F421627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 196 | 353 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0103602|Ga0495629_0103602_1106_1792 |
| Length | 228 |
| Sequence | VTLPRLPGWLRRRSAPAGAPIQENDDMTGSTGSTSDVWLVVGLGNPGPSYAGHRHNVGYLVADVLAERMGSDFRAHKSGRAAVVEGRVTPPGVVGPRVVLARPRSYMNETGGPVKQLAAFYKVPHERIVVVHDELDLPFDTMRVKLGGGDNGHNGLRSVRQALGTGDFYRVRVGIGRPRGRQDVADFVLSDYSAGERRMLPLQVATAADAVESLLTEGLDRTQSRFNS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 2 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 3 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 4 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 5 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 124 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 127 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 196 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.1 |
| Metatranscriptomes | 2.23 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.75 |
| Rhizosphere | 84.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10055345 | 3300005327 | Bacteria | 3223 |
| 2 | Ga0070658_10159697 | 3300005327 | Bacteria | 1891 |
| 3 | Ga0070658_10207971 | 3300005327 | Bacteria | 1652 |
| 4 | Ga0070683_100106926 | 3300005329 | Bacteria | 2638 |
| 5 | Ga0070683_100330971 | 3300005329 | Bacteria | 1450 |
| 6 | Ga0070683_100341351 | 3300005329 | Bacteria | 1426 |
| 7 | Ga0070683_100414864 | 3300005329 | Bacteria | 1284 |
| 8 | Ga0070683_100666932 | 3300005329 | Bacteria | 996 |
| 9 | Ga0070690_100028652 | 3300005330 | Bacteria | 3450 |
| 10 | Ga0068869_100146785 | 3300005334 | Bacteria | 1826 |
| 11 | Ga0070666_10155150 | 3300005335 | Bacteria | 1599 |
| 12 | Ga0070680_100001726 | 3300005336 | Bacteria | 16048 |
| 13 | Ga0070680_100218819 | 3300005336 | Bacteria | 1607 |
| 14 | Ga0070680_100270713 | 3300005336 | Bacteria | 1438 |
| 15 | Ga0070680_100314551 | 3300005336 | Bacteria | 1329 |
| 16 | Ga0070680_100392588 | 3300005336 | Bacteria | 1182 |
| 17 | Ga0070682_100838122 | 3300005337 | Bacteria | 750 |
| 18 | Ga0070660_100022174 | 3300005339 | Bacteria | 4693 |
| 19 | Ga0070660_100233470 | 3300005339 | Bacteria | 1497 |
| 20 | Ga0070660_100239452 | 3300005339 | Bacteria | 1478 |
| 21 | Ga0070660_100485638 | 3300005339 | Bacteria | 1027 |
| 22 | Ga0070660_100566953 | 3300005339 | Bacteria | 948 |
| 23 | Ga0070687_100152294 | 3300005343 | Bacteria | 1358 |
| 24 | Ga0070661_100480239 | 3300005344 | Bacteria | 992 |
| 25 | Ga0070668_100617203 | 3300005347 | Bacteria | 950 |
| 26 | Ga0070675_100779829 | 3300005354 | Bacteria | 873 |
| 27 | Ga0070671_100004596 | 3300005355 | Bacteria | 10940 |
| 28 | Ga0070674_101105372 | 3300005356 | Bacteria | 700 |
| 29 | Ga0070659_100001340 | 3300005366 | Bacteria | 17722 |
| 30 | Ga0070659_100023145 | 3300005366 | Bacteria | 4750 |
| 31 | Ga0070659_100349818 | 3300005366 | Bacteria | 1239 |
| 32 | Ga0070667_100118668 | 3300005367 | Bacteria | 2299 |
| 33 | Ga0070709_10173044 | 3300005434 | Bacteria | 1510 |
| 34 | Ga0070713_100049638 | 3300005436 | Bacteria | 3463 |
| 35 | Ga0070705_100261041 | 3300005440 | Bacteria | 1221 |
| 36 | Ga0070700_100000021 | 3300005441 | Bacteria | 130127 |
| 37 | Ga0070700_100633708 | 3300005441 | Bacteria | 842 |
| 38 | Ga0070663_100040703 | 3300005455 | Bacteria | 3255 |
| 39 | Ga0070678_100120864 | 3300005456 | Bacteria | 2065 |
| 40 | Ga0070681_10003785 | 3300005458 | Bacteria | 14216 |
| 41 | Ga0070681_10004181 | 3300005458 | Bacteria | 13668 |
| 42 | Ga0070681_10022088 | 3300005458 | Bacteria | 6386 |
| 43 | Ga0070681_10449901 | 3300005458 | Bacteria | 1200 |
| 44 | Ga0070681_10527782 | 3300005458 | Bacteria | 1094 |
| 45 | Ga0070679_100000128 | 3300005530 | Bacteria | 60863 |
| 46 | Ga0070679_100002298 | 3300005530 | Bacteria | 17283 |
| 47 | Ga0070679_100011389 | 3300005530 | Bacteria | 8474 |
| 48 | Ga0070679_100317604 | 3300005530 | Bacteria | 1507 |
| 49 | Ga0070679_100412430 | 3300005530 | Bacteria | 1296 |
| 50 | Ga0070679_100739027 | 3300005530 | Bacteria | 927 |
| 51 | Ga0070684_100262900 | 3300005535 | Bacteria | 1579 |
| 52 | Ga0070684_100785001 | 3300005535 | Bacteria | 890 |
| 53 | Ga0068853_100166981 | 3300005539 | Bacteria | 1989 |
| 54 | Ga0070665_100001490 | 3300005548 | Bacteria | 27321 |
| 55 | Ga0068855_100618795 | 3300005563 | Bacteria | 1166 |
| 56 | Ga0068855_100942143 | 3300005563 | Bacteria | 910 |
| 57 | Ga0068855_101050446 | 3300005563 | Bacteria | 854 |
| 58 | Ga0068852_101450171 | 3300005616 | Bacteria | 709 |
| 59 | Ga0068859_100617693 | 3300005617 | Bacteria | 1177 |
| 60 | Ga0068864_100511945 | 3300005618 | Bacteria | 1156 |
| 61 | Ga0068866_10191254 | 3300005718 | Bacteria | 1216 |
| 62 | Ga0068851_10074902 | 3300005834 | Bacteria | 1758 |
| 63 | Ga0068870_10239699 | 3300005840 | Bacteria | 1119 |
| 64 | Ga0068863_100001613 | 3300005841 | Bacteria | 22293 |
| 65 | Ga0068863_100007236 | 3300005841 | Bacteria | 10879 |
| 66 | Ga0068863_100020259 | 3300005841 | Bacteria | 6361 |
| 67 | Ga0068858_100128762 | 3300005842 | Bacteria | 2372 |
| 68 | Ga0068860_100000195 | 3300005843 | Bacteria | 97163 |
| 69 | Ga0081455_10003959 | 3300005937 | Bacteria | 16820 |
| 70 | Ga0081455_10004443 | 3300005937 | Bacteria | 15732 |
| 71 | Ga0081455_10037340 | 3300005937 | Bacteria | 4316 |
| 72 | Ga0081455_10059691 | 3300005937 | Bacteria | 3219 |
| 73 | Ga0070717_10067485 | 3300006028 | Bacteria | 2976 |
| 74 | Ga0070716_100029457 | 3300006173 | Bacteria | 2968 |
| 75 | Ga0097621_101053261 | 3300006237 | Bacteria | 762 |
| 76 | Ga0075428_100000631 | 3300006844 | Bacteria | 36078 |
| 77 | Ga0075430_100473990 | 3300006846 | Bacteria | 1033 |
| 78 | Ga0075431_100000069 | 3300006847 | Bacteria | 59736 |
| 79 | Ga0075433_10020028 | 3300006852 | Bacteria | 5587 |
| 80 | Ga0075429_100246547 | 3300006880 | Bacteria | 1564 |
| 81 | Ga0097620_100617650 | 3300006931 | Bacteria | 1177 |
| 82 | Ga0075435_100008153 | 3300007076 | Bacteria | 7502 |
| 83 | Ga0105240_10397625 | 3300009093 | Bacteria | 1553 |
| 84 | Ga0105240_10425772 | 3300009093 | Bacteria | 1490 |
| 85 | Ga0105245_10005593 | 3300009098 | Bacteria | 11040 |
| 86 | Ga0105245_10019677 | 3300009098 | Bacteria | 5916 |
