F421594

General Info

Members Datasets Scaffolds Average Seq Length
359 200 718 209

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0367646|Ga0395898_0367646_605_1312
Length 235
Sequence MPLLPGVVTLKQIITRTPPSSGNRLLPLEHEIRDVTPGLWIWRLAHPEWKPGLGWREMVTSTCVESGGEVALLDALAPPEDAPEIWERLDARPPTLVAVLKPDHIRDVDLFVRRYGARAFGPELFWRTDIPETELEPIWPGNELPGGLVALYDGRGRNETPLWLPEQRALVFADGLTAPKGELRVWETPWHEERALPALRALLEYPFEHVIVSHGEPVHDRAAYERALELPPWTG

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 8.91
Rhizosphere 89.97
Stem 0
Stem Tuber 0
Unclassified 14.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0367646 3300037466 Bacteria 1371
2 rootL2_10078026 3300003322 Bacteria 1618
3 Ga0070658_10043964 3300005327 Bacteria 3609
4 Ga0070683_100272509 3300005329 Bacteria 1610
5 Ga0070683_100931411 3300005329 Bacteria 834
6 Ga0070682_100209588 3300005337 Bacteria 1380
7 Ga0068868_100029468 3300005338 Bacteria 4203
8 Ga0068868_100080735 3300005338 Bacteria 2606
9 Ga0068868_100104843 3300005338 Unclassified 2292
10 Ga0068868_100116258 3300005338 Bacteria 2178
11 Ga0070660_100045731 3300005339 Bacteria 3352
12 Ga0070660_100599720 3300005339 Bacteria 921
13 Ga0070689_100061736 3300005340 Bacteria 2915
14 Ga0070687_100119924 3300005343 Bacteria 1503
15 Ga0070674_100064524 3300005356 Bacteria 2566
16 Ga0070659_100308186 3300005366 Bacteria 1322
17 Ga0070659_100348904 3300005366 Bacteria 1241
18 Ga0070709_10011038 3300005434 Bacteria 5019
19 Ga0070714_100170342 3300005435 Archaea 1976
20 Ga0070713_100051122 3300005436 Unclassified 3418
21 Ga0070701_10032704 3300005438 Bacteria 2593
22 Ga0070711_100099538 3300005439 Unclassified 2112
23 Ga0070711_100262026 3300005439 Bacteria 1360
24 Ga0070705_100121094 3300005440 Bacteria 1690
25 Ga0070708_100094164 3300005445 Bacteria 2732
26 Ga0070662_100063216 3300005457 Bacteria 2707
27 Ga0070662_100109780 3300005457 Bacteria 2100
28 Ga0070662_100632420 3300005457 Archaea 902
29 Ga0070681_10556477 3300005458 Unclassified 1061
30 Ga0070706_100515004 3300005467 Bacteria 1113
31 Ga0070707_100054354 3300005468 Bacteria 3838
32 Ga0070707_100813980 3300005468 Unclassified 898
33 Ga0070698_100012360 3300005471 Bacteria 9039
34 Ga0070698_100949742 3300005471 Bacteria 806
35 Ga0070699_100020813 3300005518 Bacteria 5657
36 Ga0070679_100101086 3300005530 Bacteria 2870
37 Ga0070679_100394000 3300005530 Bacteria 1331
38 Ga0070684_100230631 3300005535 Bacteria 1691
39 Ga0068853_100118339 3300005539 Bacteria 2361
40 Ga0070672_100297288 3300005543 Bacteria 1368
41 Ga0068855_100025137 3300005563 Bacteria 7129
42 Ga0068855_100220029 3300005563 Bacteria 2130
43 Ga0070664_100665400 3300005564 Bacteria 968
44 Ga0070702_100048038 3300005615 Bacteria 2427
45 Ga0070702_100110584 3300005615 Bacteria 1703
46 Ga0068864_100300132 3300005618 Bacteria 1503
47 Ga0068861_100022292 3300005719 Bacteria 4561
48 Ga0068861_100176194 3300005719 Bacteria 1776
49 Ga0068851_10215009 3300005834 Bacteria 1078
50 Ga0068862_100073711 3300005844 Bacteria 2950
51 Ga0081538_10006542 3300005981 Bacteria 10236
52 Ga0081540_1001853 3300005983 Bacteria 17712
53 Ga0075364_10003922 3300006051 Bacteria 8533
54 Ga0070715_10007216 3300006163 Unclassified 3818
55 Ga0070712_100015150 3300006175 Bacteria 4958
56 Ga0075428_100016863 3300006844 Bacteria 8066
57 Ga0075428_100209713 3300006844 Bacteria 2105
58 Ga0075430_100050625 3300006846 Bacteria 3501
59 Ga0075431_100065283 3300006847 Bacteria 3759
60 Ga0075431_100111639 3300006847 Unclassified 2821
