F421596

General Info

Members Datasets Scaffolds Average Seq Length
359 303 718 453

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0028182|Ga0395905_0028182_2501_4033
Length 510
Sequence LAAGKGFARKKNNFGRILCPFHFVVSVDGAARAAARQTENTTMQEPYGRSEKNWVLGITSLASFMMALDALIITTAFASIRTDFGSPVETLQWTVNAYNLTFAVLLLTGAALGDRFGRRRMFAAGITLFVLASAACALSATAGWLVVSRAAQGAGAALVMPLAMAILSGAFGREERARALGIFSGITGCALIIGPAIGGFITENLGWRWVFWINLPIGLIAIVLMRARLRESFGPAAALDVTGLMLVAIAALALVWSLLRGNSAGWTSPEVTSTMIAGLVFTVAFVLWELRAAAPMVPMRLFASRSFASGVSASILFYAAMYGVLFLLPQFLQITLGFSPLSAGLRLLPWTATLFVTAPIAGAMVSKLGERPLVVTGLLMQAIGLGWIALIATPGLAYSALVAPLVLAGVGVSMAMPAAQNAILSSVAVTEMGKASGVFNMGRFLGGMFGIAAMVAVFSANGAVGSLAHFNAGFSPAMMLAAALSLAGALVALYLPSRRRVAAAPTPQGA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
36 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
37 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
83 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
84 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
85 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
193 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
196 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
197 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
198 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
199 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
200 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
201 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
202 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
203 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
204 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
205 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
206 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
207 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
208 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
209 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
210 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
211 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
212 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
213 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
214 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
215 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
216 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
217 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
218 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
219 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
220 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
221 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
222 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
223 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
224 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
225 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
226 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
227 2904699407
228 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
229 2906610324
230 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
231 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
232 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
233 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
234 2922368715
235 2922425934
236 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
237 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
238 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
239 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
240 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
241 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
242 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
243 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
244 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
245 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
246 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
247 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
248 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
249 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