| 87 | Ga0105247_10107819 | 3300009101 | Bacteria | 1789 |
| 88 | Ga0105247_10201308 | 3300009101 | Bacteria | 1338 |
| 89 | Ga0105243_10006420 | 3300009148 | Bacteria | 9088 |
| 90 | Ga0105241_10209602 | 3300009174 | Bacteria | 1632 |
| 91 | Ga0105242_10343434 | 3300009176 | Bacteria | 1376 |
| 92 | Ga0105248_10272627 | 3300009177 | Bacteria | 1905 |
| 93 | Ga0105237_10017439 | 3300009545 | Bacteria | 7443 |
| 94 | Ga0105237_10085832 | 3300009545 | Bacteria | 3137 |
| 95 | Ga0105237_10324807 | 3300009545 | Bacteria | 1542 |
| 96 | Ga0105238_10061475 | 3300009551 | Bacteria | 3759 |
| 97 | Ga0105238_10205943 | 3300009551 | Bacteria | 1943 |
| 98 | Ga0105249_10007621 | 3300009553 | Bacteria | 9443 |
| 99 | Ga0105249_10677807 | 3300009553 | Bacteria | 1090 |
| 100 | Ga0105246_10009256 | 3300011119 | Bacteria | 6068 |
| 101 | Ga0157371_10084184 | 3300013102 | Bacteria | 2252 |
| 102 | Ga0157371_10941969 | 3300013102 | Bacteria | 656 |
| 103 | Ga0157370_10026852 | 3300013104 | Bacteria | 5679 |
| 104 | Ga0157370_10725106 | 3300013104 | Bacteria | 906 |
| 105 | Ga0157369_10028377 | 3300013105 | Bacteria | 6194 |
| 106 | Ga0157369_10032469 | 3300013105 | Bacteria | 5741 |
| 107 | Ga0157369_10057105 | 3300013105 | Bacteria | 4212 |
| 108 | Ga0157369_10123892 | 3300013105 | Bacteria | 2741 |
| 109 | Ga0157369_10237859 | 3300013105 | Bacteria | 1902 |
| 110 | Ga0157369_10257231 | 3300013105 | Bacteria | 1821 |
| 111 | Ga0163162_10010160 | 3300013306 | Bacteria | 9144 |
| 112 | Ga0163162_10169816 | 3300013306 | Bacteria | 2306 |
| 113 | Ga0157372_10037238 | 3300013307 | Bacteria | 5364 |
| 114 | Ga0157372_11003878 | 3300013307 | Bacteria | 967 |
| 115 | Ga0157372_11482152 | 3300013307 | Bacteria | 782 |
| 116 | Ga0157375_10000958 | 3300013308 | Bacteria | 24975 |
| 117 | Ga0157375_10339586 | 3300013308 | Bacteria | 1667 |
| 118 | Ga0163163_10133565 | 3300014325 | Bacteria | 2522 |
| 119 | Ga0157380_10145822 | 3300014326 | Bacteria | 2040 |
| 120 | Ga0157380_10939116 | 3300014326 | Bacteria | 894 |
| 121 | Ga0157379_10018519 | 3300014968 | Bacteria | 6143 |
| 122 | Ga0157379_10036370 | 3300014968 | Bacteria | 4391 |
| 123 | Ga0157379_10200234 | 3300014968 | Bacteria | 1806 |
| 124 | Ga0157376_10108525 | 3300014969 | Bacteria | 2438 |
| 125 | Ga0157376_10143382 | 3300014969 | Bacteria | 2146 |
| 126 | Ga0163161_10007157 | 3300017792 | Bacteria | 7714 |
| 127 | Ga0206354_10521760 | 3300020081 | Bacteria | 1578 |
| 128 | Ga0206353_10971152 | 3300020082 | Bacteria | 1684 |
| 129 | Ga0206353_11016463 | 3300020082 | Bacteria | 2490 |
| 130 | Ga0206353_11198684 | 3300020082 | Bacteria | 6998 |
| 131 | Ga0206353_11260483 | 3300020082 | Bacteria | 768 |
| 132 | Ga0206353_11569373 | 3300020082 | Bacteria | 1072 |
| 133 | Ga0206353_11922679 | 3300020082 | Bacteria | 2280 |
| 134 | Ga0224712_10051659 | 3300022467 | Bacteria | 1602 |
| 135 | Ga0207642_10057002 | 3300025899 | Bacteria | 1795 |
| 136 | Ga0207710_10002313 | 3300025900 | Bacteria | 8902 |
| 137 | Ga0207710_10194203 | 3300025900 | Bacteria | 1000 |
| 138 | Ga0207710_10255763 | 3300025900 | Bacteria | 877 |
| 139 | Ga0207699_10201713 | 3300025906 | Bacteria | 1348 |
| 140 | Ga0207705_10000417 | 3300025909 | Bacteria | 37398 |
| 141 | Ga0207705_10131596 | 3300025909 | Bacteria | 1862 |
| 142 | Ga0207707_10000199 | 3300025912 | Bacteria | 63720 |
| 143 | Ga0207707_10023815 | 3300025912 | Bacteria | 5354 |
| 144 | Ga0207707_10030550 | 3300025912 | Bacteria | 4714 |
| 145 | Ga0207671_10014977 | 3300025914 | Bacteria | 6094 |
| 146 | Ga0207693_10002732 | 3300025915 | Bacteria | 15275 |
| 147 | Ga0207660_10001441 | 3300025917 | Bacteria | 15957 |
| 148 | Ga0207660_10153857 | 3300025917 | Bacteria | 1769 |
| 149 | Ga0207660_10386105 | 3300025917 | Bacteria | 1126 |
| 150 | Ga0207660_10649756 | 3300025917 | Bacteria | 860 |
| 151 | Ga0207662_10068731 | 3300025918 | Bacteria | 2140 |
| 152 | Ga0207657_10029411 | 3300025919 | Bacteria | 5001 |
| 153 | Ga0207657_10071855 | 3300025919 | Bacteria | 2929 |
| 154 | Ga0207657_10085052 | 3300025919 | Bacteria | 2650 |
| 155 | Ga0207657_10244744 | 3300025919 | Bacteria | 1431 |
| 156 | Ga0207657_10248326 | 3300025919 | Bacteria | 1419 |
| 157 | Ga0207652_10000199 | 3300025921 | Bacteria | 63364 |
| 158 | Ga0207652_10004586 | 3300025921 | Bacteria | 11210 |
| 159 | Ga0207652_10011781 | 3300025921 | Bacteria | 7058 |
| 160 | Ga0207652_10310130 | 3300025921 | Bacteria | 1424 |
| 161 | Ga0207652_10413229 | 3300025921 | Bacteria | 1217 |
| 162 | Ga0207652_10752259 | 3300025921 | Bacteria | 867 |
| 163 | Ga0207687_10226144 | 3300025927 | Bacteria | 1476 |
| 164 | Ga0207687_10384489 | 3300025927 | Bacteria | 1151 |
| 165 | Ga0207700_10081676 | 3300025928 | Bacteria | 2525 |
| 166 | Ga0207690_10002301 | 3300025932 | Bacteria | 11642 |
| 167 | Ga0207706_10011004 | 3300025933 | Bacteria | 8249 |
| 168 | Ga0207709_10603325 | 3300025935 | Bacteria | 869 |
| 169 | Ga0207704_10062725 | 3300025938 | Bacteria | 2313 |
| 170 | Ga0207711_10489734 | 3300025941 | Bacteria | 1146 |
| 171 | Ga0207661_10016854 | 3300025944 | Bacteria | 5396 |
| 172 | Ga0207661_10115889 | 3300025944 | Bacteria | 2274 |
| 173 | Ga0207661_10821212 | 3300025944 | Bacteria | 856 |
| 174 | Ga0207679_10382397 | 3300025945 | Bacteria | 1234 |
| 175 | Ga0207667_10294114 | 3300025949 | Bacteria | 1659 |
| 176 | Ga0207667_10596855 | 3300025949 | Bacteria | 1114 |
| 177 | Ga0207667_11014598 | 3300025949 | Bacteria | 816 |
| 178 | Ga0207668_10102293 | 3300025972 | Bacteria | 2131 |
| 179 | Ga0207658_10089789 | 3300025986 | Bacteria | 2380 |
| 180 | Ga0207658_10103800 | 3300025986 | Bacteria | 2232 |
| 181 | Ga0207677_10538921 | 3300026023 | Bacteria | 1015 |
| 182 | Ga0207678_10035541 | 3300026067 | Bacteria | 4338 |
| 183 | Ga0207678_10933606 | 3300026067 | Bacteria | 767 |
| 184 | Ga0207708_10000025 | 3300026075 | Bacteria | 169896 |
| 185 | Ga0207702_10145154 | 3300026078 | Bacteria | 2152 |
| 186 | Ga0207702_10494578 | 3300026078 | Bacteria | 1192 |
| 187 | Ga0207641_10020944 | 3300026088 | Bacteria | 5375 |
| 188 | Ga0207641_10204571 | 3300026088 | Bacteria | 1822 |
| 189 | Ga0207676_10146390 | 3300026095 | Bacteria | 2029 |
