Ga0501047_0000037 Ga0501047_0000037_25964_26545 190
228 3300049584 Ga0501068_0233887 Ga0501068_0233887_95_676 190
229 3300049742 Ga0501080_0335813 Ga0501080_0335813_485_1066 190
230 3300050513 nmdc:mga0rr50_71714_c1 nmdc:mga0rr50_71714_c1_1881_2507 190
231 3300050514 nmdc:mga08x19_11020_c1 nmdc:mga08x19_11020_c1_4282_4908 190
232 3300050515 nmdc:mga0a205_476961_c1 nmdc:mga0a205_476961_c1_19_645 190
233 iso_pu_bacteria 2684623035 2686533821 190
234 iso_pu_bacteria 2895880812 2895886405 190
235 iso_pu_bacteria 8054472261 8054478923 190
236 3300005329 Ga0070683_100106926 Ga0070683_1001069263 191
237 3300005329 Ga0070683_100666932 Ga0070683_1006669322 191
238 3300005336 Ga0070680_100001726 Ga0070680_1000017269 191
239 3300005347 Ga0070668_100617203 Ga0070668_1006172032 191
240 3300005356 Ga0070674_101105372 Ga0070674_1011053721 191
241 3300005441 Ga0070700_100633708 Ga0070700_1006337082 191
242 3300005458 Ga0070681_10003785 Ga0070681_100037856 191
243 3300005458 Ga0070681_10022088 Ga0070681_100220882 191
244 3300005458 Ga0070681_10449901 Ga0070681_104499012 191
245 3300005458 Ga0070681_10527782 Ga0070681_105277822 191
246 3300005530 Ga0070679_100000128 Ga0070679_10000012849 191
247 3300005530 Ga0070679_100011389 Ga0070679_1000113893 191
248 3300005530 Ga0070679_100317604 Ga0070679_1003176041 191
249 3300005530 Ga0070679_100739027 Ga0070679_1007390271 191
250 3300005535 Ga0070684_100262900 Ga0070684_1002629002 191
251 3300005563 Ga0068855_100942143 Ga0068855_1009421432 191
252 3300005563 Ga0068855_101050446 Ga0068855_1010504462 191
253 3300005616 Ga0068852_101450171 Ga0068852_1014501711 191
254 3300005718 Ga0068866_10191254 Ga0068866_101912542 191
255 3300009098 Ga0105245_10019677 Ga0105245_100196774 191
256 3300009177 Ga0105248_10272627 Ga0105248_102726272 191
257 3300013104 Ga0157370_10725106 Ga0157370_107251061 191
258 3300013105 Ga0157369_10057105 Ga0157369_100571052 191
259 3300013105 Ga0157369_10257231 Ga0157369_102572312 191
260 3300013306 Ga0163162_10169816 Ga0163162_101698162 191
261 3300013307 Ga0157372_11482152 Ga0157372_114821522 191
262 3300013308 Ga0157375_10000958 Ga0157375_100009582 191
263 3300014326 Ga0157380_10939116 Ga0157380_109391161 191
264 3300020081 Ga0206354_10521760 Ga0206354_105217602 191
265 3300020082 Ga0206353_10971152 Ga0206353_109711521 191
266 3300020082 Ga0206353_11016463 Ga0206353_110164633 191
267 3300020082 Ga0206353_11569373 Ga0206353_115693732 191
268 3300022467 Ga0224712_10051659 Ga0224712_100516592 191
269 3300025899 Ga0207642_10057002 Ga0207642_100570022 191
270 3300025912 Ga0207707_10000199 Ga0207707_100001996 191
271 3300025912 Ga0207707_10030550 Ga0207707_100305502 191
272 3300025917 Ga0207660_10001441 Ga0207660_100014416 191
273 3300025919 Ga0207657_10071855 Ga0207657_100718553 191
274 3300025921 Ga0207652_10000199 Ga0207652_1000019911 191
275 3300025921 Ga0207652_10413229 Ga0207652_104132291 191
276 3300025927 Ga0207687_10226144 Ga0207687_102261442 191
277 3300025935 Ga0207709_10603325 Ga0207709_106033252 191
278 3300025941 Ga0207711_10489734 Ga0207711_104897342 191
279 3300025944 Ga0207661_10115889 Ga0207661_101158891 191
280 3300025944 Ga0207661_10821212 Ga0207661_108212122 191
281 3300025949 Ga0207667_10596855 Ga0207667_105968552 191
282 3300026023 Ga0207677_10538921 Ga0207677_105389212 191
283 3300026142 Ga0207698_10371238 Ga0207698_103712382 191
284 3300028800 Ga0265338_10065957 Ga0265338_100659572 191
285 3300031241 Ga0265325_10059261 Ga0265325_100592612 191
286 3300031241 Ga0265325_10236339 Ga0265325_102363392 191
287 3300031249 Ga0265339_10010851 Ga0265339_100108516 191
288 3300031344 Ga0265316_10073469 Ga0265316_100734694 191
289 3300031595 Ga0265313_10032651 Ga0265313_100326512 191
290 3300031711 Ga0265314_10053473 Ga0265314_100534733 191
291 3300031712 Ga0265342_10242795 Ga0265342_102427951 191
292 3300031712 Ga0265342_10270064 Ga0265342_102700642 191
293 3300037418 Ga0395900_0084948 Ga0395900_0084948_525_1100 191
294 3300037466 Ga0395898_0467141 Ga0395898_0467141_605_1180 191
295 3300038443 Ga0395901_0299670 Ga0395901_0299670_1010_1585 191
296 3300044693 Ga0466961_0042486 Ga0466961_0042486_670_1275 191
297 3300044693 Ga0466961_0290363 Ga0466961_0290363_18_596 191
298 3300044694 Ga0466963_0048266 Ga0466963_0048266_1595_2179 191
299 3300044694 Ga0466963_0524111 Ga0466963_0524111_212_787 191
300 3300044842 Ga0466957_0241002 Ga0466957_0241002_314_889 191
301 3300045976 Ga0466967_0102321 Ga0466967_0102321_961_1545 191
302 3300045976 Ga0466967_0790247 Ga0466967_0790247_70_645 191
303 3300045976 Ga0466967_0896667 Ga0466967_0896667_273_848 191