250 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
251 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
252 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
253 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
254 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
255 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
256 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
257 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
258 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
259 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
260 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
261 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
262 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
263 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
264 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
265 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
266 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
267 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
268 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
269 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
270 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
271 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
272 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
273 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
274 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
275 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
276 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
277 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
278 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
279 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
280 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
281 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
282 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
283 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
284 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
285 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
286 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
287 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
288 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
289 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
290 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
291 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
292 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
293 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
294 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
295 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
296 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
297 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
298 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
299 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
300 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
301 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
302 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
303 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.14
Metatranscriptomes 0.28
Isolates 29.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.13
Nodule 28.97
Rhizoplane 5.29
Rhizosphere 49.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0028182 3300037471 Bacteria 5294
2 JGI25153J46596_10006157 3300003215 Bacteria 6147
3 rootH2_10122440 3300003320 Bacteria 2267
4 Ga0055542_1007381 3300003762 Bacteria 2236
5 Ga0070683_100002859 3300005329 Bacteria 13830
6 Ga0070683_100038588 3300005329 Bacteria 4379
7 Ga0070683_100078110 3300005329 Bacteria 3096
8 Ga0070666_10019360 3300005335 Bacteria 4394
9 Ga0070661_100178575 3300005344 Bacteria 1614
10 Ga0070668_100014240 3300005347 Bacteria 5942
11 Ga0070671_100009392 3300005355 Bacteria 7853
12 Ga0070667_100040404 3300005367 Bacteria 3912
13 Ga0070667_100040586 3300005367 Bacteria 3903
14 Ga0070667_100124594 3300005367 Bacteria 2244
15 Ga0070713_100003613 3300005436 Bacteria 10228