| 190 | Ga0207676_10256190 | 3300026095 | Bacteria | 1577 |
| 191 | Ga0207683_10000893 | 3300026121 | Bacteria | 27409 |
| 192 | Ga0207698_10371238 | 3300026142 | Bacteria | 1358 |
| 193 | Ga0268266_10002106 | 3300028379 | Bacteria | 21983 |
| 194 | Ga0268266_11012021 | 3300028379 | Bacteria | 804 |
| 195 | Ga0268264_10000239 | 3300028381 | Bacteria | 104914 |
| 196 | Ga0265338_10065957 | 3300028800 | Bacteria | 3136 |
| 197 | Ga0265325_10059261 | 3300031241 | Bacteria | 1947 |
| 198 | Ga0265325_10214414 | 3300031241 | Bacteria | 883 |
| 199 | Ga0265325_10236339 | 3300031241 | Bacteria | 831 |
| 200 | Ga0265339_10010851 | 3300031249 | Bacteria | 5635 |
| 201 | Ga0265316_10073469 | 3300031344 | Bacteria | 2634 |
| 202 | Ga0265313_10032651 | 3300031595 | Bacteria | 2654 |
| 203 | Ga0265314_10053473 | 3300031711 | Bacteria | 2800 |
| 204 | Ga0265342_10242795 | 3300031712 | Bacteria | 964 |
| 205 | Ga0265342_10270064 | 3300031712 | Bacteria | 903 |
| 206 | Ga0307413_10731188 | 3300031824 | Bacteria | 825 |
| 207 | Ga0307415_100255352 | 3300032126 | Bacteria | 1427 |
| 208 | Ga0307507_10000732 | 3300033179 | Bacteria | 72083 |
| 209 | Ga0307510_10069898 | 3300033180 | Bacteria | 3512 |
| 210 | Ga0373930_0003350 | 3300034816 | Bacteria | 2536 |
| 211 | Ga0373928_0026433 | 3300035084 | Bacteria | 1257 |
| 212 | Ga0373940_0221513 | 3300035088 | Bacteria | 629 |
| 213 | Ga0373952_0072333 | 3300035092 | Bacteria | 865 |
| 214 | Ga0373923_0419919 | 3300035111 | Bacteria | 646 |
| 215 | Ga0373942_0033053 | 3300035207 | Bacteria | 1378 |
| 216 | Ga0373962_0139931 | 3300035242 | Bacteria | 785 |
| 217 | Ga0373927_0029796 | 3300035695 | Bacteria | 3559 |
| 218 | Ga0395900_0084948 | 3300037418 | Bacteria | 3253 |
| 219 | Ga0395898_0467141 | 3300037466 | Bacteria | 1201 |
| 220 | Ga0436364_0095699 | 3300037853 | Bacteria | 4117 |
| 221 | Ga0395901_0299670 | 3300038443 | Bacteria | 1667 |
| 222 | Ga0466969_0008121 | 3300044656 | Bacteria | 5571 |
| 223 | Ga0466969_0015870 | 3300044656 | Bacteria | 3947 |
| 224 | Ga0466969_0037936 | 3300044656 | Bacteria | 2428 |
| 225 | Ga0466969_0045013 | 3300044656 | Bacteria | 2192 |
| 226 | Ga0466969_0056127 | 3300044656 | Bacteria | 1924 |
| 227 | Ga0466969_0063295 | 3300044656 | Bacteria | 1793 |
| 228 | Ga0466972_0021218 | 3300044658 | Bacteria | 3240 |
| 229 | Ga0466972_0039920 | 3300044658 | Bacteria | 2289 |
| 230 | Ga0466965_0015465 | 3300044683 | Bacteria | 3625 |
| 231 | Ga0466966_0002957 | 3300044684 | Bacteria | 11182 |
| 232 | Ga0466966_0006103 | 3300044684 | Bacteria | 7959 |
| 233 | Ga0466966_0051716 | 3300044684 | Bacteria | 2611 |
| 234 | Ga0466966_0154623 | 3300044684 | Bacteria | 1398 |
| 235 | Ga0466966_0297432 | 3300044684 | Bacteria | 970 |
| 236 | Ga0466961_0015642 | 3300044693 | Bacteria | 4868 |
| 237 | Ga0466961_0026287 | 3300044693 | Bacteria | 3742 |
| 238 | Ga0466961_0042486 | 3300044693 | Bacteria | 2914 |
| 239 | Ga0466961_0104524 | 3300044693 | Bacteria | 1783 |
| 240 | Ga0466961_0290363 | 3300044693 | Bacteria | 1000 |
| 241 | Ga0466961_0511875 | 3300044693 | Bacteria | 724 |
| 242 | Ga0466961_0532712 | 3300044693 | Bacteria | 708 |
| 243 | Ga0466963_0011619 | 3300044694 | Bacteria | 5360 |
| 244 | Ga0466963_0024570 | 3300044694 | Bacteria | 3835 |
| 245 | Ga0466963_0027631 | 3300044694 | Bacteria | 3635 |
| 246 | Ga0466963_0048266 | 3300044694 | Bacteria | 2812 |
| 247 | Ga0466963_0064096 | 3300044694 | Bacteria | 2461 |
| 248 | Ga0466963_0073306 | 3300044694 | Bacteria | 2308 |
| 249 | Ga0466963_0423845 | 3300044694 | Bacteria | 938 |
| 250 | Ga0466963_0524111 | 3300044694 | Bacteria | 837 |
| 251 | Ga0466971_0007204 | 3300044719 | Bacteria | 4843 |
| 252 | Ga0466971_0012838 | 3300044719 | Bacteria | 3672 |
| 253 | Ga0466971_0103350 | 3300044719 | Bacteria | 1311 |
| 254 | Ga0466968_0053549 | 3300044735 | Bacteria | 1729 |
| 255 | Ga0466970_0018589 | 3300044765 | Bacteria | 3600 |
| 256 | Ga0466970_0146484 | 3300044765 | Bacteria | 1303 |
| 257 | Ga0466970_0636793 | 3300044765 | Bacteria | 620 |
| 258 | Ga0466957_0023720 | 3300044842 | Bacteria | 3629 |
| 259 | Ga0466957_0069977 | 3300044842 | Bacteria | 2168 |
| 260 | Ga0466957_0241002 | 3300044842 | Bacteria | 1200 |
| 261 | Ga0466960_0007176 | 3300044901 | Bacteria | 4510 |
| 262 | Ga0466959_0100283 | 3300045049 | Bacteria | 2073 |
| 263 | Ga0466959_0406315 | 3300045049 | Bacteria | 925 |
| 264 | Ga0466958_0011749 | 3300045836 | Bacteria | 4943 |
| 265 | Ga0466958_0370440 | 3300045836 | Bacteria | 923 |
| 266 | Ga0466958_0624243 | 3300045836 | Bacteria | 701 |
| 267 | Ga0466958_0737696 | 3300045836 | Bacteria | 642 |
| 268 | Ga0466967_0001337 | 3300045976 | Bacteria | 14137 |
| 269 | Ga0466967_0009716 | 3300045976 | Bacteria | 7163 |
| 270 | Ga0466967_0102321 | 3300045976 | Bacteria | 2620 |
| 271 | Ga0466967_0131502 | 3300045976 | Bacteria | 2324 |
| 272 | Ga0466967_0362379 | 3300045976 | Bacteria | 1405 |
| 273 | Ga0466967_0394175 | 3300045976 | Bacteria | 1346 |
| 274 | Ga0466967_0431712 | 3300045976 | Bacteria | 1285 |
| 275 | Ga0466967_0790247 | 3300045976 | Bacteria | 942 |
| 276 | Ga0466967_0843883 | 3300045976 | Bacteria | 910 |
| 277 | Ga0466967_0896667 | 3300045976 | Bacteria | 882 |
| 278 | Ga0466967_1029886 | 3300045976 | Bacteria | 820 |
| 279 | Ga0495603_0199295 | 3300046455 | Bacteria | 1157 |
| 280 | Ga0495629_0103602 | 3300046459 | Bacteria | 1985 |
| 281 | Ga0495641_0080842 | 3300046461 | Bacteria | 1456 |
| 282 | Ga0495635_0281568 | 3300046663 | Bacteria | 1117 |
| 283 | Ga0495658_0543632 | 3300046683 | Bacteria | 744 |
| 284 | Ga0495674_0664400 | 3300047319 | Bacteria | 821 |
| 285 | Ga0495676_0508712 | 3300047321 | Bacteria | 790 |
| 286 | Ga0495593_0050793 | 3300047673 | Bacteria | 2196 |
| 287 | Ga0496100_0068687 | 3300048903 | Bacteria | 2357 |
| 288 | Ga0496100_0267982 | 3300048903 | Bacteria | 1269 |
| 289 | Ga0496100_0623512 | 3300048903 | Bacteria | 839 |
| 290 | Ga0496101_0015012 | 3300048904 | Bacteria | 5212 |
| 291 | Ga0496101_0079797 | 3300048904 | Bacteria | 2416 |
| 292 | Ga0496101_0178704 | 3300048904 | Bacteria | 1633 |
| 293 | Ga0496102_0000048 | 3300048905 | Bacteria | 179713 |
| 294 | Ga0496102_0000264 | 3300048905 | Bacteria | 67050 |