61 Ga0075431_100161878 3300006847 Bacteria 2301
62 Ga0075433_10459226 3300006852 Unclassified 1122
63 Ga0075434_100054491 3300006871 Bacteria 3973
64 Ga0075434_100275955 3300006871 Unclassified 1700
65 Ga0075434_100540360 3300006871 Bacteria 1185
66 Ga0075429_100007368 3300006880 Bacteria 9550
67 Ga0068865_100266313 3300006881 Bacteria 1359
68 Ga0068865_100735479 3300006881 Unclassified 846
69 Ga0075436_100002978 3300006914 Bacteria 11589
70 Ga0075436_100004791 3300006914 Bacteria 9291
71 Ga0097620_100226037 3300006931 Bacteria 1960
72 Ga0075435_100004440 3300007076 Bacteria 9636
73 Ga0075435_100357443 3300007076 Unclassified 1252
74 Ga0111539_10035777 3300009094 Bacteria 6011
75 Ga0111539_10053846 3300009094 Bacteria 4790
76 Ga0111539_10173362 3300009094 Bacteria 2520
77 Ga0111539_10801231 3300009094 Unclassified 1096
78 Ga0105245_10029498 3300009098 Bacteria 4847
79 Ga0105245_10034372 3300009098 Bacteria 4496
80 Ga0105245_10068149 3300009098 Unclassified 3224
81 Ga0105245_10383788 3300009098 Unclassified 1400
82 Ga0114129_10112941 3300009147 Bacteria 3747
83 Ga0114129_10486688 3300009147 Bacteria 1613
84 Ga0105243_10186144 3300009148 Bacteria 1810
85 Ga0105243_10441488 3300009148 Bacteria 1219
86 Ga0105243_10491761 3300009148 Bacteria 1160
87 Ga0105242_10775529 3300009176 Unclassified 946
88 Ga0105248_11101118 3300009177 Bacteria 898
89 Ga0105249_10057958 3300009553 Bacteria 3549
90 Ga0105239_10107532 3300010375 Bacteria 3090
91 Ga0105239_10341140 3300010375 Bacteria 1691
92 Ga0105239_10498777 3300010375 Bacteria 1384
93 Ga0157373_10106580 3300013100 Bacteria 1970
94 Ga0157374_10002590 3300013296 Bacteria 15239
95 Ga0157372_10106469 3300013307 Bacteria 3207
96 Ga0157372_11180811 3300013307 Bacteria 885
97 Ga0157372_11550208 3300013307 Bacteria 763
98 Ga0157375_10658045 3300013308 Bacteria 1203
99 Ga0157380_10118225 3300014326 Bacteria 2240
100 Ga0157377_10157073 3300014745 Bacteria 1411
101 Ga0157379_10182239 3300014968 Bacteria 1897
102 Ga0157376_11154432 3300014969 Unclassified 802
103 Ga0163161_10159577 3300017792 Bacteria 1719
104 Ga0213874_10035220 3300021377 Bacteria 1470
105 Ga0207656_10074554 3300025321 Bacteria 1514
106 Ga0207682_10184975 3300025893 Bacteria 953
107 Ga0207688_10014328 3300025901 Bacteria 4315
108 Ga0207688_10038849 3300025901 Unclassified 2643
109 Ga0207685_10071470 3300025905 Unclassified 1408
110 Ga0207699_10079259 3300025906 Bacteria 2031
111 Ga0207643_10449576 3300025908 Bacteria 820
112 Ga0207707_10263025 3300025912 Unclassified 1497
113 Ga0207707_10334753 3300025912 Bacteria 1306
114 Ga0207707_10524913 3300025912 Unclassified 1008
115 Ga0207693_10000797 3300025915 Bacteria 28134
116 Ga0207660_10986387 3300025917 Bacteria 687
117 Ga0207662_10030029 3300025918 Bacteria 3152
118 Ga0207657_10002639 3300025919 Bacteria 19358
119 Ga0207657_10049213 3300025919 Bacteria 3675
120 Ga0207652_10119811 3300025921 Bacteria 2341
121 Ga0207652_10403906 3300025921 Bacteria 1233
122 Ga0207659_11167892 3300025926 Bacteria 662
123 Ga0207687_10106029 3300025927 Bacteria 2077
124 Ga0207687_10106774 3300025927 Bacteria 2070
125 Ga0207687_10225749 3300025927 Bacteria 1477
126 Ga0207700_10308836 3300025928 Unclassified 1367
127 Ga0207664_10158519 3300025929 Archaea 1928
128 Ga0207690_10197792 3300025932 Bacteria 1524
129 Ga0207686_10297971 3300025934 Bacteria 1197
130 Ga0207709_10017937 3300025935 Bacteria 3959
131 Ga0207670_10085973 3300025936 Bacteria 2211