16 Ga0070713_100009411 3300005436 Bacteria 6994
17 Ga0070707_100001229 3300005468 Bacteria 25157
18 Ga0070679_100030227 3300005530 Bacteria 5347
19 Ga0070684_100001396 3300005535 Bacteria 17369
20 Ga0070684_100021114 3300005535 Bacteria 5411
21 Ga0070697_100013843 3300005536 Bacteria 6330
22 Ga0068853_100076276 3300005539 Bacteria 2927
23 Ga0070665_100000159 3300005548 Bacteria 122613
24 Ga0070665_100043099 3300005548 Bacteria 4536
25 Ga0070665_100099560 3300005548 Bacteria 2911
26 Ga0068855_100015904 3300005563 Bacteria 9051
27 Ga0070664_100012546 3300005564 Bacteria 6893
28 Ga0068857_100004324 3300005577 Bacteria 11984
29 Ga0068857_100042394 3300005577 Bacteria 4037
30 Ga0068857_100108541 3300005577 Bacteria 2494
31 Ga0068856_100005482 3300005614 Bacteria 12504
32 Ga0068859_100010925 3300005617 Bacteria 9138
33 Ga0068864_100127517 3300005618 Bacteria 2282
34 Ga0068863_100007786 3300005841 Bacteria 10476
35 Ga0068863_100031984 3300005841 Bacteria 5018
36 Ga0068858_100000049 3300005842 Bacteria 122693
37 Ga0068858_100001137 3300005842 Bacteria 27530
38 Ga0068860_100317930 3300005843 Bacteria 1528
39 Ga0068862_100007305 3300005844 Bacteria 9172
40 Ga0081455_10013246 3300005937 Bacteria 8167
41 Ga0081455_10041720 3300005937 Bacteria 4032
42 Ga0081539_10002439 3300005985 Bacteria 26261
43 Ga0070717_10010340 3300006028 Bacteria 7040
44 Ga0070717_10015673 3300006028 Bacteria 5858
45 Ga0075362_10027738 3300006177 Bacteria 2426
46 Ga0075366_10007891 3300006195 Bacteria 5888
47 Ga0075431_100062996 3300006847 Bacteria 3827
48 Ga0097620_100010925 3300006931 Bacteria 9138
49 Ga0099824_1011564 3300006942 Bacteria 9936
50 Ga0099824_1025127 3300006942 Bacteria 3325
51 Ga0099822_1000191 3300006943 Bacteria 46107
52 Ga0099823_1000128 3300006944 Bacteria 38804
53 Ga0105240_10032690 3300009093 Bacteria 6732
54 Ga0105240_10078310 3300009093 Bacteria 4071
55 Ga0111539_10141443 3300009094 Bacteria 2817
56 Ga0105245_10063520 3300009098 Bacteria 3334
57 Ga0105245_10080627 3300009098 Bacteria 2974
58 Ga0105247_10000536 3300009101 Bacteria 30808
59 Ga0105241_10039910 3300009174 Bacteria 3542
60 Ga0105237_10004389 3300009545 Bacteria 16356
61 Ga0105237_10161718 3300009545 Bacteria 2237
62 Ga0105238_10027261 3300009551 Bacteria 5820
63 Ga0105238_10104129 3300009551 Bacteria 2819
64 Ga0105249_10000073 3300009553 Bacteria 145660
65 Ga0105249_10005194 3300009553 Bacteria 11237
66 Ga0105239_10033325 3300010375 Bacteria 5658
67 Ga0157370_10016997 3300013104 Bacteria 7352
68 Ga0157369_10000051 3300013105 Bacteria 165672
69 Ga0157369_10004320 3300013105 Bacteria 16785
70 Ga0157369_10026675 3300013105 Bacteria 6406
71 Ga0163162_10074646 3300013306 Bacteria 3450
72 Ga0157372_10049212 3300013307 Bacteria 4686
73 Ga0163163_10092178 3300014325 Bacteria 3045
74 Ga0157379_10077920 3300014968 Bacteria 2968
75 Ga0197907_10075305 3300020069 Bacteria 2186
76 Ga0213871_10006330 3300021441 Bacteria 2500
77 Ga0209148_1000520 3300025254 Bacteria 38141
78 Ga0209233_1008679 3300025261 Bacteria 3127
79 Ga0209455_1001081 3300025272 Bacteria 13416
80 Ga0209257_1016020 3300025304 Bacteria 3063
81 Ga0207710_10000212 3300025900 Bacteria 51768
82 Ga0207688_10014622 3300025901 Bacteria 4264
83 Ga0207680_10010687 3300025903 Bacteria 4604
84 Ga0207647_10001943 3300025904 Bacteria 15806
85 Ga0207699_10068774 3300025906 Bacteria 2157
86 Ga0207695_10032542 3300025913 Bacteria 5705
87 Ga0207671_10050924 3300025914 Bacteria 3067
88 Ga0207671_10113728 3300025914 Bacteria 2062
89 Ga0207646_10007970 3300025922 Bacteria 10683
90 Ga0207681_10010433 3300025923 Bacteria 5685
91 Ga0207644_10001177 3300025931 Bacteria 16787
92 Ga0207661_10000915 3300025944 Bacteria 19383
93 Ga0207661_10070396 3300025944 Bacteria 2856
94 Ga0207679_10005641 3300025945 Bacteria 7850
95 Ga0207667_10080117 3300025949 Bacteria 3383
96 Ga0207712_10000003 3300025961 Bacteria 615314
97 Ga0207668_10009348 3300025972 Bacteria 5869
98 Ga0207658_10012716 3300025986 Bacteria 5748
99 Ga0207658_10044331 3300025986 Bacteria 3238
100 Ga0207703_10000132 3300026035 Bacteria 90163
101 Ga0207703_10016358 3300026035 Bacteria 5782