| 295 | Ga0496102_0000324 | 3300048905 | Bacteria | 59699 |
| 296 | Ga0496102_0068905 | 3300048905 | Bacteria | 3247 |
| 297 | Ga0496102_0337659 | 3300048905 | Bacteria | 1419 |
| 298 | Ga0496102_0508884 | 3300048905 | Bacteria | 1126 |
| 299 | Ga0496103_0000018 | 3300048906 | Bacteria | 239585 |
| 300 | Ga0496103_0001057 | 3300048906 | Bacteria | 19207 |
| 301 | Ga0496103_0018301 | 3300048906 | Bacteria | 4202 |
| 302 | Ga0496103_0133272 | 3300048906 | Bacteria | 1587 |
| 303 | Ga0496104_0070678 | 3300048907 | Bacteria | 3319 |
| 304 | Ga0496104_0087451 | 3300048907 | Bacteria | 2976 |
| 305 | Ga0496105_0162355 | 3300048908 | Bacteria | 1834 |
| 306 | Ga0496105_0523501 | 3300048908 | Bacteria | 928 |
| 307 | Ga0496107_0081885 | 3300048910 | Bacteria | 2354 |
| 308 | Ga0496108_0028490 | 3300048911 | Bacteria | 4621 |
| 309 | Ga0496108_0078875 | 3300048911 | Bacteria | 2787 |
| 310 | Ga0496109_0000602 | 3300048912 | Bacteria | 30110 |
| 311 | Ga0496110_0067527 | 3300048913 | Bacteria | 3164 |
| 312 | Ga0496110_0443671 | 3300048913 | Bacteria | 1183 |
| 313 | Ga0496110_0608855 | 3300048913 | Bacteria | 991 |
| 314 | Ga0496111_0260403 | 3300048914 | Bacteria | 1287 |
| 315 | Ga0496111_0265487 | 3300048914 | Bacteria | 1273 |
| 316 | Ga0496112_0001815 | 3300048915 | Bacteria | 16806 |
| 317 | Ga0496113_0007030 | 3300048916 | Bacteria | 7199 |
| 318 | Ga0496114_0065415 | 3300048917 | Bacteria | 3046 |
| 319 | Ga0496114_0317089 | 3300048917 | Bacteria | 1377 |
| 320 | Ga0496114_0964044 | 3300048917 | Bacteria | 735 |
| 321 | Ga0496115_0090505 | 3300048918 | Bacteria | 2499 |
| 322 | Ga0496116_0000197 | 3300048919 | Bacteria | 120256 |
| 323 | Ga0496117_0000879 | 3300048920 | Bacteria | 46401 |
| 324 | Ga0496117_0389907 | 3300048920 | Bacteria | 706 |
| 325 | Ga0496118_0000172 | 3300048921 | Bacteria | 116150 |
| 326 | Ga0496119_0000253 | 3300048922 | Bacteria | 75779 |
| 327 | Ga0496119_0048767 | 3300048922 | Bacteria | 2623 |
| 328 | Ga0496120_0002248 | 3300048923 | Bacteria | 20168 |
| 329 | Ga0496120_0006132 | 3300048923 | Bacteria | 9322 |
| 330 | Ga0496121_0002921 | 3300048924 | Bacteria | 25037 |
| 331 | Ga0496121_0042364 | 3300048924 | Bacteria | 3962 |
| 332 | Ga0496122_0294392 | 3300048925 | Bacteria | 879 |
| 333 | Ga0496125_0091940 | 3300048928 | Bacteria | 2270 |
| 334 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 335 | Ga0496126_0000040 | 3300048929 | Bacteria | 345144 |
| 336 | Ga0496126_0000869 | 3300048929 | Bacteria | 53155 |
| 337 | Ga0501047_0000037 | 3300049581 | Bacteria | 189750 |
| 338 | Ga0501068_0233887 | 3300049584 | Bacteria | 1169 |
| 339 | Ga0501069_0415029 | 3300049585 | Bacteria | 797 |
| 340 | Ga0501070_0012548 | 3300049586 | Bacteria | 7146 |
| 341 | Ga0501072_0590713 | 3300049588 | Bacteria | 876 |
| 342 | Ga0501074_0022648 | 3300049590 | Bacteria | 4567 |
| 343 | Ga0501079_0337213 | 3300049741 | Bacteria | 1181 |
| 344 | Ga0501080_0003628 | 3300049742 | Bacteria | 13607 |
| 345 | Ga0501080_0032493 | 3300049742 | Bacteria | 4868 |
| 346 | Ga0501080_0335813 | 3300049742 | Bacteria | 1366 |
| 347 | Ga0501045_0192914 | 3300049824 | Bacteria | 1518 |
| 348 | nmdc:mga09592_161497_c1 | 3300050508 | Bacteria | 1936 |
| 349 | nmdc:mga0qj67_401680_c1 | 3300050509 | Bacteria | 1106 |
| 350 | nmdc:mga0rr50_71714_c1 | 3300050513 | Bacteria | 2644 |
| 351 | nmdc:mga08x19_11020_c1 | 3300050514 | Bacteria | 5440 |
| 352 | nmdc:mga0a205_476961_c1 | 3300050515 | Bacteria | 1106 |
| 353 | Ga0466962_0044966 | 3300061719 | Bacteria | 2111 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_101053261 | Ga0097621_1010532611 | 162 |
| 2 | 3300013308 | Ga0157375_10339586 | Ga0157375_103395862 | 162 |
| 3 | 3300014969 | Ga0157376_10143382 | Ga0157376_101433822 | 162 |
| 4 | 3300045836 | Ga0466958_0737696 | Ga0466958_0737696_43_534 | 163 |
| 5 | 3300048916 | Ga0496113_0007030 | Ga0496113_0007030_6676_7167 | 163 |
| 6 | 3300048917 | Ga0496114_0065415 | Ga0496114_0065415_15_506 | 163 |
| 7 | 3300013102 | Ga0157371_10941969 | Ga0157371_109419691 | 167 |
| 8 | 3300045976 | Ga0466967_0843883 | Ga0466967_0843883_130_744 | 178 |
| 9 | 3300044658 | Ga0466972_0021218 | Ga0466972_0021218_456_1052 | 182 |
| 10 | 3300044683 | Ga0466965_0015465 | Ga0466965_0015465_2086_2682 | 182 |
| 11 | 3300044719 | Ga0466971_0103350 | Ga0466971_0103350_75_671 | 182 |
| 12 | 3300044765 | Ga0466970_0018589 | Ga0466970_0018589_1423_2019 | 182 |
| 13 | 3300044842 | Ga0466957_0023720 | Ga0466957_0023720_1201_1797 | 182 |
| 14 | 3300044901 | Ga0466960_0007176 | Ga0466960_0007176_2150_2746 | 182 |
| 15 | 3300045836 | Ga0466958_0624243 | Ga0466958_0624243_80_676 | 182 |
| 16 | 3300048917 | Ga0496114_0317089 | Ga0496114_0317089_93_644 | 182 |
| 17 | 3300005434 | Ga0070709_10173044 | Ga0070709_101730441 | 186 |
| 18 | 3300034816 | Ga0373930_0003350 | Ga0373930_0003350_1914_2474 | 186 |
| 19 | 3300035088 | Ga0373940_0221513 | Ga0373940_0221513_47_607 | 186 |
| 20 | 3300035092 | Ga0373952_0072333 | Ga0373952_0072333_266_826 | 186 |
| 21 | 3300044694 | Ga0466963_0073306 | Ga0466963_0073306_922_1500 | 186 |
| 22 | 3300049590 | Ga0501074_0022648 | Ga0501074_0022648_2601_3200 | 186 |
| 23 | 3300049742 | Ga0501080_0032493 | Ga0501080_0032493_202_801 | 186 |
| 24 | iso_pu_bacteria | 2816332119 | 2816420640 | 186 |
| 25 | iso_pu_bacteria | 2974315732 | 2974318480 | 186 |
| 26 | iso_pu_bacteria | 2984523437 | 2984526690 | 186 |
| 27 | 3300005618 | Ga0068864_100511945 | Ga0068864_1005119452 | 187 |
| 28 | 3300005841 | Ga0068863_100007236 | Ga0068863_1000072367 | 187 |
| 29 | 3300009101 | Ga0105247_10201308 | Ga0105247_102013082 | 187 |
| 30 | 3300014968 | Ga0157379_10036370 | Ga0157379_100363702 | 187 |
| 31 | 3300025900 | Ga0207710_10194203 | Ga0207710_101942032 | 187 |
| 32 | 3300026088 | Ga0207641_10204571 | Ga0207641_102045713 | 187 |
| 33 | 3300026095 | Ga0207676_10256190 | Ga0207676_102561902 | 187 |
| 34 | 3300048903 | Ga0496100_0068687 | Ga0496100_0068687_972_1544 | 187 |
| 35 | 3300048904 | Ga0496101_0015012 | Ga0496101_0015012_3786_4358 | 187 |
| 36 | 3300048905 | Ga0496102_0000048 | Ga0496102_0000048_134166_134738 | 187 |
| 37 | 3300048906 | Ga0496103_0000018 | Ga0496103_0000018_160004_160576 | 187 |