132 Ga0207669_10227191 3300025937 Bacteria 1374
133 Ga0207669_10363116 3300025937 Bacteria 1123
134 Ga0207704_10413634 3300025938 Bacteria 1067
135 Ga0207665_10004113 3300025939 Bacteria 9702
136 Ga0207691_10142886 3300025940 Bacteria 2108
137 Ga0207661_10352716 3300025944 Bacteria 1328
138 Ga0207661_10413952 3300025944 Bacteria 1224
139 Ga0207679_10467813 3300025945 Bacteria 1120
140 Ga0207679_10576745 3300025945 Bacteria 1012
141 Ga0207667_10819769 3300025949 Bacteria 926
142 Ga0207651_10229289 3300025960 Bacteria 1507
143 Ga0207712_10021655 3300025961 Bacteria 4222
144 Ga0207712_10283309 3300025961 Bacteria 1353
145 Ga0207668_10256594 3300025972 Bacteria 1423
146 Ga0207640_10112105 3300025981 Bacteria 1936
147 Ga0207677_10116981 3300026023 Bacteria 1997
148 Ga0207677_10181730 3300026023 Unclassified 1655
149 Ga0207703_10319590 3300026035 Bacteria 1421
150 Ga0207639_10279137 3300026041 Bacteria 1468
151 Ga0207678_10282816 3300026067 Unclassified 1424
152 Ga0207675_100017113 3300026118 Bacteria 6770
153 Ga0207675_100110956 3300026118 Bacteria 2588
154 Ga0207683_10063737 3300026121 Bacteria 3247
155 Ga0207698_10182835 3300026142 Bacteria 1859
156 Ga0207428_10020923 3300027907 Bacteria 5547
157 Ga0207428_10048743 3300027907 Unclassified 3396
158 Ga0207428_10282958 3300027907 Bacteria 1231
159 Ga0268265_10299007 3300028380 Bacteria 1448
160 Ga0268264_10138968 3300028381 Bacteria 2164
161 Ga0307408_100109059 3300031548 Bacteria 2123
162 Ga0307413_10028010 3300031824 Bacteria 3131
163 Ga0307406_10127871 3300031901 Bacteria 1778
164 Ga0307407_10030711 3300031903 Bacteria 2901
165 Ga0307409_100004059 3300031995 Bacteria 8142
166 Ga0307409_100052293 3300031995 Bacteria 3130
167 Ga0307409_100174771 3300031995 Bacteria 1894
168 Ga0307409_100305866 3300031995 Bacteria 1481
169 Ga0307416_100000355 3300032002 Bacteria 23746
170 Ga0307416_100761210 3300032002 Bacteria 1062
171 Ga0307414_10791676 3300032004 Bacteria 864
172 Ga0307411_10088693 3300032005 Bacteria 2152
173 Ga0307411_10225759 3300032005 Bacteria 1456
174 Ga0307415_100007659 3300032126 Bacteria 5925
175 Ga0307415_100449636 3300032126 Bacteria 1113
176 Ga0373961_0113399 3300035241 Unclassified 891
177 Ga0395899_0048722 3300037312 Bacteria 3151
178 Ga0395899_0068552 3300037312 Bacteria 2600
179 Ga0395899_0078279 3300037312 Bacteria 2410
180 Ga0395899_0126849 3300037312 Bacteria 1824
181 Ga0395900_0019239 3300037418 Bacteria 6962
182 Ga0395900_0057723 3300037418 Bacteria 3996
183 Ga0395900_0073699 3300037418 Bacteria 3510
184 Ga0395900_0477527 3300037418 Bacteria 1199
185 Ga0395900_1007919 3300037418 Unclassified 752
186 Ga0395898_0001106 3300037466 Bacteria 41610
187 Ga0395898_0005350 3300037466 Bacteria 13874
188 Ga0395898_0123893 3300037466 Bacteria 2476
189 Ga0395898_0298272 3300037466 Unclassified 1537
190 Ga0395898_0322288 3300037466 Bacteria 1474
191 Ga0395898_1278317 3300037466 Bacteria 664
192 Ga0395905_0009160 3300037471 Bacteria 9694
193 Ga0395905_0020528 3300037471 Bacteria 6257
194 Ga0395905_0120333 3300037471 Bacteria 2468
195 Ga0395905_0158437 3300037471 Bacteria 2128
196 Ga0395905_0195454 3300037471 Bacteria 1897
197 Ga0395905_0794152 3300037471 Bacteria 849
198 Ga0395901_0003599 3300038443 Bacteria 15631
199 Ga0395901_0004155 3300038443 Bacteria 14606
200 Ga0395901_0006455 3300038443 Bacteria 11885
201 Ga0395901_0008785 3300038443 Bacteria 10221
202 Ga0395901_0117099 3300038443 Bacteria 2799