102 Ga0207639_10104516 3300026041 Bacteria 2296
103 Ga0207702_10059044 3300026078 Bacteria 3266
104 Ga0207641_10001625 3300026088 Bacteria 21918
105 Ga0207674_10000577 3300026116 Bacteria 48267
106 Ga0207674_10021407 3300026116 Bacteria 6961
107 Ga0207683_10279664 3300026121 Bacteria 1525
108 Ga0207698_10111178 3300026142 Bacteria 2296
109 Ga0209389_1000223 3300027296 Bacteria 38812
110 Ga0209589_1000055 3300027357 Bacteria 111890
111 Ga0209489_100128 3300027361 Bacteria 111890
112 Ga0209489_102324 3300027361 Bacteria 38812
113 Ga0209700_100137 3300027363 Bacteria 111890
114 Ga0209700_102324 3300027363 Bacteria 38812
115 Ga0268266_10000023 3300028379 Bacteria 501899
116 Ga0268266_10000756 3300028379 Bacteria 43282
117 Ga0268266_10153300 3300028379 Bacteria 2079
118 Ga0307513_10003141 3300031456 Bacteria 22564
119 Ga0307508_10000046 3300031616 Bacteria 139709
120 Ga0307516_10051696 3300031730 Bacteria 4026
121 Ga0373934_0002223 3300035086 Bacteria 7130
122 Ga0373923_0000022 3300035111 Bacteria 23262
123 Ga0373953_0003110 3300035117 Bacteria 5113
124 Ga0373954_0000692 3300035118 Bacteria 12921
125 Ga0373956_0001947 3300035119 Bacteria 8537
126 Ga0373957_0001285 3300035120 Bacteria 6729
127 Ga0373946_0010533 3300035171 Bacteria 3424
128 Ga0373955_0001695 3300035172 Bacteria 9427
129 Ga0373924_0001373 3300035410 Bacteria 7865
130 Ga0373927_0000362 3300035695 Bacteria 35248
131 Ga0373933_0125726 3300035724 Bacteria 1608
132 Ga0395900_0040271 3300037418 Bacteria 4815
133 Ga0395898_0200465 3300037466 Bacteria 1905
134 Ga0436364_1147798 3300037853 Bacteria 2192
135 Ga0395901_0044618 3300038443 Bacteria 4598
136 Ga0436360_1268055 3300039438 Bacteria 4022
137 Ga0436362_0690741 3300039453 Bacteria 2019
138 Ga0466969_0069886 3300044656 Bacteria 1690
139 Ga0466963_0079465 3300044694 Bacteria 2219
140 Ga0466967_0013853 3300045976 Bacteria 6252
141 Ga0466967_0119488 3300045976 Bacteria 2433
142 Ga0495592_0011733 3300046454 Bacteria 6636
143 Ga0495590_0017548 3300046457 Bacteria 2574
144 Ga0495638_0009303 3300046460 Bacteria 6906
145 Ga0495605_0050656 3300046474 Bacteria 2025
146 Ga0495605_0061001 3300046474 Bacteria 1806
147 Ga0495628_0007200 3300046516 Bacteria 9633
148 Ga0495648_0000568 3300046524 Bacteria 39499
149 Ga0495652_0059429 3300046529 Bacteria 3234
150 Ga0495587_0019705 3300046536 Bacteria 4172
151 Ga0495645_0064501 3300046543 Bacteria 2650
152 Ga0495667_0056388 3300046559 Bacteria 2583
153 Ga0495668_0050194 3300046616 Bacteria 2312
154 Ga0495625_0065003 3300046660 Bacteria 2572
155 Ga0495635_0000213 3300046663 Bacteria 36809
156 Ga0495661_0080537 3300046665 Bacteria 1879
157 Ga0495657_0001192 3300046675 Bacteria 22779
158 Ga0495599_0001319 3300046678 Bacteria 14145
159 Ga0495623_0006967 3300046679 Bacteria 7345
160 Ga0495646_0004450 3300046680 Bacteria 8828
161 Ga0495613_0004294 3300046689 Bacteria 10676
162 Ga0495649_0070345 3300046694 Bacteria 1876
163 Ga0495600_0010507 3300046809 Bacteria 5749
164 Ga0495604_0045526 3300047317 Bacteria 3423
165 Ga0495604_0051689 3300047317 Bacteria 3184
166 Ga0495674_0000027 3300047319 Bacteria 132744
167 Ga0495674_0057156 3300047319 Bacteria 3415
168 Ga0495672_0016939 3300047320 Bacteria 4884
169 Ga0495683_0025120 3300047323 Bacteria 3055
170 Ga0495687_025497 3300047443 Bacteria 2793
171 Ga0495684_0000052 3300047471 Bacteria 85125
172 Ga0495593_0000126 3300047673 Bacteria 37465
173 Ga0496101_0103370 3300048904 Bacteria 2135
174 Ga0496102_0022157 3300048905 Bacteria 5628
175 Ga0496102_0050594 3300048905 Bacteria 3784
176 Ga0496103_0007458 3300048906 Bacteria 6520
177 Ga0496104_0000917 3300048907 Bacteria 25278
178 Ga0496105_0045393 3300048908 Bacteria 3625
179 Ga0496105_0063583 3300048908 Bacteria 3044
180 Ga0496105_0164671 3300048908 Bacteria 1819
181 Ga0496106_0105466 3300048909 Bacteria 2190
182 Ga0496110_0175585 3300048913 Bacteria 1944
183 Ga0496111_0022862 3300048914 Bacteria 4383
184 Ga0496111_0112340 3300048914 Bacteria 2007
185 Ga0496112_0075129 3300048915 Bacteria 3342
186 Ga0496112_0127578 3300048915 Bacteria 2514