304 3300045976 Ga0466967_1029886 Ga0466967_1029886_81_656 191
305 3300046455 Ga0495603_0199295 Ga0495603_0199295_567_1142 191
306 3300046683 Ga0495658_0543632 Ga0495658_0543632_54_629 191
307 3300048903 Ga0496100_0267982 Ga0496100_0267982_31_606 191
308 3300048905 Ga0496102_0068905 Ga0496102_0068905_1383_1958 191
309 3300048908 Ga0496105_0162355 Ga0496105_0162355_800_1375 191
310 3300048910 Ga0496107_0081885 Ga0496107_0081885_905_1480 191
311 3300048911 Ga0496108_0078875 Ga0496108_0078875_873_1448 191
312 3300048912 Ga0496109_0000602 Ga0496109_0000602_28067_28642 191
313 3300048915 Ga0496112_0001815 Ga0496112_0001815_11634_12209 191
314 3300048929 Ga0496126_0000040 Ga0496126_0000040_147825_148409 191
315 3300049742 Ga0501080_0003628 Ga0501080_0003628_11404_11979 191
316 3300005327 Ga0070658_10055345 Ga0070658_100553452 192
317 3300005327 Ga0070658_10207971 Ga0070658_102079712 192
318 3300005329 Ga0070683_100330971 Ga0070683_1003309713 192
319 3300005329 Ga0070683_100341351 Ga0070683_1003413512 192
320 3300005329 Ga0070683_100414864 Ga0070683_1004148642 192
321 3300005336 Ga0070680_100218819 Ga0070680_1002188192 192
322 3300005336 Ga0070680_100270713 Ga0070680_1002707132 192
323 3300005336 Ga0070680_100392588 Ga0070680_1003925882 192
324 3300005337 Ga0070682_100838122 Ga0070682_1008381221 192
325 3300005339 Ga0070660_100022174 Ga0070660_1000221747 192
326 3300005339 Ga0070660_100566953 Ga0070660_1005669531 192
327 3300005458 Ga0070681_10004181 Ga0070681_100041816 192
328 3300005530 Ga0070679_100002298 Ga0070679_10000229817 192
329 3300005530 Ga0070679_100412430 Ga0070679_1004124301 192
330 3300005535 Ga0070684_100785001 Ga0070684_1007850011 192
331 3300005937 Ga0081455_10003959 Ga0081455_1000395910 192
332 3300009093 Ga0105240_10397625 Ga0105240_103976252 192
333 3300009545 Ga0105237_10324807 Ga0105237_103248072 192
334 3300013105 Ga0157369_10237859 Ga0157369_102378593 192
335 3300013307 Ga0157372_11003878 Ga0157372_110038782 192
336 3300025909 Ga0207705_10000417 Ga0207705_1000041722 192
337 3300025909 Ga0207705_10131596 Ga0207705_101315962 192
338 3300025912 Ga0207707_10023815 Ga0207707_100238154 192
339 3300025917 Ga0207660_10153857 Ga0207660_101538572 192
340 3300025917 Ga0207660_10649756 Ga0207660_106497561 192
341 3300025919 Ga0207657_10029411 Ga0207657_100294113 192
342 3300025919 Ga0207657_10085052 Ga0207657_100850523 192
343 3300025921 Ga0207652_10011781 Ga0207652_100117812 192
344 3300025921 Ga0207652_10752259 Ga0207652_107522591 192
345 3300025944 Ga0207661_10016854 Ga0207661_100168543 192
346 3300025949 Ga0207667_11014598 Ga0207667_110145982 192
347 3300026067 Ga0207678_10933606 Ga0207678_109336061 192
348 3300026078 Ga0207702_10494578 Ga0207702_104945781 192
349 3300033179 Ga0307507_10000732 Ga0307507_1000073219 192
350 3300044656 Ga0466969_0015870 Ga0466969_0015870_583_1167 192
351 3300044656 Ga0466969_0037936 Ga0466969_0037936_542_1126 192
352 3300044684 Ga0466966_0006103 Ga0466966_0006103_4857_5441 192
353 3300044693 Ga0466961_0104524 Ga0466961_0104524_1174_1755 192
354 3300044693 Ga0466961_0511875 Ga0466961_0511875_85_669 192
355 3300044719 Ga0466971_0012838 Ga0466971_0012838_78_662 192
356 3300044765 Ga0466970_0146484 Ga0466970_0146484_338_922 192
357 3300049588 Ga0501072_0590713 Ga0501072_0590713_155_757 192
358 3300049741 Ga0501079_0337213 Ga0501079_0337213_140_742 192
359 3300061719 Ga0466962_0044966 Ga0466962_0044966_269_853 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

39

227

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9792 5 192
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9777 5 182
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.973 7 188
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9661 6 182
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9617 9 191
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9605 9 192 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9443 9 192 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9422 5 184 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9388 6 191 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9322 4 191 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A1Q9TJ95-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9964 5 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A4R2DKB0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9955 9 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A354XPW4-F1-model_v4 deleted 0.994 8 192
AF-A0A6I4PFW5-F1-model_v4 deleted 0.9925 8 190
AF-A0A8A6AQC1-F1-model_v4 deleted 0.992 7 189

Feature Viewer

pLDDT pTM Quality
95.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map