203 Ga0395901_0176723 3300038443 Bacteria 2239
204 Ga0395901_0204775 3300038443 Unclassified 2067
205 Ga0395901_0222022 3300038443 Unclassified 1975
206 Ga0395901_0255261 3300038443 Bacteria 1826
207 Ga0395901_0429648 3300038443 Bacteria 1353
208 Ga0395901_0829385 3300038443 Bacteria 912
209 Ga0439453_0043390 3300041408 Bacteria 889
210 Ga0439448_0009617 3300042005 Unclassified 2853
211 Ga0439446_0008425 3300042156 Bacteria 2737
212 Ga0450908_018476 3300042184 Bacteria 1233
213 Ga0439440_0065270 3300042993 Unclassified 937
214 Ga0466972_0287613 3300044658 Unclassified 768
215 Ga0466965_0267393 3300044683 Unclassified 920
216 Ga0466965_0487087 3300044683 Unclassified 690
217 Ga0466961_0155992 3300044693 Unclassified 1424
218 Ga0466963_0018715 3300044694 Bacteria 4335
219 Ga0466963_0070434 3300044694 Bacteria 2352
220 Ga0466963_0089582 3300044694 Bacteria 2093
221 Ga0466963_0140044 3300044694 Bacteria 1675
222 Ga0466963_0403462 3300044694 Bacteria 964
223 Ga0466964_0071299 3300044706 Bacteria 1470
224 Ga0466964_0127601 3300044706 Bacteria 1154
225 Ga0466964_0219088 3300044706 Bacteria 923
226 Ga0466970_0197352 3300044765 Unclassified 1119
227 Ga0466957_0027873 3300044842 Bacteria 3359
228 Ga0466957_0192304 3300044842 Bacteria 1337
229 Ga0466957_0257421 3300044842 Bacteria 1162
230 Ga0466959_0016837 3300045049 Bacteria 5350
231 Ga0451576_0200460 3300045051 Unclassified 2085
232 Ga0451576_0570747 3300045051 Bacteria 1189
233 Ga0466958_0059300 3300045836 Bacteria 2328
234 Ga0466967_0000125 3300045976 Bacteria 29126
235 Ga0466967_0002166 3300045976 Bacteria 12061
236 Ga0466967_0008343 3300045976 Bacteria 7580
237 Ga0466967_0034982 3300045976 Bacteria 4270
238 Ga0466967_0068096 3300045976 Bacteria 3177
239 Ga0466967_0206569 3300045976 Unclassified 1862
240 Ga0466967_0293840 3300045976 Bacteria 1562
241 Ga0466967_0340360 3300045976 Bacteria 1450
242 Ga0495630_0190962 3300046517 Bacteria 1563
243 Ga0495680_0151565 3300047322 Bacteria 1690
244 Ga0496100_0080628 3300048903 Bacteria 2197
245 Ga0496101_0050631 3300048904 Bacteria 2991
246 Ga0496101_0696118 3300048904 Unclassified 802
247 Ga0496102_0073249 3300048905 Bacteria 3148
248 Ga0496102_0575707 3300048905 Bacteria 1049
249 Ga0496105_0123104 3300048908 Bacteria 2138
250 Ga0496105_0321809 3300048908 Unclassified 1239
251 Ga0496106_0020302 3300048909 Bacteria 4930
252 Ga0496106_0024397 3300048909 Bacteria 4496
253 Ga0496106_0224252 3300048909 Bacteria 1499
254 Ga0496107_0004538 3300048910 Bacteria 9401
255 Ga0496107_0024041 3300048910 Bacteria 4308
256 Ga0496107_0045245 3300048910 Bacteria 3166
257 Ga0496107_0078447 3300048910 Bacteria 2406
258 Ga0496108_0047024 3300048911 Bacteria 3606
259 Ga0496108_0138170 3300048911 Bacteria 2098
260 Ga0496108_0383806 3300048911 Unclassified 1227
261 Ga0496109_0009397 3300048912 Bacteria 8332
262 Ga0496109_0582513 3300048912 Bacteria 1054
263 Ga0496110_0062019 3300048913 Bacteria 3301
264 Ga0496110_0088655 3300048913 Unclassified 2764
265 Ga0496110_0203599 3300048913 Bacteria 1798
266 Ga0496111_0100587 3300048914 Bacteria 2123
267 Ga0496111_0211595 3300048914 Bacteria 1440
268 Ga0496112_0000293 3300048915 Bacteria 32490
269 Ga0496112_0012090 3300048915 Bacteria 7922
270 Ga0496112_0046076 3300048915 Bacteria 4275
271 Ga0496112_0090411 3300048915 Bacteria 3030
272 Ga0496112_0362436 3300048915 Bacteria 1391
273 Ga0496113_0100371 3300048916 Bacteria 2242
274 Ga0496114_0144258 3300048917 Bacteria 2063