187 Ga0496112_0284762 3300048915 Bacteria 1599
188 Ga0496113_0109352 3300048916 Bacteria 2149
189 Ga0496115_0037371 3300048918 Bacteria 3848
190 Ga0496115_0066157 3300048918 Bacteria 2921
191 Ga0496116_0002620 3300048919 Bacteria 18682
192 Ga0496116_0032426 3300048919 Bacteria 3723
193 Ga0496117_0003773 3300048920 Bacteria 17326
194 Ga0496118_0001554 3300048921 Bacteria 34121
195 Ga0496119_0008512 3300048922 Bacteria 8996
196 Ga0496120_0002606 3300048923 Bacteria 17878
197 Ga0496121_0000416 3300048924 Bacteria 84469
198 Ga0496121_0001659 3300048924 Bacteria 36737
199 Ga0496121_0007501 3300048924 Bacteria 13162
200 Ga0496121_0064578 3300048924 Bacteria 2984
201 Ga0496121_0093658 3300048924 Bacteria 2338
202 Ga0496121_0118544 3300048924 Bacteria 2003
203 Ga0496125_0038495 3300048928 Bacteria 4137
204 Ga0496125_0050832 3300048928 Bacteria 3427
205 Ga0496126_0037687 3300048929 Bacteria 4508
206 Ga0496126_0046749 3300048929 Bacteria 3966
207 Ga0501031_0002736 3300049568 Bacteria 11236
208 Ga0501032_0003908 3300049569 Bacteria 11304
209 Ga0501033_0002057 3300049570 Bacteria 17490
210 Ga0501034_0049703 3300049571 Bacteria 4231
211 Ga0501036_0004532 3300049572 Bacteria 11218
212 Ga0501037_0001167 3300049573 Bacteria 19383
213 Ga0501038_0005698 3300049574 Bacteria 11552
214 Ga0501039_0008634 3300049575 Bacteria 7763
215 Ga0501043_0016773 3300049579 Bacteria 5739
216 Ga0501046_0005427 3300049580 Bacteria 11393
217 Ga0501047_0000499 3300049581 Bacteria 42560
218 Ga0501047_0039881 3300049581 Bacteria 4542
219 Ga0501047_0106506 3300049581 Bacteria 2684
220 Ga0501048_0003881 3300049582 Bacteria 11378
221 Ga0501068_0055397 3300049584 Bacteria 2402
222 Ga0501069_0006869 3300049585 Bacteria 5951
223 Ga0501070_0009026 3300049586 Bacteria 8434
224 Ga0501070_0024415 3300049586 Bacteria 5072
225 Ga0501070_0036206 3300049586 Bacteria 4122
226 Ga0501071_0055288 3300049587 Bacteria 2865
227 Ga0501073_0007085 3300049589 Bacteria 8351
228 Ga0501074_0017535 3300049590 Bacteria 5197
229 Ga0501080_0072317 3300049742 Bacteria 3208
230 Ga0501083_0004410 3300049744 Bacteria 9925
231 Ga0501083_0025125 3300049744 Bacteria 4126
232 Ga0501035_0001327 3300049822 Bacteria 25524
233 Ga0501044_0000664 3300049823 Bacteria 41476
234 nmdc:mga03683_11129_c1 3300050489 Bacteria 2437
235 nmdc:mga0yw44_46420_c1 3300050492 Bacteria 2608
236 Ga0495595_0001191 3300053084 Bacteria 10108
237 Ga0495619_0000913 3300053085 Bacteria 19380
238 Ga0500641_0039802 3300053096 Bacteria 1895
239 Ga0500569_013556 3300053109 Bacteria 1998
240 Ga0500595_001771 3300053119 Bacteria 11236
241 Ga0500597_076885 3300053120 Bacteria 1447
242 Ga0500618_001680 3300053125 Bacteria 9487
243 Ga0500658_0009610 3300053134 Bacteria 3565
244 Ga0500589_026887 3300053147 Bacteria 2669
245 Ga0500590_062686 3300053148 Bacteria 1865
246 Ga0500616_0000236 3300053153 Bacteria 86733
247 Ga0500616_0008486 3300053153 Bacteria 6373
248 Ga0500609_005431 3300053731 Bacteria 1743
249 Ga0500601_000152 3300053737 Bacteria 14372
250 Ga0501082_0052681 3300060353 Bacteria 3507
251 2508545132 2508501009 Bacteria 7784016
252 2508693886 2508501042 Bacteria 8719808
253 2513650422 2513237095 Bacteria 8976980
254 2513656459 2513237096 Bacteria 8722461
255 2513858966 2513237137 Bacteria 9558895
256 2513890439 2513237141 Bacteria 8496279
257 2513917362 2513237145 Bacteria 8979722
258 2515628102 2515154112 Bacteria 8294334
259 2517889584 2517572143 Bacteria 9484767
260 2524539539 2524023228 Bacteria 10118060
261 2528855866 2528768022 Bacteria 10457665
262 2617385934 2617270742 Bacteria 6808054
263 2671121228 2667528175 Bacteria 7532676
264 2728749231 2728368998 Bacteria 8720350
265 2793070446 2791355197 Bacteria 8420563
266 2818238476 2816332527 Bacteria 8933356
267 2824665892 2824661429 Bacteria 9877870
268 2844317150 2844315083 Bacteria 8138177
269 2847938941 2847930680 Bacteria 9342022
270 2874594220 2874590934 Bacteria 8299676
271 2874646727 2874645413 Bacteria 8214782
272 2876773552 2876771140 Bacteria 8287509
273 2876824820 2876818435 Bacteria 8274608
274 2879081547 2879074833 Bacteria 8279565