| 38 | 3300048907 | Ga0496104_0070678 | Ga0496104_0070678_1064_1636 | 187 |
| 39 | 3300048913 | Ga0496110_0067527 | Ga0496110_0067527_1766_2338 | 187 |
| 40 | 3300048914 | Ga0496111_0260403 | Ga0496111_0260403_116_688 | 187 |
| 41 | 3300048919 | Ga0496116_0000197 | Ga0496116_0000197_74727_75299 | 187 |
| 42 | 3300048920 | Ga0496117_0000879 | Ga0496117_0000879_876_1448 | 187 |
| 43 | 3300048921 | Ga0496118_0000172 | Ga0496118_0000172_79012_79584 | 187 |
| 44 | 3300048922 | Ga0496119_0048767 | Ga0496119_0048767_1178_1750 | 187 |
| 45 | 3300048923 | Ga0496120_0006132 | Ga0496120_0006132_859_1431 | 187 |
| 46 | 3300048924 | Ga0496121_0002921 | Ga0496121_0002921_4207_4779 | 187 |
| 47 | 3300048925 | Ga0496122_0294392 | Ga0496122_0294392_250_822 | 187 |
| 48 | 3300048928 | Ga0496125_0091940 | Ga0496125_0091940_184_756 | 187 |
| 49 | 3300048929 | Ga0496126_0000869 | Ga0496126_0000869_36576_37148 | 187 |
| 50 | 3300005327 | Ga0070658_10159697 | Ga0070658_101596972 | 188 |
| 51 | 3300009101 | Ga0105247_10107819 | Ga0105247_101078193 | 188 |
| 52 | 3300020082 | Ga0206353_11260483 | Ga0206353_112604832 | 188 |
| 53 | 3300025900 | Ga0207710_10002313 | Ga0207710_100023136 | 188 |
| 54 | 3300025921 | Ga0207652_10004586 | Ga0207652_100045864 | 188 |
| 55 | 3300048904 | Ga0496101_0178704 | Ga0496101_0178704_931_1497 | 188 |
| 56 | 3300048905 | Ga0496102_0000264 | Ga0496102_0000264_10538_11104 | 188 |
| 57 | 3300048906 | Ga0496103_0001057 | Ga0496103_0001057_10550_11116 | 188 |
| 58 | 3300048920 | Ga0496117_0389907 | Ga0496117_0389907_40_606 | 188 |
| 59 | 3300048924 | Ga0496121_0042364 | Ga0496121_0042364_1627_2193 | 188 |
| 60 | 3300049586 | Ga0501070_0012548 | Ga0501070_0012548_6091_6657 | 188 |
| 61 | 3300005354 | Ga0070675_100779829 | Ga0070675_1007798291 | 189 |
| 62 | 3300005937 | Ga0081455_10004443 | Ga0081455_100044439 | 189 |
| 63 | 3300005937 | Ga0081455_10059691 | Ga0081455_100596913 | 189 |
| 64 | 3300006844 | Ga0075428_100000631 | Ga0075428_10000063115 | 189 |
| 65 | 3300006846 | Ga0075430_100473990 | Ga0075430_1004739902 | 189 |
| 66 | 3300006847 | Ga0075431_100000069 | Ga0075431_1000000696 | 189 |
| 67 | 3300006880 | Ga0075429_100246547 | Ga0075429_1002465472 | 189 |
| 68 | 3300025917 | Ga0207660_10386105 | Ga0207660_103861051 | 189 |
| 69 | 3300025921 | Ga0207652_10310130 | Ga0207652_103101302 | 189 |
| 70 | 3300033180 | Ga0307510_10069898 | Ga0307510_100698983 | 189 |
| 71 | 3300044656 | Ga0466969_0008121 | Ga0466969_0008121_4640_5215 | 189 |
| 72 | 3300044719 | Ga0466971_0007204 | Ga0466971_0007204_689_1264 | 189 |
| 73 | 3300045976 | Ga0466967_0009716 | Ga0466967_0009716_1448_2017 | 189 |
| 74 | 3300047321 | Ga0495676_0508712 | Ga0495676_0508712_67_690 | 189 |
| 75 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_910104_910673 | 189 |
| 76 | 3300049585 | Ga0501069_0415029 | Ga0501069_0415029_57_650 | 189 |
| 77 | 3300049824 | Ga0501045_0192914 | Ga0501045_0192914_49_630 | 189 |
| 78 | 3300050508 | nmdc:mga09592_161497_c1 | nmdc:mga09592_161497_c1_804_1427 | 189 |
| 79 | 3300050509 | nmdc:mga0qj67_401680_c1 | nmdc:mga0qj67_401680_c1_405_986 | 189 |
| 80 | 3300005330 | Ga0070690_100028652 | Ga0070690_1000286523 | 190 |
| 81 | 3300005334 | Ga0068869_100146785 | Ga0068869_1001467853 | 190 |
| 82 | 3300005335 | Ga0070666_10155150 | Ga0070666_101551502 | 190 |
| 83 | 3300005336 | Ga0070680_100314551 | Ga0070680_1003145512 | 190 |
| 84 | 3300005339 | Ga0070660_100233470 | Ga0070660_1002334701 | 190 |
| 85 | 3300005339 | Ga0070660_100239452 | Ga0070660_1002394522 | 190 |
| 86 | 3300005339 | Ga0070660_100485638 | Ga0070660_1004856382 | 190 |
| 87 | 3300005343 | Ga0070687_100152294 | Ga0070687_1001522942 | 190 |
| 88 | 3300005344 | Ga0070661_100480239 | Ga0070661_1004802391 | 190 |
| 89 | 3300005355 | Ga0070671_100004596 | Ga0070671_1000045962 | 190 |
| 90 | 3300005366 | Ga0070659_100001340 | Ga0070659_1000013402 | 190 |
| 91 | 3300005366 | Ga0070659_100023145 | Ga0070659_1000231454 | 190 |
| 92 | 3300005366 | Ga0070659_100349818 | Ga0070659_1003498182 | 190 |
| 93 | 3300005367 | Ga0070667_100118668 | Ga0070667_1001186683 | 190 |
| 94 | 3300005436 | Ga0070713_100049638 | Ga0070713_1000496384 | 190 |
| 95 | 3300005440 | Ga0070705_100261041 | Ga0070705_1002610411 | 190 |
| 96 | 3300005441 | Ga0070700_100000021 | Ga0070700_10000002154 | 190 |
| 97 | 3300005455 | Ga0070663_100040703 | Ga0070663_1000407031 | 190 |
| 98 | 3300005456 | Ga0070678_100120864 | Ga0070678_1001208643 | 190 |
| 99 | 3300005539 | Ga0068853_100166981 | Ga0068853_1001669813 | 190 |
| 100 | 3300005548 | Ga0070665_100001490 | Ga0070665_10000149014 | 190 |
| 101 | 3300005563 | Ga0068855_100618795 | Ga0068855_1006187952 | 190 |
| 102 | 3300005617 | Ga0068859_100617693 | Ga0068859_1006176932 | 190 |
| 103 | 3300005834 | Ga0068851_10074902 | Ga0068851_100749021 | 190 |
| 104 | 3300005840 | Ga0068870_10239699 | Ga0068870_102396992 | 190 |
| 105 | 3300005841 | Ga0068863_100001613 | Ga0068863_10000161312 | 190 |
| 106 | 3300005841 | Ga0068863_100020259 | Ga0068863_1000202597 | 190 |
| 107 | 3300005842 | Ga0068858_100128762 | Ga0068858_1001287622 | 190 |
| 108 | 3300005843 | Ga0068860_100000195 | Ga0068860_10000019521 | 190 |
| 109 | 3300005937 | Ga0081455_10037340 | Ga0081455_100373405 | 190 |
| 110 | 3300006028 | Ga0070717_10067485 | Ga0070717_100674853 | 190 |
| 111 | 3300006173 | Ga0070716_100029457 | Ga0070716_1000294572 | 190 |
| 112 | 3300006852 | Ga0075433_10020028 | Ga0075433_100200282 | 190 |
| 113 | 3300006931 | Ga0097620_100617650 | Ga0097620_1006176502 | 190 |
| 114 | 3300007076 | Ga0075435_100008153 | Ga0075435_1000081537 | 190 |
| 115 | 3300009093 | Ga0105240_10425772 | Ga0105240_104257721 | 190 |
| 116 | 3300009098 | Ga0105245_10005593 | Ga0105245_100055936 | 190 |
| 117 | 3300009148 | Ga0105243_10006420 | Ga0105243_100064203 | 190 |
| 118 | 3300009174 | Ga0105241_10209602 | Ga0105241_102096021 | 190 |
| 119 | 3300009176 | Ga0105242_10343434 | Ga0105242_103434341 | 190 |
| 120 | 3300009545 | Ga0105237_10017439 | Ga0105237_100174397 | 190 |
| 121 | 3300009545 | Ga0105237_10085832 | Ga0105237_100858323 | 190 |
| 122 | 3300009551 | Ga0105238_10061475 | Ga0105238_100614754 | 190 |