275 Ga0496115_0089104 3300048918 Bacteria 2519
276 Ga0501031_0013095 3300049568 Bacteria 5411
277 Ga0501031_0104723 3300049568 Bacteria 1846
278 Ga0501032_0293369 3300049569 Unclassified 1052
279 Ga0501033_0134895 3300049570 Bacteria 1786
280 Ga0501036_0008267 3300049572 Bacteria 8532
281 Ga0501037_0088442 3300049573 Bacteria 2242
282 Ga0501038_0008596 3300049574 Bacteria 9371
283 Ga0501039_0030573 3300049575 Bacteria 4153
284 Ga0501040_0002213 3300049576 Bacteria 12518
285 Ga0501040_0115858 3300049576 Bacteria 1876
286 Ga0501041_0061246 3300049577 Bacteria 2303
287 Ga0501042_0019942 3300049578 Bacteria 4663
288 Ga0501042_0206413 3300049578 Bacteria 1417
289 Ga0501042_0488788 3300049578 Unclassified 893
290 Ga0501046_0029120 3300049580 Bacteria 4493
291 Ga0501048_0008856 3300049582 Bacteria 7577
292 Ga0501068_0000083 3300049584 Bacteria 39291
293 Ga0501069_0000023 3300049585 Bacteria 118054
294 Ga0501070_0098597 3300049586 Bacteria 2417
295 Ga0501071_0037843 3300049587 Bacteria 3446
296 Ga0501072_0001706 3300049588 Bacteria 16356
297 Ga0501072_0001743 3300049588 Bacteria 16185
298 Ga0501072_0598487 3300049588 Bacteria 869
299 Ga0501073_0224969 3300049589 Bacteria 1296
300 Ga0501074_0264889 3300049590 Unclassified 1222
301 Ga0501074_0527306 3300049590 Unclassified 836
302 Ga0501075_0001086 3300049591 Bacteria 17489
303 Ga0501075_0008986 3300049591 Bacteria 6972
304 Ga0501076_0001735 3300049592 Bacteria 14743
305 Ga0501076_0017251 3300049592 Bacteria 5483
306 Ga0501076_0206994 3300049592 Bacteria 1602
307 Ga0501077_0000531 3300049593 Bacteria 23114
308 Ga0501077_0021783 3300049593 Bacteria 4058
309 Ga0501079_0003694 3300049741 Bacteria 11284
310 Ga0501079_0007574 3300049741 Bacteria 8222
311 Ga0501079_0049516 3300049741 Bacteria 3242
312 Ga0501079_0645846 3300049741 Bacteria 833
313 Ga0501081_0005067 3300049743 Bacteria 8478
314 Ga0501081_0030032 3300049743 Bacteria 3676
315 Ga0501083_0088161 3300049744 Bacteria 2052
316 Ga0501035_0135761 3300049822 Bacteria 2142
317 Ga0501045_0003925 3300049824 Bacteria 10245
318 Ga0501045_0028270 3300049824 Bacteria 4044
319 nmdc:mga00v17_36369_c1 3300050491 Bacteria 2934
320 nmdc:mga05p37_114753_c1 3300050507 Bacteria 3311
321 nmdc:mga05p37_227057_c1 3300050507 Bacteria 2251
322 nmdc:mga05p37_8755_c1 3300050507 Bacteria 11957
323 nmdc:mga09592_218032_c1 3300050508 Bacteria 1653
324 nmdc:mga09592_3920_c1 3300050508 Bacteria 8107
325 nmdc:mga09592_530296_c1 3300050508 Bacteria 1012
326 nmdc:mga0qj67_20354_c1 3300050509 Bacteria 5078
327 nmdc:mga0qj67_662297_c1 3300050509 Bacteria 832
328 nmdc:mga06r32_120921_c1 3300050510 Bacteria 2583
329 nmdc:mga06r32_35648_c1 3300050510 Bacteria 4695
330 nmdc:mga06r32_379528_c1 3300050510 Bacteria 1396
331 nmdc:mga08y16_34326_c1 3300050511 Bacteria 5329
332 nmdc:mga08y16_441269_c1 3300050511 Unclassified 1329
333 nmdc:mga08y16_600310_c1 3300050511 Bacteria 1110
334 nmdc:mga08y16_70813_c1 3300050511 Bacteria 3634
335 nmdc:mga0n895_127975_c1 3300050512 Bacteria 2564
336 nmdc:mga0n895_4807_c1 3300050512 Bacteria 11184
337 nmdc:mga0n895_599906_c1 3300050512 Bacteria 1104
338 nmdc:mga0n895_77562_c1 3300050512 Unclassified 3305
339 nmdc:mga0rr50_315995_c1 3300050513 Unclassified 1309
340 nmdc:mga0rr50_345478_c1 3300050513 Bacteria 1251
341 nmdc:mga0rr50_365712_c1 3300050513 Unclassified 1215
342 nmdc:mga0rr50_73719_c1 3300050513 Unclassified 2610
343 nmdc:mga08x19_6507_c1 3300050514 Bacteria 6919