275 2879106273 2879099564 Bacteria 10442239
276 2879129550 2879127579 Bacteria 8294491
277 2879145759 2879142872 Bacteria 8267021
278 2885375091 2885374607 Bacteria 8927485
279 2888381191 2888378607 Bacteria 9652610
280 2903735134 2903727486 Bacteria 8281579
281 2903753866 2903748898 Bacteria 9972761
282 2904692116 2904690495 Bacteria 9412302
283 2904709412
284 2906607189 2906602504 Bacteria 8295279
285 2906613032
286 2906641140 2906635258 Bacteria 8601019
287 2906665696 2906660503 Bacteria 8595048
288 2908746180 2908739725 Bacteria 8628932
289 2908757398 2908756301 Bacteria 8864324
290 2922376792
291 2922433496
292 2929621441 2929615660 Bacteria 9193770
293 2929631745 2929624759 Bacteria 9339455
294 2932790250 2932784394 Bacteria 9704911
295 2932797069 2932794094 Bacteria 7915132
296 2932807364 2932801729 Bacteria 7987968
297 2932815845 2932809354 Bacteria 9135765
298 2932824733 2932818245 Bacteria 9955613
299 2932833292 2932828146 Bacteria 9745859
300 2933583534 2933577622 Bacteria 9116884
301 2935621434 2935616580 Bacteria 9032984
302 2935635045 2935630451 Bacteria 8169952
303 2935644783 2935638405 Bacteria 10015038
304 2935650332 2935648319 Bacteria 8801166
305 2935658479 2935656913 Bacteria 8965014
306 2935672387 2935665750 Bacteria 9571747
307 2935682829 2935675223 Bacteria 9928132
308 2935693266 2935684952 Bacteria 9590419
309 2935702153 2935694250 Bacteria 9291695
310 2935710926 2935703347 Bacteria 10242284
311 2935720945 2935713505 Bacteria 9608509
312 2935730568 2935722832 Bacteria 9608746
313 2935740667 2935732158 Bacteria 9706831
314 2935749859 2935741537 Bacteria 9707219
315 2935759321 2935750917 Bacteria 9590372
316 2935767230 2935760218 Bacteria 9817913
317 2935808876 2935801545 Bacteria 9301974
318 2935817673 2935810662 Bacteria 9401221
319 2935834033 2935827899 Bacteria 10038562
320 2935845476 2935837841 Bacteria 9454360
321 2935859373 2935855204 Bacteria 9035059
322 2935869984 2935864058 Bacteria 9784707
323 2935880946 2935873716 Bacteria 9632195
324 2935884508 2935883170 Bacteria 7964738
325 2935979412 2935975950 Bacteria 8347125
326 2935986041 2935984226 Bacteria 8302647
327 2935998280 2935992306 Bacteria 9802711
328 2936009181 2936002035 Bacteria 9362176
329 2936013109 2936011229 Bacteria 8801034
330 2936021804 2936019824 Bacteria 8804134
331 2936030402 2936028420 Bacteria 8965941
332 2936044426 2936037263 Bacteria 9446081
333 2936047998 2936046547 Bacteria 8903709
334 2936057998 2936055302 Bacteria 8785755
335 2940565153 2940556831 Bacteria 9590747
336 2941511676 2941507105 Bacteria 8166816
337 2941519341 2941515067 Bacteria 8166720
338 2941527535 2941523033 Bacteria 8169134
339 2941536598 2941531003 Bacteria 7653939
340 2941542920 2941538514 Bacteria 9402094
341 3005483184 3005474847 Bacteria 9259049
342 3005596223 3005594810 Bacteria 8716512
343 8006935556 8006933436 Bacteria 10410654
344 8006975482 8006973647 Bacteria 10679141
345 8016637746 8016630954 Bacteria 9217207
346 8017065727 8017057580 Bacteria 10023680
347 8019563255 8019555841 Bacteria 9642137
348 8019573337 8019565922 Bacteria 9639779
349 8019585157 8019576017 Bacteria 10049540
350 8019598338 8019597564 Bacteria 10041141
351 8019610041 8019608314 Bacteria 10042931
352 8019636789 8019629233 Bacteria 8687553
353 8019642833 8019638758 Bacteria 9062356
354 8019655200 8019648815 Bacteria 10014479
355 8019664596 8019659431 Bacteria 8577854
356 8019674179 8019668869 Bacteria 8791617
357 8019681938 8019678201 Bacteria 8863603
358 8055744356 8055742211 Bacteria 9226248
359 8056976316 8056967851 Bacteria 9038162
360 Ga0395905_0028182
361 JGI25153J46596_10006157
362 rootH2_10122440
363 Ga0055542_1007381
364 Ga0070683_100002859
365 Ga0070683_100038588
366 Ga0070683_100078110
367 Ga0070666_10019360
368 Ga0070661_100178575
369 Ga0070668_100014240
370 Ga0070671_100009392
371 Ga0070667_100040404
372 Ga0070667_100040586
373 Ga0070667_100124594
374 Ga0070713_100003613
375 Ga0070713_100009411
376 Ga0070707_100001229
377 Ga0070679_100030227
378 Ga0070684_100001396
379 Ga0070684_100021114