| 123 | 3300009551 | Ga0105238_10205943 | Ga0105238_102059432 | 190 |
| 124 | 3300009553 | Ga0105249_10007621 | Ga0105249_100076213 | 190 |
| 125 | 3300009553 | Ga0105249_10677807 | Ga0105249_106778072 | 190 |
| 126 | 3300011119 | Ga0105246_10009256 | Ga0105246_100092563 | 190 |
| 127 | 3300013102 | Ga0157371_10084184 | Ga0157371_100841842 | 190 |
| 128 | 3300013104 | Ga0157370_10026852 | Ga0157370_100268523 | 190 |
| 129 | 3300013105 | Ga0157369_10028377 | Ga0157369_100283773 | 190 |
| 130 | 3300013105 | Ga0157369_10032469 | Ga0157369_100324695 | 190 |
| 131 | 3300013105 | Ga0157369_10123892 | Ga0157369_101238922 | 190 |
| 132 | 3300013306 | Ga0163162_10010160 | Ga0163162_100101603 | 190 |
| 133 | 3300013307 | Ga0157372_10037238 | Ga0157372_100372382 | 190 |
| 134 | 3300014325 | Ga0163163_10133565 | Ga0163163_101335651 | 190 |
| 135 | 3300014326 | Ga0157380_10145822 | Ga0157380_101458222 | 190 |
| 136 | 3300014968 | Ga0157379_10018519 | Ga0157379_100185192 | 190 |
| 137 | 3300014968 | Ga0157379_10200234 | Ga0157379_102002343 | 190 |
| 138 | 3300014969 | Ga0157376_10108525 | Ga0157376_101085253 | 190 |
| 139 | 3300017792 | Ga0163161_10007157 | Ga0163161_100071571 | 190 |
| 140 | 3300020082 | Ga0206353_11198684 | Ga0206353_111986842 | 190 |
| 141 | 3300020082 | Ga0206353_11922679 | Ga0206353_119226794 | 190 |
| 142 | 3300025900 | Ga0207710_10255763 | Ga0207710_102557631 | 190 |
| 143 | 3300025906 | Ga0207699_10201713 | Ga0207699_102017132 | 190 |
| 144 | 3300025914 | Ga0207671_10014977 | Ga0207671_100149773 | 190 |
| 145 | 3300025915 | Ga0207693_10002732 | Ga0207693_100027329 | 190 |
| 146 | 3300025918 | Ga0207662_10068731 | Ga0207662_100687313 | 190 |
| 147 | 3300025919 | Ga0207657_10244744 | Ga0207657_102447443 | 190 |
| 148 | 3300025919 | Ga0207657_10248326 | Ga0207657_102483262 | 190 |
| 149 | 3300025927 | Ga0207687_10384489 | Ga0207687_103844891 | 190 |
| 150 | 3300025928 | Ga0207700_10081676 | Ga0207700_100816763 | 190 |
| 151 | 3300025932 | Ga0207690_10002301 | Ga0207690_100023013 | 190 |
| 152 | 3300025933 | Ga0207706_10011004 | Ga0207706_100110041 | 190 |
| 153 | 3300025938 | Ga0207704_10062725 | Ga0207704_100627253 | 190 |
| 154 | 3300025945 | Ga0207679_10382397 | Ga0207679_103823972 | 190 |
| 155 | 3300025949 | Ga0207667_10294114 | Ga0207667_102941142 | 190 |
| 156 | 3300025972 | Ga0207668_10102293 | Ga0207668_101022933 | 190 |
| 157 | 3300025986 | Ga0207658_10089789 | Ga0207658_100897893 | 190 |
| 158 | 3300025986 | Ga0207658_10103800 | Ga0207658_101038003 | 190 |
| 159 | 3300026067 | Ga0207678_10035541 | Ga0207678_100355412 | 190 |
| 160 | 3300026075 | Ga0207708_10000025 | Ga0207708_1000002583 | 190 |
| 161 | 3300026078 | Ga0207702_10145154 | Ga0207702_101451543 | 190 |
| 162 | 3300026088 | Ga0207641_10020944 | Ga0207641_100209443 | 190 |
| 163 | 3300026095 | Ga0207676_10146390 | Ga0207676_101463901 | 190 |
| 164 | 3300026121 | Ga0207683_10000893 | Ga0207683_100008937 | 190 |
| 165 | 3300028379 | Ga0268266_10002106 | Ga0268266_100021062 | 190 |
| 166 | 3300028379 | Ga0268266_11012021 | Ga0268266_110120211 | 190 |
| 167 | 3300028381 | Ga0268264_10000239 | Ga0268264_1000023921 | 190 |
| 168 | 3300031241 | Ga0265325_10214414 | Ga0265325_102144142 | 190 |
| 169 | 3300031824 | Ga0307413_10731188 | Ga0307413_107311881 | 190 |
| 170 | 3300032126 | Ga0307415_100255352 | Ga0307415_1002553521 | 190 |
| 171 | 3300035084 | Ga0373928_0026433 | Ga0373928_0026433_564_1190 | 190 |
| 172 | 3300035111 | Ga0373923_0419919 | Ga0373923_0419919_38_610 | 190 |
| 173 | 3300035207 | Ga0373942_0033053 | Ga0373942_0033053_70_696 | 190 |
| 174 | 3300035242 | Ga0373962_0139931 | Ga0373962_0139931_121_747 | 190 |
| 175 | 3300035695 | Ga0373927_0029796 | Ga0373927_0029796_1613_2185 | 190 |
| 176 | 3300037853 | Ga0436364_0095699 | Ga0436364_0095699_3441_4013 | 190 |
| 177 | 3300044656 | Ga0466969_0045013 | Ga0466969_0045013_1543_2115 | 190 |
| 178 | 3300044656 | Ga0466969_0056127 | Ga0466969_0056127_92_664 | 190 |
| 179 | 3300044656 | Ga0466969_0063295 | Ga0466969_0063295_596_1168 | 190 |
| 180 | 3300044658 | Ga0466972_0039920 | Ga0466972_0039920_87_662 | 190 |
| 181 | 3300044684 | Ga0466966_0002957 | Ga0466966_0002957_3373_3945 | 190 |
| 182 | 3300044684 | Ga0466966_0051716 | Ga0466966_0051716_1566_2138 | 190 |
| 183 | 3300044684 | Ga0466966_0154623 | Ga0466966_0154623_62_634 | 190 |
| 184 | 3300044684 | Ga0466966_0297432 | Ga0466966_0297432_262_834 | 190 |
| 185 | 3300044693 | Ga0466961_0015642 | Ga0466961_0015642_3876_4448 | 190 |
| 186 | 3300044693 | Ga0466961_0026287 | Ga0466961_0026287_2515_3087 | 190 |
| 187 | 3300044693 | Ga0466961_0532712 | Ga0466961_0532712_14_592 | 190 |
| 188 | 3300044694 | Ga0466963_0011619 | Ga0466963_0011619_2918_3499 | 190 |
| 189 | 3300044694 | Ga0466963_0024570 | Ga0466963_0024570_105_677 | 190 |
| 190 | 3300044694 | Ga0466963_0027631 | Ga0466963_0027631_790_1377 | 190 |
| 191 | 3300044694 | Ga0466963_0064096 | Ga0466963_0064096_505_1077 | 190 |
| 192 | 3300044694 | Ga0466963_0423845 | Ga0466963_0423845_347_919 | 190 |
| 193 | 3300044735 | Ga0466968_0053549 | Ga0466968_0053549_560_1132 | 190 |
| 194 | 3300044765 | Ga0466970_0636793 | Ga0466970_0636793_24_596 | 190 |
| 195 | 3300044842 | Ga0466957_0069977 | Ga0466957_0069977_1240_1812 | 190 |
| 196 | 3300045049 | Ga0466959_0100283 | Ga0466959_0100283_223_840 | 190 |
| 197 | 3300045049 | Ga0466959_0406315 | Ga0466959_0406315_141_713 | 190 |
| 198 | 3300045836 | Ga0466958_0011749 | Ga0466958_0011749_4137_4709 | 190 |
| 199 | 3300045836 | Ga0466958_0370440 | Ga0466958_0370440_173_760 | 190 |
| 200 | 3300045976 | Ga0466967_0001337 | Ga0466967_0001337_87_659 | 190 |
| 201 | 3300045976 | Ga0466967_0131502 | Ga0466967_0131502_1693_2265 | 190 |
| 202 | 3300045976 | Ga0466967_0362379 | Ga0466967_0362379_312_896 | 190 |
| 203 | 3300045976 | Ga0466967_0394175 | Ga0466967_0394175_249_821 | 190 |
| 204 | 3300045976 | Ga0466967_0431712 | Ga0466967_0431712_680_1252 | 190 |
| 205 | 3300046459 | Ga0495629_0103602 | Ga0495629_0103602_1106_1792 | 190 |
| 206 | 3300046461 | Ga0495641_0080842 | Ga0495641_0080842_111_713 | 190 |
| 207 | 3300046663 | Ga0495635_0281568 | Ga0495635_0281568_64_636 | 190 |