344 nmdc:mga08x19_8293_c1 3300050514 Bacteria 6181
345 nmdc:mga0a205_343184_c1 3300050515 Bacteria 1362
346 nmdc:mga0a205_401951_c1 3300050515 Unclassified 1234
347 nmdc:mga0a205_617160_c1 3300050515 Bacteria 937
348 Ga0495601_0276137 3300053077 Bacteria 1096
349 Ga0495595_0065658 3300053084 Bacteria 1707
350 Ga0495619_0070923 3300053085 Bacteria 2331
351 Ga0501084_0026880 3300054114 Bacteria 4807
352 Ga0501084_0031177 3300054114 Bacteria 4458
353 Ga0501084_0099885 3300054114 Bacteria 2436
354 Ga0590075_003858 3300059424 Bacteria 3554
355 Ga0590075_089611 3300059424 Unclassified 798
356 Ga0501082_0008294 3300060353 Bacteria 8958
357 Ga0466962_0030904 3300061719 Bacteria 2564
358 Ga0530510_0001384 3300061734 Bacteria 16265
359 Ga0530510_0044418 3300061734 Bacteria 3211
360 Ga0395898_0367646
361 rootL2_10078026
362 Ga0070658_10043964
363 Ga0070683_100272509
364 Ga0070683_100931411
365 Ga0070682_100209588
366 Ga0068868_100029468
367 Ga0068868_100080735
368 Ga0068868_100104843
369 Ga0068868_100116258
370 Ga0070660_100045731
371 Ga0070660_100599720
372 Ga0070689_100061736
373 Ga0070687_100119924
374 Ga0070674_100064524
375 Ga0070659_100308186
376 Ga0070659_100348904
377 Ga0070709_10011038
378 Ga0070714_100170342
379 Ga0070713_100051122
380 Ga0070701_10032704
381 Ga0070711_100099538
382 Ga0070711_100262026
383 Ga0070705_100121094
384 Ga0070708_100094164
385 Ga0070662_100063216
386 Ga0070662_100109780
387 Ga0070662_100632420
388 Ga0070681_10556477
389 Ga0070706_100515004
390 Ga0070707_100054354
391 Ga0070707_100813980
392 Ga0070698_100012360
393 Ga0070698_100949742
394 Ga0070699_100020813
395 Ga0070679_100101086
396 Ga0070679_100394000
397 Ga0070684_100230631
398 Ga0068853_100118339
399 Ga0070672_100297288
400 Ga0068855_100025137
401 Ga0068855_100220029
402 Ga0070664_100665400
403 Ga0070702_100048038
404 Ga0070702_100110584
405 Ga0068864_100300132
406 Ga0068861_100022292
407 Ga0068861_100176194
408 Ga0068851_10215009
409 Ga0068862_100073711
410 Ga0081538_10006542
411 Ga0081540_1001853
412 Ga0075364_10003922
413 Ga0070715_10007216
414 Ga0070712_100015150
415 Ga0075428_100016863
416 Ga0075428_100209713
417 Ga0075430_100050625
418 Ga0075431_100065283
419 Ga0075431_100111639
420 Ga0075431_100161878
421 Ga0075433_10459226
422 Ga0075434_100054491
423 Ga0075434_100275955
424 Ga0075434_100540360
425 Ga0075429_100007368
426 Ga0068865_100266313
427 Ga0068865_100735479
428 Ga0075436_100002978
429 Ga0075436_100004791
430 Ga0097620_100226037
431 Ga0075435_100004440
432 Ga0075435_100357443
433 Ga0111539_10035777
434 Ga0111539_10053846
435 Ga0111539_10173362
436 Ga0111539_10801231
437 Ga0105245_10029498
438 Ga0105245_10034372
439 Ga0105245_10068149
440 Ga0105245_10383788
441 Ga0114129_10112941
442 Ga0114129_10486688
443 Ga0105243_10186144
444 Ga0105243_10441488
445 Ga0105243_10491761
446 Ga0105242_10775529
447 Ga0105248_11101118
448 Ga0105249_10057958
449 Ga0105239_10107532
450 Ga0105239_10341140
451 Ga0105239_10498777
452 Ga0157373_10106580
453 Ga0157374_10002590
454 Ga0157372_10106469
455 Ga0157372_11180811
456 Ga0157372_11550208
457 Ga0157375_10658045
458 Ga0157380_10118225
459 Ga0157377_10157073
460 Ga0157379_10182239
461 Ga0157376_11154432
462 Ga0163161_10159577
463 Ga0213874_10035220
464 Ga0207656_10074554
465 Ga0207682_10184975
466 Ga0207688_10014328
467 Ga0207688_10038849
468 Ga0207685_10071470
469 Ga0207699_10079259
470 Ga0207643_10449576
471 Ga0207707_10263025
472 Ga0207707_10334753
473 Ga0207707_10524913