380 Ga0070697_100013843
381 Ga0068853_100076276
382 Ga0070665_100000159
383 Ga0070665_100043099
384 Ga0070665_100099560
385 Ga0068855_100015904
386 Ga0070664_100012546
387 Ga0068857_100004324
388 Ga0068857_100042394
389 Ga0068857_100108541
390 Ga0068856_100005482
391 Ga0068859_100010925
392 Ga0068864_100127517
393 Ga0068863_100007786
394 Ga0068863_100031984
395 Ga0068858_100000049
396 Ga0068858_100001137
397 Ga0068860_100317930
398 Ga0068862_100007305
399 Ga0081455_10013246
400 Ga0081455_10041720
401 Ga0081539_10002439
402 Ga0070717_10010340
403 Ga0070717_10015673
404 Ga0075362_10027738
405 Ga0075366_10007891
406 Ga0075431_100062996
407 Ga0097620_100010925
408 Ga0099824_1011564
409 Ga0099824_1025127
410 Ga0099822_1000191
411 Ga0099823_1000128
412 Ga0105240_10032690
413 Ga0105240_10078310
414 Ga0111539_10141443
415 Ga0105245_10063520
416 Ga0105245_10080627
417 Ga0105247_10000536
418 Ga0105241_10039910
419 Ga0105237_10004389
420 Ga0105237_10161718
421 Ga0105238_10027261
422 Ga0105238_10104129
423 Ga0105249_10000073
424 Ga0105249_10005194
425 Ga0105239_10033325
426 Ga0157370_10016997
427 Ga0157369_10000051
428 Ga0157369_10004320
429 Ga0157369_10026675
430 Ga0163162_10074646
431 Ga0157372_10049212
432 Ga0163163_10092178
433 Ga0157379_10077920
434 Ga0197907_10075305
435 Ga0213871_10006330
436 Ga0209148_1000520
437 Ga0209233_1008679
438 Ga0209455_1001081
439 Ga0209257_1016020
440 Ga0207710_10000212
441 Ga0207688_10014622
442 Ga0207680_10010687
443 Ga0207647_10001943
444 Ga0207699_10068774
445 Ga0207695_10032542
446 Ga0207671_10050924
447 Ga0207671_10113728
448 Ga0207646_10007970
449 Ga0207681_10010433
450 Ga0207644_10001177
451 Ga0207661_10000915
452 Ga0207661_10070396
453 Ga0207679_10005641
454 Ga0207667_10080117
455 Ga0207712_10000003
456 Ga0207668_10009348
457 Ga0207658_10012716
458 Ga0207658_10044331
459 Ga0207703_10000132
460 Ga0207703_10016358
461 Ga0207639_10104516
462 Ga0207702_10059044
463 Ga0207641_10001625
464 Ga0207674_10000577
465 Ga0207674_10021407
466 Ga0207683_10279664
467 Ga0207698_10111178
468 Ga0209389_1000223
469 Ga0209589_1000055
470 Ga0209489_100128
471 Ga0209489_102324
472 Ga0209700_100137
473 Ga0209700_102324
474 Ga0268266_10000023
475 Ga0268266_10000756
476 Ga0268266_10153300
477 Ga0307513_10003141
478 Ga0307508_10000046
479 Ga0307516_10051696
480 Ga0373934_0002223
481 Ga0373923_0000022
482 Ga0373953_0003110
483 Ga0373954_0000692
484 Ga0373956_0001947
485 Ga0373957_0001285
486 Ga0373946_0010533
487 Ga0373955_0001695
488 Ga0373924_0001373
489 Ga0373927_0000362
490 Ga0373933_0125726
491 Ga0395900_0040271
492 Ga0395898_0200465
493 Ga0436364_1147798
494 Ga0395901_0044618
495 Ga0436360_1268055
496 Ga0436362_0690741
497 Ga0466969_0069886
498 Ga0466963_0079465
499 Ga0466967_0013853
500 Ga0466967_0119488
501 Ga0495592_0011733
502 Ga0495590_0017548
503 Ga0495638_0009303
504 Ga0495605_0050656
505 Ga0495605_0061001
506 Ga0495628_0007200
507 Ga0495648_0000568
508 Ga0495652_0059429
509 Ga0495587_0019705
510 Ga0495645_0064501
511 Ga0495667_0056388
512 Ga0495668_0050194
513 Ga0495625_0065003
514 Ga0495635_0000213
515 Ga0495661_0080537
516 Ga0495657_0001192
517 Ga0495599_0001319
518 Ga0495623_0006967
519 Ga0495646_0004450
520 Ga0495613_0004294
521 Ga0495649_0070345
522 Ga0495600_0010507
523 Ga0495604_0045526
524 Ga0495604_0051689
525 Ga0495674_0000027
526 Ga0495674_0057156
527 Ga0495672_0016939
528 Ga0495683_0025120
529 Ga0495687_025497
530 Ga0495684_0000052
531 Ga0495593_0000126
532 Ga0496101_0103370
533 Ga0496102_0022157
534 Ga0496102_0050594
535 Ga0496103_0007458
536 Ga0496104_0000917
537 Ga0496105_0045393
538 Ga0496105_0063583
539 Ga0496105_0164671
540 Ga0496106_0105466
541 Ga0496110_0175585
542 Ga0496111_0022862
543 Ga0496111_0112340
544 Ga0496112_0075129
545 Ga0496112_0127578
546 Ga0496112_0284762
547 Ga0496113_0109352
548 Ga0496115_0037371
549 Ga0496115_0066157
550 Ga0496116_0002620
551 Ga0496116_0032426
552 Ga0496117_0003773
553 Ga0496118_0001554
554 Ga0496119_0008512
555 Ga0496120_0002606
556 Ga0496121_0000416
557 Ga0496121_0001659
558 Ga0496121_0007501
559 Ga0496121_0064578