| 208 | 3300047319 | Ga0495674_0664400 | Ga0495674_0664400_72_644 | 190 |
| 209 | 3300047673 | Ga0495593_0050793 | Ga0495593_0050793_1319_2005 | 190 |
| 210 | 3300048903 | Ga0496100_0623512 | Ga0496100_0623512_227_814 | 190 |
| 211 | 3300048904 | Ga0496101_0079797 | Ga0496101_0079797_191_817 | 190 |
| 212 | 3300048905 | Ga0496102_0000324 | Ga0496102_0000324_14578_15150 | 190 |
| 213 | 3300048905 | Ga0496102_0337659 | Ga0496102_0337659_338_964 | 190 |
| 214 | 3300048905 | Ga0496102_0508884 | Ga0496102_0508884_101_679 | 190 |
| 215 | 3300048906 | Ga0496103_0018301 | Ga0496103_0018301_1500_2072 | 190 |
| 216 | 3300048906 | Ga0496103_0133272 | Ga0496103_0133272_554_1126 | 190 |
| 217 | 3300048907 | Ga0496104_0087451 | Ga0496104_0087451_397_1023 | 190 |
| 218 | 3300048908 | Ga0496105_0523501 | Ga0496105_0523501_154_780 | 190 |
| 219 | 3300048911 | Ga0496108_0028490 | Ga0496108_0028490_3382_4008 | 190 |
| 220 | 3300048913 | Ga0496110_0443671 | Ga0496110_0443671_341_925 | 190 |
| 221 | 3300048913 | Ga0496110_0608855 | Ga0496110_0608855_275_901 | 190 |
| 222 | 3300048914 | Ga0496111_0265487 | Ga0496111_0265487_168_794 | 190 |
| 223 | 3300048917 | Ga0496114_0964044 | Ga0496114_0964044_43_669 | 190 |
| 224 | 3300048918 | Ga0496115_0090505 | Ga0496115_0090505_1783_2409 | 190 |
| 225 | 3300048922 | Ga0496119_0000253 | Ga0496119_0000253_13098_13670 | 190 |
| 226 | 3300048923 | Ga0496120_0002248 | Ga0496120_0002248_2661_3233 | 190 |
| 227 | 3300049581 | Ga0501047_0000037 | Ga0501047_0000037_25964_26545 | 190 |
| 228 | 3300049584 | Ga0501068_0233887 | Ga0501068_0233887_95_676 | 190 |
| 229 | 3300049742 | Ga0501080_0335813 | Ga0501080_0335813_485_1066 | 190 |
| 230 | 3300050513 | nmdc:mga0rr50_71714_c1 | nmdc:mga0rr50_71714_c1_1881_2507 | 190 |
| 231 | 3300050514 | nmdc:mga08x19_11020_c1 | nmdc:mga08x19_11020_c1_4282_4908 | 190 |
| 232 | 3300050515 | nmdc:mga0a205_476961_c1 | nmdc:mga0a205_476961_c1_19_645 | 190 |
| 233 | iso_pu_bacteria | 2684623035 | 2686533821 | 190 |
| 234 | iso_pu_bacteria | 2895880812 | 2895886405 | 190 |
| 235 | iso_pu_bacteria | 8054472261 | 8054478923 | 190 |
| 236 | 3300005329 | Ga0070683_100106926 | Ga0070683_1001069263 | 191 |
| 237 | 3300005329 | Ga0070683_100666932 | Ga0070683_1006669322 | 191 |
| 238 | 3300005336 | Ga0070680_100001726 | Ga0070680_1000017269 | 191 |
| 239 | 3300005347 | Ga0070668_100617203 | Ga0070668_1006172032 | 191 |
| 240 | 3300005356 | Ga0070674_101105372 | Ga0070674_1011053721 | 191 |
| 241 | 3300005441 | Ga0070700_100633708 | Ga0070700_1006337082 | 191 |
| 242 | 3300005458 | Ga0070681_10003785 | Ga0070681_100037856 | 191 |
| 243 | 3300005458 | Ga0070681_10022088 | Ga0070681_100220882 | 191 |
| 244 | 3300005458 | Ga0070681_10449901 | Ga0070681_104499012 | 191 |
| 245 | 3300005458 | Ga0070681_10527782 | Ga0070681_105277822 | 191 |
| 246 | 3300005530 | Ga0070679_100000128 | Ga0070679_10000012849 | 191 |
| 247 | 3300005530 | Ga0070679_100011389 | Ga0070679_1000113893 | 191 |
| 248 | 3300005530 | Ga0070679_100317604 | Ga0070679_1003176041 | 191 |
| 249 | 3300005530 | Ga0070679_100739027 | Ga0070679_1007390271 | 191 |
| 250 | 3300005535 | Ga0070684_100262900 | Ga0070684_1002629002 | 191 |
| 251 | 3300005563 | Ga0068855_100942143 | Ga0068855_1009421432 | 191 |
| 252 | 3300005563 | Ga0068855_101050446 | Ga0068855_1010504462 | 191 |
| 253 | 3300005616 | Ga0068852_101450171 | Ga0068852_1014501711 | 191 |
| 254 | 3300005718 | Ga0068866_10191254 | Ga0068866_101912542 | 191 |
| 255 | 3300009098 | Ga0105245_10019677 | Ga0105245_100196774 | 191 |
| 256 | 3300009177 | Ga0105248_10272627 | Ga0105248_102726272 | 191 |
| 257 | 3300013104 | Ga0157370_10725106 | Ga0157370_107251061 | 191 |
| 258 | 3300013105 | Ga0157369_10057105 | Ga0157369_100571052 | 191 |
| 259 | 3300013105 | Ga0157369_10257231 | Ga0157369_102572312 | 191 |
| 260 | 3300013306 | Ga0163162_10169816 | Ga0163162_101698162 | 191 |
| 261 | 3300013307 | Ga0157372_11482152 | Ga0157372_114821522 | 191 |
| 262 | 3300013308 | Ga0157375_10000958 | Ga0157375_100009582 | 191 |
| 263 | 3300014326 | Ga0157380_10939116 | Ga0157380_109391161 | 191 |
| 264 | 3300020081 | Ga0206354_10521760 | Ga0206354_105217602 | 191 |
| 265 | 3300020082 | Ga0206353_10971152 | Ga0206353_109711521 | 191 |
| 266 | 3300020082 | Ga0206353_11016463 | Ga0206353_110164633 | 191 |
| 267 | 3300020082 | Ga0206353_11569373 | Ga0206353_115693732 | 191 |
| 268 | 3300022467 | Ga0224712_10051659 | Ga0224712_100516592 | 191 |
| 269 | 3300025899 | Ga0207642_10057002 | Ga0207642_100570022 | 191 |
| 270 | 3300025912 | Ga0207707_10000199 | Ga0207707_100001996 | 191 |
| 271 | 3300025912 | Ga0207707_10030550 | Ga0207707_100305502 | 191 |
| 272 | 3300025917 | Ga0207660_10001441 | Ga0207660_100014416 | 191 |
| 273 | 3300025919 | Ga0207657_10071855 | Ga0207657_100718553 | 191 |
| 274 | 3300025921 | Ga0207652_10000199 | Ga0207652_1000019911 | 191 |
| 275 | 3300025921 | Ga0207652_10413229 | Ga0207652_104132291 | 191 |
| 276 | 3300025927 | Ga0207687_10226144 | Ga0207687_102261442 | 191 |
| 277 | 3300025935 | Ga0207709_10603325 | Ga0207709_106033252 | 191 |
| 278 | 3300025941 | Ga0207711_10489734 | Ga0207711_104897342 | 191 |
| 279 | 3300025944 | Ga0207661_10115889 | Ga0207661_101158891 | 191 |
| 280 | 3300025944 | Ga0207661_10821212 | Ga0207661_108212122 | 191 |
| 281 | 3300025949 | Ga0207667_10596855 | Ga0207667_105968552 | 191 |
| 282 | 3300026023 | Ga0207677_10538921 | Ga0207677_105389212 | 191 |
| 283 | 3300026142 | Ga0207698_10371238 | Ga0207698_103712382 | 191 |
| 284 | 3300028800 | Ga0265338_10065957 | Ga0265338_100659572 | 191 |
| 285 | 3300031241 | Ga0265325_10059261 | Ga0265325_100592612 | 191 |
| 286 | 3300031241 | Ga0265325_10236339 | Ga0265325_102363392 | 191 |
| 287 | 3300031249 | Ga0265339_10010851 | Ga0265339_100108516 | 191 |
| 288 | 3300031344 | Ga0265316_10073469 | Ga0265316_100734694 | 191 |
| 289 | 3300031595 | Ga0265313_10032651 | Ga0265313_100326512 | 191 |
| 290 | 3300031711 | Ga0265314_10053473 | Ga0265314_100534733 | 191 |
| 291 | 3300031712 | Ga0265342_10242795 | Ga0265342_102427951 | 191 |
| 292 | 3300031712 | Ga0265342_10270064 | Ga0265342_102700642 | 191 |