474 Ga0207693_10000797
475 Ga0207660_10986387
476 Ga0207662_10030029
477 Ga0207657_10002639
478 Ga0207657_10049213
479 Ga0207652_10119811
480 Ga0207652_10403906
481 Ga0207659_11167892
482 Ga0207687_10106029
483 Ga0207687_10106774
484 Ga0207687_10225749
485 Ga0207700_10308836
486 Ga0207664_10158519
487 Ga0207690_10197792
488 Ga0207686_10297971
489 Ga0207709_10017937
490 Ga0207670_10085973
491 Ga0207669_10227191
492 Ga0207669_10363116
493 Ga0207704_10413634
494 Ga0207665_10004113
495 Ga0207691_10142886
496 Ga0207661_10352716
497 Ga0207661_10413952
498 Ga0207679_10467813
499 Ga0207679_10576745
500 Ga0207667_10819769
501 Ga0207651_10229289
502 Ga0207712_10021655
503 Ga0207712_10283309
504 Ga0207668_10256594
505 Ga0207640_10112105
506 Ga0207677_10116981
507 Ga0207677_10181730
508 Ga0207703_10319590
509 Ga0207639_10279137
510 Ga0207678_10282816
511 Ga0207675_100017113
512 Ga0207675_100110956
513 Ga0207683_10063737
514 Ga0207698_10182835
515 Ga0207428_10020923
516 Ga0207428_10048743
517 Ga0207428_10282958
518 Ga0268265_10299007
519 Ga0268264_10138968
520 Ga0307408_100109059
521 Ga0307413_10028010
522 Ga0307406_10127871
523 Ga0307407_10030711
524 Ga0307409_100004059
525 Ga0307409_100052293
526 Ga0307409_100174771
527 Ga0307409_100305866
528 Ga0307416_100000355
529 Ga0307416_100761210
530 Ga0307414_10791676
531 Ga0307411_10088693
532 Ga0307411_10225759
533 Ga0307415_100007659
534 Ga0307415_100449636
535 Ga0373961_0113399
536 Ga0395899_0048722
537 Ga0395899_0068552
538 Ga0395899_0078279
539 Ga0395899_0126849
540 Ga0395900_0019239
541 Ga0395900_0057723
542 Ga0395900_0073699
543 Ga0395900_0477527
544 Ga0395900_1007919
545 Ga0395898_0001106
546 Ga0395898_0005350
547 Ga0395898_0123893
548 Ga0395898_0298272
549 Ga0395898_0322288
550 Ga0395898_1278317
551 Ga0395905_0009160
552 Ga0395905_0020528
553 Ga0395905_0120333
554 Ga0395905_0158437
555 Ga0395905_0195454
556 Ga0395905_0794152
557 Ga0395901_0003599
558 Ga0395901_0004155
559 Ga0395901_0006455
560 Ga0395901_0008785
561 Ga0395901_0117099
562 Ga0395901_0176723
563 Ga0395901_0204775
564 Ga0395901_0222022
565 Ga0395901_0255261
566 Ga0395901_0429648
567 Ga0395901_0829385
568 Ga0439453_0043390
569 Ga0439448_0009617
570 Ga0439446_0008425
571 Ga0450908_018476
572 Ga0439440_0065270
573 Ga0466972_0287613
574 Ga0466965_0267393
575 Ga0466965_0487087
576 Ga0466961_0155992
577 Ga0466963_0018715
578 Ga0466963_0070434
579 Ga0466963_0089582
580 Ga0466963_0140044
581 Ga0466963_0403462
582 Ga0466964_0071299
583 Ga0466964_0127601
584 Ga0466964_0219088
585 Ga0466970_0197352
586 Ga0466957_0027873
587 Ga0466957_0192304
588 Ga0466957_0257421
589 Ga0466959_0016837
590 Ga0451576_0200460
591 Ga0451576_0570747
592 Ga0466958_0059300
593 Ga0466967_0000125
594 Ga0466967_0002166
595 Ga0466967_0008343
596 Ga0466967_0034982
597 Ga0466967_0068096
598 Ga0466967_0206569
599 Ga0466967_0293840
600 Ga0466967_0340360
601 Ga0495630_0190962
602 Ga0495680_0151565
603 Ga0496100_0080628
604 Ga0496101_0050631
605 Ga0496101_0696118
606 Ga0496102_0073249
607 Ga0496102_0575707
608 Ga0496105_0123104
609 Ga0496105_0321809
610 Ga0496106_0020302
611 Ga0496106_0024397
612 Ga0496106_0224252
613 Ga0496107_0004538
614 Ga0496107_0024041
615 Ga0496107_0045245
616 Ga0496107_0078447
617 Ga0496108_0047024
618 Ga0496108_0138170
619 Ga0496108_0383806
620 Ga0496109_0009397
621 Ga0496109_0582513
622 Ga0496110_0062019
623 Ga0496110_0088655
624 Ga0496110_0203599
625 Ga0496111_0100587
626 Ga0496111_0211595
627 Ga0496112_0000293
628 Ga0496112_0012090
629 Ga0496112_0046076
630 Ga0496112_0090411
631 Ga0496112_0362436
632 Ga0496113_0100371
633 Ga0496114_0144258
634 Ga0496115_0089104
635 Ga0501031_0013095
636 Ga0501031_0104723
637 Ga0501032_0293369
638 Ga0501033_0134895
639 Ga0501036_0008267
640 Ga0501037_0088442
641 Ga0501038_0008596
642 Ga0501039_0030573
643 Ga0501040_0002213
644 Ga0501040_0115858
645 Ga0501041_0061246
646 Ga0501042_0019942
647 Ga0501042_0206413
648 Ga0501042_0488788
649 Ga0501046_0029120
650 Ga0501048_0008856
651 Ga0501068_0000083
652 Ga0501069_0000023
653 Ga0501070_0098597
654 Ga0501071_0037843
655 Ga0501072_0001706
656 Ga0501072_0001743
657 Ga0501072_0598487
658 Ga0501073_0224969
659 Ga0501074_0264889
660 Ga0501074_0527306
661 Ga0501075_0001086
662 Ga0501075_0008986
663 Ga0501076_0001735
664 Ga0501076_0017251
665 Ga0501076_0206994
666 Ga0501077_0000531
667 Ga0501077_0021783
668 Ga0501079_0003694
669 Ga0501079_0007574
670 Ga0501079_0049516
671 Ga0501079_0645846
672 Ga0501081_0005067
673 Ga0501081_0030032
674 Ga0501083_0088161
675 Ga0501035_0135761
676 Ga0501045_0003925
677 Ga0501045_0028270
678 nmdc:mga00v17_36369_c1
679 nmdc:mga05p37_114753_c1
680 nmdc:mga05p37_227057_c1
681 nmdc:mga05p37_8755_c1
682 nmdc:mga09592_218032_c1
683 nmdc:mga09592_3920_c1
684 nmdc:mga09592_530296_c1
685 nmdc:mga0qj67_20354_c1
686 nmdc:mga0qj67_662297_c1
687 nmdc:mga06r32_120921_c1
688 nmdc:mga06r32_35648_c1
689 nmdc:mga06r32_379528_c1
690 nmdc:mga08y16_34326_c1
691 nmdc:mga08y16_441269_c1
692 nmdc:mga08y16_600310_c1
693 nmdc:mga08y16_70813_c1
694 nmdc:mga0n895_127975_c1
695 nmdc:mga0n895_4807_c1
696 nmdc:mga0n895_599906_c1
697 nmdc:mga0n895_77562_c1
698 nmdc:mga0rr50_315995_c1
699 nmdc:mga0rr50_345478_c1
700 nmdc:mga0rr50_365712_c1
701 nmdc:mga0rr50_73719_c1
702 nmdc:mga08x19_6507_c1
703 nmdc:mga08x19_8293_c1
704 nmdc:mga0a205_343184_c1
705 nmdc:mga0a205_401951_c1
706 nmdc:mga0a205_617160_c1
707 Ga0495601_0276137
708 Ga0495595_0065658
709 Ga0495619_0070923
710 Ga0501084_0026880
711 Ga0501084_0031177
712 Ga0501084_0099885
713 Ga0590075_003858
714 Ga0590075_089611
715 Ga0501082_0008294
716 Ga0466962_0030904
717 Ga0530510_0001384
718 Ga0530510_0044418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.8019 4 202
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7873 4 202
2zzi-assembly1.cif.gz_A crystal structure of ttha1623 in a di-iron-bound form 0.759 32 200
1znb-assembly2.cif.gz_B metallo-beta-lactamase 0.7478 3 202
6jka-assembly1.cif.gz_A crystal structure of metallo-beta-lactamse, imp-1, in complex with a thiazole-bearing inhibitor 0.7466 3 202
ID Description Score Start End Superfamily
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8055 9 202 3.60.15.10
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7721 9 202 3.60.15.10
1znbB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7478 3 202 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7385 10 202 3.60.15.10
af_A0A1D8PNS9_9_239_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7348 4 149 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A538FJL8-F1-model_v4 MBL fold metallo-hydrolase 0.9898 1 208 GO:0016787
AF-A0A537TW44-F1-model_v4 MBL fold metallo-hydrolase 0.9879 34 208 GO:0016787
AF-A0A2V9AHD2-F1-model_v4 MBL fold metallo-hydrolase 0.9875 59 208
AF-A0A7Y0Q5F1-F1-model_v4 MBL fold metallo-hydrolase 0.9795 4 208 GO:0016787
AF-A0A4R2HKI7-F1-model_v4 Uncharacterized protein 0.9755 2 206

Map