560 Ga0496121_0093658
561 Ga0496121_0118544
562 Ga0496125_0038495
563 Ga0496125_0050832
564 Ga0496126_0037687
565 Ga0496126_0046749
566 Ga0501031_0002736
567 Ga0501032_0003908
568 Ga0501033_0002057
569 Ga0501034_0049703
570 Ga0501036_0004532
571 Ga0501037_0001167
572 Ga0501038_0005698
573 Ga0501039_0008634
574 Ga0501043_0016773
575 Ga0501046_0005427
576 Ga0501047_0000499
577 Ga0501047_0039881
578 Ga0501047_0106506
579 Ga0501048_0003881
580 Ga0501068_0055397
581 Ga0501069_0006869
582 Ga0501070_0009026
583 Ga0501070_0024415
584 Ga0501070_0036206
585 Ga0501071_0055288
586 Ga0501073_0007085
587 Ga0501074_0017535
588 Ga0501080_0072317
589 Ga0501083_0004410
590 Ga0501083_0025125
591 Ga0501035_0001327
592 Ga0501044_0000664
593 nmdc:mga03683_11129_c1
594 nmdc:mga0yw44_46420_c1
595 Ga0495595_0001191
596 Ga0495619_0000913
597 Ga0500641_0039802
598 Ga0500569_013556
599 Ga0500595_001771
600 Ga0500597_076885
601 Ga0500618_001680
602 Ga0500658_0009610
603 Ga0500589_026887
604 Ga0500590_062686
605 Ga0500616_0000236
606 Ga0500616_0008486
607 Ga0500609_005431
608 Ga0500601_000152
609 Ga0501082_0052681
610 2508545132
611 2508693886
612 2513650422
613 2513656459
614 2513858966
615 2513890439
616 2513917362
617 2515628102
618 2517889584
619 2524539539
620 2528855866
621 2617385934
622 2671121228
623 2728749231
624 2793070446
625 2818238476
626 2824665892
627 2844317150
628 2847938941
629 2874594220
630 2874646727
631 2876773552
632 2876824820
633 2879081547
634 2879106273
635 2879129550
636 2879145759
637 2885375091
638 2888381191
639 2903735134
640 2903753866
641 2904692116
642 2904709412
643 2906607189
644 2906613032
645 2906641140
646 2906665696
647 2908746180
648 2908757398
649 2922376792
650 2922433496
651 2929621441
652 2929631745
653 2932790250
654 2932797069
655 2932807364
656 2932815845
657 2932824733
658 2932833292
659 2933583534
660 2935621434
661 2935635045
662 2935644783
663 2935650332
664 2935658479
665 2935672387
666 2935682829
667 2935693266
668 2935702153
669 2935710926
670 2935720945
671 2935730568
672 2935740667
673 2935749859
674 2935759321
675 2935767230
676 2935808876
677 2935817673
678 2935834033
679 2935845476
680 2935859373
681 2935869984
682 2935880946
683 2935884508
684 2935979412
685 2935986041
686 2935998280
687 2936009181
688 2936013109
689 2936021804
690 2936030402
691 2936044426
692 2936047998
693 2936057998
694 2940565153
695 2941511676
696 2941519341
697 2941527535
698 2941536598
699 2941542920
700 3005483184
701 3005596223
702 8006935556
703 8006975482
704 8016637746
705 8017065727
706 8019563255
707 8019573337
708 8019585157
709 8019598338
710 8019610041
711 8019636789
712 8019642833
713 8019655200
714 8019664596
715 8019674179
716 8019681938
717 8055744356
718 8056976316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

59

451

0.92

PF07690

MFS_1

Major Facilitator Superfamily

310

510

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9204 1 415
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8975 12 417
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8968 13 417
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8778 13 417
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8749 9 417
ID Description Score Start End Superfamily
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9724 16 212 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9671 16 198 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.962 10 187 1.20.1250.20
af_P9WG89_46_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9619 16 248 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9559 14 245 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537X6T9-F1-model_v4 MFS transporter 0.9941 1 272 GO:0016020
GO:0022857
AF-A0A6G9Z4F4-F1-model_v4 DHA2 family efflux MFS transporter permease subunit 0.988 5 417 GO:0005886
GO:0022857
AF-A0A537X6T9-F1-model_v4 MFS transporter 0.9869 1 272 GO:0016020
GO:0022857
AF-A0A2N0JIU8-F1-model_v4 deleted 0.9865 1 416
AF-A0A0M8QRJ0-F1-model_v4 Major facilitator transporter 0.9818 10 416 GO:0005886
GO:0022857
GO:0046677

Map