| 293 | 3300037418 | Ga0395900_0084948 | Ga0395900_0084948_525_1100 | 191 |
| 294 | 3300037466 | Ga0395898_0467141 | Ga0395898_0467141_605_1180 | 191 |
| 295 | 3300038443 | Ga0395901_0299670 | Ga0395901_0299670_1010_1585 | 191 |
| 296 | 3300044693 | Ga0466961_0042486 | Ga0466961_0042486_670_1275 | 191 |
| 297 | 3300044693 | Ga0466961_0290363 | Ga0466961_0290363_18_596 | 191 |
| 298 | 3300044694 | Ga0466963_0048266 | Ga0466963_0048266_1595_2179 | 191 |
| 299 | 3300044694 | Ga0466963_0524111 | Ga0466963_0524111_212_787 | 191 |
| 300 | 3300044842 | Ga0466957_0241002 | Ga0466957_0241002_314_889 | 191 |
| 301 | 3300045976 | Ga0466967_0102321 | Ga0466967_0102321_961_1545 | 191 |
| 302 | 3300045976 | Ga0466967_0790247 | Ga0466967_0790247_70_645 | 191 |
| 303 | 3300045976 | Ga0466967_0896667 | Ga0466967_0896667_273_848 | 191 |
| 304 | 3300045976 | Ga0466967_1029886 | Ga0466967_1029886_81_656 | 191 |
| 305 | 3300046455 | Ga0495603_0199295 | Ga0495603_0199295_567_1142 | 191 |
| 306 | 3300046683 | Ga0495658_0543632 | Ga0495658_0543632_54_629 | 191 |
| 307 | 3300048903 | Ga0496100_0267982 | Ga0496100_0267982_31_606 | 191 |
| 308 | 3300048905 | Ga0496102_0068905 | Ga0496102_0068905_1383_1958 | 191 |
| 309 | 3300048908 | Ga0496105_0162355 | Ga0496105_0162355_800_1375 | 191 |
| 310 | 3300048910 | Ga0496107_0081885 | Ga0496107_0081885_905_1480 | 191 |
| 311 | 3300048911 | Ga0496108_0078875 | Ga0496108_0078875_873_1448 | 191 |
| 312 | 3300048912 | Ga0496109_0000602 | Ga0496109_0000602_28067_28642 | 191 |
| 313 | 3300048915 | Ga0496112_0001815 | Ga0496112_0001815_11634_12209 | 191 |
| 314 | 3300048929 | Ga0496126_0000040 | Ga0496126_0000040_147825_148409 | 191 |
| 315 | 3300049742 | Ga0501080_0003628 | Ga0501080_0003628_11404_11979 | 191 |
| 316 | 3300005327 | Ga0070658_10055345 | Ga0070658_100553452 | 192 |
| 317 | 3300005327 | Ga0070658_10207971 | Ga0070658_102079712 | 192 |
| 318 | 3300005329 | Ga0070683_100330971 | Ga0070683_1003309713 | 192 |
| 319 | 3300005329 | Ga0070683_100341351 | Ga0070683_1003413512 | 192 |
| 320 | 3300005329 | Ga0070683_100414864 | Ga0070683_1004148642 | 192 |
| 321 | 3300005336 | Ga0070680_100218819 | Ga0070680_1002188192 | 192 |
| 322 | 3300005336 | Ga0070680_100270713 | Ga0070680_1002707132 | 192 |
| 323 | 3300005336 | Ga0070680_100392588 | Ga0070680_1003925882 | 192 |
| 324 | 3300005337 | Ga0070682_100838122 | Ga0070682_1008381221 | 192 |
| 325 | 3300005339 | Ga0070660_100022174 | Ga0070660_1000221747 | 192 |
| 326 | 3300005339 | Ga0070660_100566953 | Ga0070660_1005669531 | 192 |
| 327 | 3300005458 | Ga0070681_10004181 | Ga0070681_100041816 | 192 |
| 328 | 3300005530 | Ga0070679_100002298 | Ga0070679_10000229817 | 192 |
| 329 | 3300005530 | Ga0070679_100412430 | Ga0070679_1004124301 | 192 |
| 330 | 3300005535 | Ga0070684_100785001 | Ga0070684_1007850011 | 192 |
| 331 | 3300005937 | Ga0081455_10003959 | Ga0081455_1000395910 | 192 |
| 332 | 3300009093 | Ga0105240_10397625 | Ga0105240_103976252 | 192 |
| 333 | 3300009545 | Ga0105237_10324807 | Ga0105237_103248072 | 192 |
| 334 | 3300013105 | Ga0157369_10237859 | Ga0157369_102378593 | 192 |
| 335 | 3300013307 | Ga0157372_11003878 | Ga0157372_110038782 | 192 |
| 336 | 3300025909 | Ga0207705_10000417 | Ga0207705_1000041722 | 192 |
| 337 | 3300025909 | Ga0207705_10131596 | Ga0207705_101315962 | 192 |
| 338 | 3300025912 | Ga0207707_10023815 | Ga0207707_100238154 | 192 |
| 339 | 3300025917 | Ga0207660_10153857 | Ga0207660_101538572 | 192 |
| 340 | 3300025917 | Ga0207660_10649756 | Ga0207660_106497561 | 192 |
| 341 | 3300025919 | Ga0207657_10029411 | Ga0207657_100294113 | 192 |
| 342 | 3300025919 | Ga0207657_10085052 | Ga0207657_100850523 | 192 |
| 343 | 3300025921 | Ga0207652_10011781 | Ga0207652_100117812 | 192 |
| 344 | 3300025921 | Ga0207652_10752259 | Ga0207652_107522591 | 192 |
| 345 | 3300025944 | Ga0207661_10016854 | Ga0207661_100168543 | 192 |
| 346 | 3300025949 | Ga0207667_11014598 | Ga0207667_110145982 | 192 |
| 347 | 3300026067 | Ga0207678_10933606 | Ga0207678_109336061 | 192 |
| 348 | 3300026078 | Ga0207702_10494578 | Ga0207702_104945781 | 192 |
| 349 | 3300033179 | Ga0307507_10000732 | Ga0307507_1000073219 | 192 |
| 350 | 3300044656 | Ga0466969_0015870 | Ga0466969_0015870_583_1167 | 192 |
| 351 | 3300044656 | Ga0466969_0037936 | Ga0466969_0037936_542_1126 | 192 |
| 352 | 3300044684 | Ga0466966_0006103 | Ga0466966_0006103_4857_5441 | 192 |
| 353 | 3300044693 | Ga0466961_0104524 | Ga0466961_0104524_1174_1755 | 192 |
| 354 | 3300044693 | Ga0466961_0511875 | Ga0466961_0511875_85_669 | 192 |
| 355 | 3300044719 | Ga0466971_0012838 | Ga0466971_0012838_78_662 | 192 |
| 356 | 3300044765 | Ga0466970_0146484 | Ga0466970_0146484_338_922 | 192 |
| 357 | 3300049588 | Ga0501072_0590713 | Ga0501072_0590713_155_757 | 192 |
| 358 | 3300049741 | Ga0501079_0337213 | Ga0501079_0337213_140_742 | 192 |
| 359 | 3300061719 | Ga0466962_0044966 | Ga0466962_0044966_269_853 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9792 | 5 | 192 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9777 | 5 | 182 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.973 | 7 | 188 |
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9661 | 6 | 182 |
| 7brd-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae | 0.9617 | 9 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9605 | 9 | 192 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9443 | 9 | 192 | 3.40.50.1470 |
| af_Q86Y79_27_209_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9422 | 5 | 184 | 3.40.50.1470 |
| 1rynA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9388 | 6 | 191 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9322 | 4 | 191 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q9TJ95-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9964 | 5 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A4R2DKB0-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9955 | 9 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A354XPW4-F1-model_v4 | deleted | 0.994 | 8 | 192 |
|
| AF-A0A6I4PFW5-F1-model_v4 | deleted | 0.9925 | 8 | 190 |
|
| AF-A0A8A6AQC1-F1-model_v4 | deleted | 0.992 | 7 | 189 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar