F421479

General Info

Members Datasets Scaffolds Average Seq Length
359 221 331 321

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100132068|Ga0068860_1001320682
Length 367
Sequence MYQRLSGLTECENDFLAGCSRLYSSLPLIKTRKAKGSGQQAEKYPLPLLASNFYITTYCYISMKHISILIPHDSVMASIVDPRIIFTGVNDFLAAAGKAPVFKVQLVGLTREVQLHNGTFTVHSDVLIGEVKKTDLILVPAIGGDLKTAIKKNEAFLPWIVDQYHQGAEVASLCIGAFLLASTGLLNGKECSSHWLTANEFREMFPEVTLVDGRIVTEQQGLYSSGGASSYWNLLLHLIEKHAGREMAIMAAKVYALEIDRKTQSPFIMFNGQKKHEDESIKQAQEFIEKNVTERISVEELAIRYAIGKRHFIRRFKKATNNTPIEYIQRVKIEAAKKQLENSRKNVNEVMYDVGYSDVKAFRTVEV

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
3 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
4 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
7 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
8 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
9 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
10 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
11 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
12 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
13 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
18 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
19 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
20 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
21 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
22 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
23 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
199 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.81
Nodule 0
Rhizoplane 0.56
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 13.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007889 3300001979 Bacteria 4294
2 JGI24740J21852_10010245 3300001979 Bacteria 3622
3 JGI24739J22299_10000559 3300001989 Bacteria 13370
4 JGI24739J22299_10004452 3300001989 Bacteria 5368
5 JGI24739J22299_10022352 3300001989 Unclassified 2244
6 JGI24735J21928_10000012 3300002067 Bacteria 208921
7 JGI25154J39366_1000003 3300002738 Bacteria 397627
8 JGI25154J39366_1000014 3300002738 Bacteria 265287
9 JGI25154J39366_1007466 3300002738 Bacteria 1494
10 JGI25158J39367_1013426 3300002739 Bacteria 1071
11 JGI25157J39369_1005206 3300002741 Bacteria 2164
12 JGI25406J46586_10002154 3300003203 Bacteria 9315
13 JGI25153J46596_10011686 3300003215 Unclassified 3858
14 JGI25153J46596_10012591 3300003215 Bacteria 3635
15 JGI25153J46596_10034455 3300003215 Bacteria 1655
16 rootH2_10006056 3300003320 Bacteria 27891
17 rootH2_10201560 3300003320 Bacteria 1403
18 rootL2_10049556 3300003322 Bacteria 4932
19 rootH1_10004563 3300003323 Bacteria 12500
20 rootH1_10132616 3300003323 Bacteria 3907
21 rootH1_10243521 3300003323 Bacteria 1403
22 rootH1_10335630 3300003323 Bacteria 1962
23 JGI25160J50197_1000961 3300003354 Bacteria 15091
24 JGI25160J50197_1001079 3300003354 Bacteria 13985
25 JGI25160J50197_1002671 3300003354 Bacteria 8208
26 JGI25160J50197_1007413 3300003354 Bacteria 4295
27 Ga0055535_1003099 3300003761 Bacteria 5015
28 Ga0055542_1003308 3300003762 Bacteria 4461
29 Ga0055528_1000177 3300003790 Bacteria 53906
30 Ga0055530_10002240 3300003791 Bacteria 12734
31 Ga0055531_10000041 3300003794 Bacteria 135600
32 Ga0065165_1000022 3300005262 Bacteria 253404
33 Ga0065165_1017255 3300005262 Bacteria 2667
34 Ga0065714_10073811 3300005288 Bacteria 3127
35 Ga0065714_10083631 3300005288 Unclassified 2229
36 Ga0070658_10031923 3300005327 Bacteria 4232
37 Ga0070658_10136808 3300005327 Unclassified 2044
38 Ga0070658_10282310 3300005327 Bacteria 1413
39 Ga0070670_100194023 3300005331 Bacteria 1764
40 Ga0070666_10005054 3300005335 Bacteria 8069
41 Ga0070666_10035022 3300005335 Bacteria 3328
42 Ga0070680_100004810 3300005336 Bacteria 10166
43 Ga0070682_100000018 3300005337 Bacteria 229427
44 Ga0068868_100004350 3300005338 Bacteria 9933
45 Ga0070660_100038718 3300005339 Bacteria 3620
46 Ga0070675_100347754 3300005354 Unclassified 1314
47 Ga0070688_100143949 3300005365 Bacteria 1622
48 Ga0070659_100034511 3300005366 Bacteria 3935
49 Ga0070667_100002577 3300005367 Bacteria 15746
50 Ga0070667_100005891 3300005367 Bacteria 10210
51 Ga0070667_100309129 3300005367 Bacteria 1424
52 Ga0070663_100191448 3300005455 Bacteria 1592
53 Ga0070681_10068307 3300005458 Bacteria 3521
54 Ga0068867_100038944 3300005459 Unclassified 3463
55 Ga0070685_10026046 3300005466 Bacteria 3221
56 Ga0070679_100081385 3300005530 Bacteria 3227
57 Ga0070679_100104857 3300005530 Unclassified 2813
58 Ga0070679_100314930 3300005530 Bacteria 1514
59 Ga0068853_100108821 3300005539 Unclassified 2459
60 Ga0070672_100227878 3300005543 Bacteria 1565
61 Ga0068855_100018883 3300005563 Bacteria 8287
62 Ga0068855_100343723 3300005563 Bacteria 1645
63 Ga0068857_100048086 3300005577 Bacteria 3787
64 Ga0068857_100265675 3300005577 Unclassified 1576
65 Ga0068856_100013212 3300005614 Bacteria 7996
66 Ga0068852_100045744 3300005616 Bacteria 3725
67 Ga0068852_100146426 3300005616 Bacteria 2191
68 Ga0068852_100365285 3300005616 Bacteria 1413
69 Ga0068859_100000089 3300005617 Bacteria 83676
70 Ga0068859_100201256 3300005617 Unclassified 2076
71 Ga0068859_100509235 3300005617 Unclassified 1299
72 Ga0068866_10130829 3300005718 Unclassified 1427
73 Ga0068851_10000104 3300005834 Bacteria 45630
74 Ga0068851_10126220 3300005834 Bacteria 1380
75 Ga0068863_100008477 3300005841 Bacteria 10040
76 Ga0068863_100010261 3300005841 Bacteria 9105
77 Ga0068863_100203680 3300005841 Unclassified 1904
78 Ga0068858_100093772 3300005842 Bacteria 2795
79 Ga0068860_100002698 3300005843 Bacteria 18476
80 Ga0068860_100005329 3300005843 Bacteria 13054
81 Ga0068860_100008876 3300005843 Bacteria 10014
82 Ga0068860_100079229 3300005843 Unclassified 3123
83 Ga0068860_100132068 3300005843 Bacteria 2397
84 Ga0068862_100131073 3300005844 Unclassified 2217
85 Ga0068862_100353589 3300005844 Unclassified 1364
86 Ga0081539_10000284 3300005985 Bacteria 114545
87 Ga0070716_100110710 3300006173 Bacteria 1701
88 Ga0075366_10013051 3300006195 Bacteria 4725
89 Ga0097621_100000978 3300006237 Bacteria 20034
90 Ga0097621_100015270 3300006237 Bacteria 5774
91 Ga0097621_100053493 3300006237 Bacteria 3291
92 Ga0097621_100126748 3300006237 Bacteria 2169
93 Ga0068871_100000089 3300006358 Bacteria 52827
94 Ga0068871_100017241 3300006358 Bacteria 5461
95 Ga0097620_100000089 3300006931 Bacteria 83676
96 Ga0097620_100201258 3300006931 Unclassified 2076
97 Ga0097620_100509227 3300006931 Unclassified 1299
98 Ga0105240_10058814 3300009093 Bacteria 4798
99 Ga0105240_10064879 3300009093 Bacteria 4535
100 Ga0105240_10339399 3300009093 Bacteria 1707
101 Ga0111539_10028371 3300009094 Bacteria 6830
102 Ga0111539_10570402 3300009094 Bacteria 1318
103 Ga0114129_10001037 3300009147 Bacteria 36347
104 Ga0105241_10012002 3300009174 Bacteria 6362
105 Ga0105241_10035856 3300009174 Bacteria 3731
106 Ga0105241_10166099 3300009174 Bacteria 1819
107 Ga0105242_10130900 3300009176 Unclassified 2166
108 Ga0105237_10001373 3300009545 Bacteria 32120
109 Ga0105237_10063442 3300009545 Bacteria 3692
110 Ga0105237_10076970 3300009545 Bacteria 3326
111 Ga0105238_10441330 3300009551 Bacteria 1298
112 Ga0105249_10006300 3300009553 Bacteria 10308
113 Ga0105249_10129368 3300009553 Bacteria 2408
114 Ga0105249_10471192 3300009553 Bacteria 1297
115 Ga0105239_10075129 3300010375 Bacteria 3715
116 Ga0105246_10154289 3300011119 Bacteria 1742
117 Ga0157373_10054985 3300013100 Unclassified 2828
118 Ga0157373_10058440 3300013100 Bacteria 2734
119 Ga0157371_10000830 3300013102 Bacteria 35437
120 Ga0157371_10001566 3300013102 Bacteria 23489
121 Ga0157371_10015653 3300013102 Bacteria 5681
122 Ga0157371_10042322 3300013102 Bacteria 3246
123 Ga0157371_10079071 3300013102 Bacteria 2329
124 Ga0157371_10095384 3300013102 Bacteria 2108
125 Ga0157370_10042391 3300013104 Bacteria 4387
126 Ga0157370_10245756 3300013104 Bacteria 1655
127 Ga0157370_10262336 3300013104 Bacteria 1596
128 Ga0157370_10276769 3300013104 Bacteria 1551
129 Ga0157369_10021418 3300013105 Bacteria 7232
130 Ga0157374_10025755 3300013296 Bacteria 5286
131 Ga0157374_10238226 3300013296 Bacteria 1789
132 Ga0157378_10014388 3300013297 Bacteria 6927
133 Ga0157378_10015487 3300013297 Bacteria 6680
134 Ga0157378_10068631 3300013297 Bacteria 3179
135 Ga0163162_10000241 3300013306 Bacteria 49773
136 Ga0163162_10000306 3300013306 Bacteria 45352
137 Ga0163162_10001396 3300013306 Bacteria 22467
138 Ga0163162_10004654 3300013306 Bacteria 13225
139 Ga0163162_10067292 3300013306 Bacteria 3632
140 Ga0163162_10423041 3300013306 Bacteria 1464
141 Ga0157372_10000484 3300013307 Bacteria 43921
142 Ga0157372_10008100 3300013307 Bacteria 11179
143 Ga0157372_10037218 3300013307 Bacteria 5365
144 Ga0157372_10108334 3300013307 Unclassified 3179
145 Ga0157372_10302990 3300013307 Bacteria 1859
146 Ga0157372_10532625 3300013307 Bacteria 1369
147 Ga0157375_10000119 3300013308 Bacteria 77124
148 Ga0157375_10047752 3300013308 Bacteria 4183
149 Ga0157375_10055070 3300013308 Bacteria 3920
150 Ga0157375_10099648 3300013308 Bacteria 2985
151 Ga0157375_10272536 3300013308 Bacteria 1855
152 Ga0163163_10000204 3300014325 Bacteria 61513
153 Ga0163163_10738882 3300014325 Bacteria 1047
154 Ga0157379_10011726 3300014968 Bacteria 7654
155 Ga0157379_10088456 3300014968 Bacteria 2778
156 Ga0157376_10000365 3300014969 Bacteria 29732
157 Ga0157376_10010817 3300014969 Bacteria 6697
158 Ga0157376_10051261 3300014969 Bacteria 3428
159 Ga0157376_10066086 3300014969 Bacteria 3056
160 Ga0157376_10595803 3300014969 Unclassified 1099
161 Ga0157376_10681091 3300014969 Bacteria 1032
162 Ga0163161_10000012 3300017792 Bacteria 264639
163 Ga0163161_10007618 3300017792 Bacteria 7489
164 Ga0213876_10141042 3300021384 Bacteria 1282
165 Ga0209436_101749 3300025208 Bacteria 7136
166 Ga0209258_100041 3300025242 Bacteria 381381
167 Ga0209646_1000002 3300025246 Bacteria 1425781
168 Ga0209646_1000004 3300025246 Bacteria 786587
169 Ga0209646_1011081 3300025246 Bacteria 1400
170 Ga0209026_1000132 3300025250 Bacteria 119048
171 Ga0209026_1000268 3300025250 Bacteria 62806
172 Ga0209148_1000375 3300025254 Bacteria 54278
173 Ga0209673_1000287 3300025273 Bacteria 94132
174 Ga0209564_1002562 3300025295 Bacteria 13980
175 Ga0209758_1003380 3300025297 Bacteria 14604
176 Ga0209758_1019180 3300025297 Unclassified 3312
177 Ga0209050_1001109 3300025298 Bacteria 32601
178 Ga0207426_1000316 3300025302 Bacteria 94148
179 Ga0207426_1001825 3300025302 Bacteria 15760
180 Ga0207426_1002074 3300025302 Bacteria 13904
181 Ga0207426_1002202 3300025302 Bacteria 13112
182 Ga0209051_1011003 3300025303 Bacteria 4510
183 Ga0209257_1000001 3300025304 Bacteria 2274655
184 Ga0209257_1001992 3300025304 Bacteria 21936
185 Ga0207656_10000149 3300025321 Bacteria 25828
186 Ga0207655_1000608 3300025728 Bacteria 43328
187 Ga0207642_10107816 3300025899 Unclassified 1412
188 Ga0207680_10002345 3300025903 Bacteria 8803
189 Ga0207647_10051912 3300025904 Bacteria 2532
190 Ga0207647_10089237 3300025904 Unclassified 1840
191 Ga0207705_10147806 3300025909 Unclassified 1759
192 Ga0207654_10013701 3300025911 Bacteria 4175
193 Ga0207654_10053199 3300025911 Bacteria 2336
194 Ga0207695_10077407 3300025913 Bacteria 3378
195 Ga0207695_10097765 3300025913 Bacteria 2936
196 Ga0207695_10211368 3300025913 Bacteria 1850
197 Ga0207671_10003658 3300025914 Bacteria 15181
198 Ga0207671_10037414 3300025914 Bacteria 3599
199 Ga0207660_10022808 3300025917 Bacteria 4220
200 Ga0207660_10183704 3300025917 Unclassified 1625
201 Ga0207657_10000767 3300025919 Bacteria 34034
202 Ga0207657_10028650 3300025919 Bacteria 5076
203 Ga0207657_10252043 3300025919 Bacteria 1407
204 Ga0207652_10079936 3300025921 Unclassified 2857
205 Ga0207652_10101845 3300025921 Bacteria 2537
206 Ga0207650_10050381 3300025925 Bacteria 3079
207 Ga0207650_10106621 3300025925 Bacteria 2164
208 Ga0207650_10180384 3300025925 Bacteria 1683
209 Ga0207659_10300670 3300025926 Unclassified 1318
210 Ga0207644_10016188 3300025931 Bacteria 5017
211 Ga0207644_10091378 3300025931 Bacteria 2270
212 Ga0207690_10056078 3300025932 Bacteria 2656
213 Ga0207704_10217975 3300025938 Bacteria 1409
214 Ga0207665_10163934 3300025939 Bacteria 1601
215 Ga0207691_10122833 3300025940 Bacteria 2299
216 Ga0207691_10226049 3300025940 Bacteria 1621
217 Ga0207689_10022455 3300025942 Bacteria 5306
218 Ga0207689_10043866 3300025942 Bacteria 3697
219 Ga0207667_10023905 3300025949 Bacteria 6722
220 Ga0207667_10026286 3300025949 Bacteria 6361
221 Ga0207651_10019872 3300025960 Bacteria 4038
222 Ga0207712_10097756 3300025961 Bacteria 2176
223 Ga0207658_10002320 3300025986 Bacteria 14003
224 Ga0207658_10004011 3300025986 Bacteria 10305
225 Ga0207703_10015907 3300026035 Bacteria 5868
226 Ga0207703_10129669 3300026035 Unclassified 2176
227 Ga0207678_10032428 3300026067 Bacteria 4552
228 Ga0207708_10120272 3300026075 Bacteria 2046
229 Ga0207702_10045238 3300026078 Bacteria 3703
230 Ga0207641_10000816 3300026088 Bacteria 33227
231 Ga0207641_10008035 3300026088 Bacteria 8745
232 Ga0207641_10359648 3300026088 Unclassified 1389
233 Ga0207648_10112864 3300026089 Bacteria 2386
234 Ga0207674_10028979 3300026116 Bacteria 5836
235 Ga0207674_10078877 3300026116 Bacteria 3298
236 Ga0207675_100065533 3300026118 Unclassified 3395
237 Ga0207698_10006590 3300026142 Bacteria 7259
238 Ga0207428_10061753 3300027907 Unclassified 2965
239 Ga0268265_10032526 3300028380 Bacteria 3782
240 Ga0268264_10004595 3300028381 Bacteria 11733
241 Ga0268264_10010783 3300028381 Bacteria 7550
242 Ga0268264_10019630 3300028381 Bacteria 5521
243 Ga0268264_10111703 3300028381 Unclassified 2395
244 Ga0307517_10006911 3300028786 Bacteria 16690
245 Ga0307515_10000001 3300028794 Bacteria 4259510
246 Ga0307515_10000380 3300028794 Bacteria 108537
247 Ga0265338_10054396 3300028800 Bacteria 3570
248 Ga0307511_10001345 3300030521 Bacteria 26061
249 Ga0316176_1126433 3300030732 Bacteria 30105
250 Ga0316181_1286895 3300030744 Bacteria 3148
251 Ga0265327_10001592 3300031251 Bacteria 27689
252 Ga0307513_10014569 3300031456 Bacteria 9574
253 Ga0307509_10132384 3300031507 Bacteria 2446
254 Ga0307509_10177816 3300031507 Bacteria 1997
255 Ga0307408_100001563 3300031548 Bacteria 16927
256 Ga0307408_100004525 3300031548 Bacteria 9427
257 Ga0307508_10004138 3300031616 Bacteria 14278
258 Ga0307508_10351208 3300031616 Bacteria 1066
259 Ga0307412_10295832 3300031911 Unclassified 1277
260 Ga0307414_10006881 3300032004 Bacteria 6365
261 Ga0373937_0488823 3300036401 Bacteria 1169
262 Ga0373937_0489250 3300036401 Bacteria 1169
263 Ga0395900_0286655 3300037418 Bacteria 1637
264 Ga0395898_0126784 3300037466 Unclassified 2445
265 Ga0395901_0245627 3300038443 Bacteria 1866
266 Ga0439439_0042335 3300041406 Bacteria 1183
267 Ga0451839_1286502 3300041496 Bacteria 1194
268 Ga0451853_1619866 3300041512 Bacteria 1296
269 Ga0439449_0049335 3300042007 Bacteria 1558
270 Ga0439457_006139 3300042014 Bacteria 2964
271 Ga0439462_0002714 3300042015 Bacteria 4158
272 Ga0439446_0029657 3300042156 Bacteria 1579
273 Ga0466972_0000021 3300044658 Bacteria 196266
274 Ga0466972_0000121 3300044658 Bacteria 66443
275 Ga0466972_0003280 3300044658 Bacteria 8019
276 Ga0453684_0037529 3300044712 Bacteria 6649
277 Ga0466970_0000944 3300044765 Bacteria 14045
278 Ga0466957_0000518 3300044842 Bacteria 19329
279 Ga0466957_0008843 3300044842 Bacteria 5736
280 Ga0451576_0000022 3300045051 Bacteria 495037
281 Ga0495629_0061978 3300046459 Bacteria 2614
282 Ga0495650_0000003 3300046471 Bacteria 900730
283 Ga0495585_0000678 3300046492 Bacteria 31150
284 Ga0495583_0061159 3300046506 Bacteria 1681
285 Ga0495583_0110719 3300046506 Bacteria 1164
286 Ga0495606_0001265 3300046507 Bacteria 35151
287 Ga0495606_0003654 3300046507 Bacteria 16121
288 Ga0495616_0004206 3300046513 Bacteria 9117
289 Ga0495630_0227948 3300046517 Bacteria 1423
290 Ga0495633_0000005 3300046558 Bacteria 357644
291 Ga0495633_0080188 3300046558 Bacteria 1519
292 Ga0495668_0000426 3300046616 Bacteria 54853
293 Ga0495668_0001856 3300046616 Bacteria 18993
294 Ga0495625_0000005 3300046660 Bacteria 596135
295 Ga0495625_0225806 3300046660 Bacteria 1225
296 Ga0495661_0001399 3300046665 Bacteria 20260
297 Ga0495661_0016163 3300046665 Bacteria 4956
298 Ga0495661_0030017 3300046665 Bacteria 3464
299 Ga0495649_0000003 3300046694 Bacteria 880817
300 Ga0495674_0048961 3300047319 Bacteria 3737
301 Ga0495687_001271 3300047443 Bacteria 23746
302 Ga0496100_0065220 3300048903 Unclassified 2412
303 Ga0496105_0147396 3300048908 Unclassified 1935
304 Ga0496126_0086075 3300048929 Bacteria 2770
305 Ga0501047_0145742 3300049581 Bacteria 2245
306 Ga0501217_006846 3300049661 Bacteria 2432
307 Ga0501236_000559 3300049670 Bacteria 4197
308 Ga0501238_004277 3300049671 Bacteria 1780
309 Ga0501225_0002148 3300049705 Bacteria 6114
310 Ga0501241_000388 3300049758 Bacteria 9633
311 Ga0501264_000417 3300049761 Bacteria 6561
312 Ga0501035_0091523 3300049822 Bacteria 2677
313 Ga0501044_0065257 3300049823 Bacteria 3713
314 nmdc:mga05p37_1709_c2 3300050507 Bacteria 20178
315 nmdc:mga08y16_34233_c1 3300050511 Bacteria 5337
316 Ga0500578_0114326 3300053086 Bacteria 1700
317 Ga0500644_0000160 3300053088 Bacteria 42538
318 Ga0500646_0006766 3300053090 Bacteria 2918
319 Ga0500583_0000013 3300053092 Bacteria 150087
320 Ga0500583_0001256 3300053092 Bacteria 7238
321 Ga0500569_025932 3300053109 Bacteria 1601
322 Ga0500607_072447 3300053121 Bacteria 1776
323 Ga0500652_005048 3300053131 Bacteria 4125
324 Ga0500652_013916 3300053131 Bacteria 2862
325 Ga0500568_0036418 3300053139 Bacteria 2002
326 Ga0500588_0002553 3300053146 Bacteria 3727
327 Ga0500589_005192 3300053147 Bacteria 5034
328 Ga0500590_052286 3300053148 Bacteria 2074
329 Ga0500633_0012158 3300053160 Bacteria 2369
330 Ga0500661_013822 3300055283 Bacteria 1455
331 Ga0466962_0057446 3300061719 Bacteria 1858

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10015487 Ga0157378_100154871 271
2 3300013308 Ga0157375_10055070 Ga0157375_100550702 278
3 3300006173 Ga0070716_100110710 Ga0070716_1001107102 294
4 3300025939 Ga0207665_10163934 Ga0207665_101639343 296
5 3300003323 rootH1_10243521 rootH1_102435212 299
6 3300009553 Ga0105249_10006300 Ga0105249_1000630010 299
7 3300013306 Ga0163162_10000241 Ga0163162_1000024118 299
8 3300013308 Ga0157375_10272536 Ga0157375_102725362 299
9 3300014969 Ga0157376_10051261 Ga0157376_100512612 299
10 3300026075 Ga0207708_10120272 Ga0207708_101202722 299
11 3300031507 Ga0307509_10132384 Ga0307509_101323842 299
12 3300001989 JGI24739J22299_10004452 JGI24739J22299_100044521 300
13 3300002067 JGI24735J21928_10000012 JGI24735J21928_10000012116 300
14 3300005563 Ga0068855_100018883 Ga0068855_1000188837 300
15 3300006195 Ga0075366_10013051 Ga0075366_100130515 300
16 3300006237 Ga0097621_100015270 Ga0097621_1000152701 300
17 3300006358 Ga0068871_100017241 Ga0068871_1000172412 300
18 3300013306 Ga0163162_10004654 Ga0163162_1000465412 300
19 3300013307 Ga0157372_10000484 Ga0157372_1000048431 300
20 3300025904 Ga0207647_10051912 Ga0207647_100519122 300
21 3300025949 Ga0207667_10023905 Ga0207667_100239053 300
22 3300026116 Ga0207674_10078877 Ga0207674_100788772 300
23 3300044658 Ga0466972_0000021 Ga0466972_0000021_25251_26234 300
24 3300044765 Ga0466970_0000944 Ga0466970_0000944_6424_7407 300
25 3300046471 Ga0495650_0000003 Ga0495650_0000003_582257_583237 300
26 3300046492 Ga0495585_0000678 Ga0495585_0000678_16_996 300
27 3300046506 Ga0495583_0061159 Ga0495583_0061159_99_1079 300
28 3300046507 Ga0495606_0001265 Ga0495606_0001265_8441_9421 300
29 3300046507 Ga0495606_0003654 Ga0495606_0003654_1345_2325 300
30 3300046513 Ga0495616_0004206 Ga0495616_0004206_4675_5655 300
31 3300046558 Ga0495633_0080188 Ga0495633_0080188_523_1503 300
32 3300046660 Ga0495625_0000005 Ga0495625_0000005_518438_519418 300
33 3300046665 Ga0495661_0030017 Ga0495661_0030017_99_1079 300
34 3300046694 Ga0495649_0000003 Ga0495649_0000003_699196_700176 300
35 3300047443 Ga0495687_001271 Ga0495687_001271_6230_7210 300
36 3300009174 Ga0105241_10166099 Ga0105241_101660992 301
37 3300025942 Ga0207689_10022455 Ga0207689_100224556 301
38 3300026118 Ga0207675_100065533 Ga0207675_1000655333 301
39 3300003203 JGI25406J46586_10002154 JGI25406J46586_100021541 302
40 3300005331 Ga0070670_100194023 Ga0070670_1001940232 302
41 3300005335 Ga0070666_10035022 Ga0070666_100350225 302
42 3300005367 Ga0070667_100005891 Ga0070667_1000058916 302
43 3300005459 Ga0068867_100038944 Ga0068867_1000389444 302
44 3300005718 Ga0068866_10130829 Ga0068866_101308292 302
45 3300005841 Ga0068863_100203680 Ga0068863_1002036803 302
46 3300005985 Ga0081539_10000284 Ga0081539_1000028465 302
47 3300006237 Ga0097621_100000978 Ga0097621_1000009789 302
48 3300006358 Ga0068871_100000089 Ga0068871_10000008939 302
49 3300013297 Ga0157378_10014388 Ga0157378_100143882 302
50 3300013306 Ga0163162_10001396 Ga0163162_1000139616 302
51 3300013308 Ga0157375_10000119 Ga0157375_100001195 302
52 3300014325 Ga0163163_10000204 Ga0163163_1000020432 302
53 3300014968 Ga0157379_10011726 Ga0157379_100117265 302
54 3300014969 Ga0157376_10000365 Ga0157376_1000036519 302
55 3300017792 Ga0163161_10007618 Ga0163161_100076182 302
56 3300025899 Ga0207642_10107816 Ga0207642_101078161 302
57 3300025925 Ga0207650_10050381 Ga0207650_100503812 302
58 3300025931 Ga0207644_10016188 Ga0207644_100161881 302
59 3300025986 Ga0207658_10004011 Ga0207658_100040116 302
60 3300026088 Ga0207641_10359648 Ga0207641_103596482 302
61 3300031616 Ga0307508_10351208 Ga0307508_103512081 302
62 3300036401 Ga0373937_0489250 Ga0373937_0489250_161_1144 302
63 3300044658 Ga0466972_0000121 Ga0466972_0000121_17062_18042 302
64 3300048903 Ga0496100_0065220 Ga0496100_0065220_208_1197 302
65 3300048908 Ga0496105_0147396 Ga0496105_0147396_616_1605 302
66 3300028794 Ga0307515_10000380 Ga0307515_10000380113 303
67 3300005843 Ga0068860_100132068 Ga0068860_1001320682 304
68 3300025940 Ga0207691_10226049 Ga0207691_102260492 304
69 3300028800 Ga0265338_10054396 Ga0265338_100543965 304
70 3300031616 Ga0307508_10004138 Ga0307508_100041381 304
71 3300041512 Ga0451853_1619866 Ga0451853_1619866_138_1118 304
72 3300044842 Ga0466957_0000518 Ga0466957_0000518_10253_11233 304
73 3300044842 Ga0466957_0008843 Ga0466957_0008843_2786_3766 304
74 3300049823 Ga0501044_0065257 Ga0501044_0065257_1827_2807 304
75 3300061719 Ga0466962_0057446 Ga0466962_0057446_29_1009 304
76 3300005327 Ga0070658_10282310 Ga0070658_102823102 305
77 3300009147 Ga0114129_10001037 Ga0114129_1000103718 305
78 3300009176 Ga0105242_10130900 Ga0105242_101309001 305
79 3300050507 nmdc:mga05p37_1709_c2 nmdc:mga05p37_1709_c2_18777_19757 305
80 3300041496 Ga0451839_1286502 Ga0451839_1286502_93_1073 307
81 3300046665 Ga0495661_0001399 Ga0495661_0001399_7438_8409 307
82 3300002738 JGI25154J39366_1007466 JGI25154J39366_10074662 308
83 3300009094 Ga0111539_10570402 Ga0111539_105704021 308
84 3300013296 Ga0157374_10025755 Ga0157374_100257552 308
85 3300046506 Ga0495583_0110719 Ga0495583_0110719_152_1123 308
86 3300046665 Ga0495661_0016163 Ga0495661_0016163_2271_3242 308
87 3300003354 JGI25160J50197_1001079 JGI25160J50197_100107911 309
88 3300005616 Ga0068852_100146426 Ga0068852_1001464262 309
89 3300013102 Ga0157371_10000830 Ga0157371_1000083024 309
90 3300014969 Ga0157376_10010817 Ga0157376_100108177 309
91 3300025246 Ga0209646_1011081 Ga0209646_10110812 309
92 3300044658 Ga0466972_0003280 Ga0466972_0003280_6017_6997 309
93 3300049581 Ga0501047_0145742 Ga0501047_0145742_190_1329 309
94 3300053086 Ga0500578_0114326 Ga0500578_0114326_394_1374 309
95 3300055283 Ga0500661_013822 Ga0500661_013822_391_1371 309
96 3300031507 Ga0307509_10177816 Ga0307509_101778161 310
97 3300049705 Ga0501225_0002148 Ga0501225_0002148_3451_4431 310
98 3300013297 Ga0157378_10068631 Ga0157378_100686313 311
99 3300036401 Ga0373937_0488823 Ga0373937_0488823_97_1071 311
100 3300005843 Ga0068860_100002698 Ga0068860_10000269814 313
101 3300005843 Ga0068860_100079229 Ga0068860_1000792293 313
102 3300009174 Ga0105241_10035856 Ga0105241_100358564 313
103 3300013306 Ga0163162_10000306 Ga0163162_1000030622 313
104 3300014969 Ga0157376_10681091 Ga0157376_106810911 313
105 3300028381 Ga0268264_10019630 Ga0268264_100196302 313
106 3300041406 Ga0439439_0042335 Ga0439439_0042335_88_1068 313
107 3300042014 Ga0439457_006139 Ga0439457_006139_797_1777 313
108 3300042015 Ga0439462_0002714 Ga0439462_0002714_633_1613 313
109 3300053092 Ga0500583_0000013 Ga0500583_0000013_109713_110693 313
110 3300005614 Ga0068856_100013212 Ga0068856_1000132123 314
111 3300009093 Ga0105240_10064879 Ga0105240_100648794 314
112 3300009174 Ga0105241_10012002 Ga0105241_100120024 314
113 3300009545 Ga0105237_10063442 Ga0105237_100634424 314
114 3300025911 Ga0207654_10013701 Ga0207654_100137014 314
115 3300025913 Ga0207695_10097765 Ga0207695_100977654 314
116 3300026078 Ga0207702_10045238 Ga0207702_100452384 314
117 3300028381 Ga0268264_10111703 Ga0268264_101117031 315
118 3300031456 Ga0307513_10014569 Ga0307513_100145693 315
119 3300003322 rootL2_10049556 rootL2_100495563 317
120 3300053146 Ga0500588_0002553 Ga0500588_0002553_159_1145 317
121 iso_pu_bacteria 2852623160 2852625590 317
122 iso_pu_bacteria 2884933994 2884934589 317
123 3300005530 Ga0070679_100104857 Ga0070679_1001048573 319
124 3300025921 Ga0207652_10079936 Ga0207652_100799363 319
125 3300009551 Ga0105238_10441330 Ga0105238_104413302 321
126 3300009553 Ga0105249_10471192 Ga0105249_104711922 321
127 3300014969 Ga0157376_10595803 Ga0157376_105958031 321
128 iso_pu_bacteria 2738541278 2738728733 321
129 iso_pu_bacteria 2738541279 2738732484 321
130 iso_pu_bacteria 2738541285 2738765049 321
131 iso_pu_bacteria 2738543007 2739214064 321
132 iso_pu_bacteria 2818991444 2819589589 321
133 iso_pu_bacteria 2840677318 2840677814 321
134 iso_pu_bacteria 2881247448 2881248489 321
135 iso_pu_bacteria 2896085136 2896085632 321
136 iso_pu_bacteria 2896109856 2896112267 321
137 iso_pu_bacteria 2911138879 2911143337 321
138 iso_pu_bacteria 2919186247 2919188262 321
139 iso_pu_bacteria 2928078545 2928079542 321
140 iso_pu_bacteria 2928147474 2928147975 321
141 iso_pu_bacteria 2929177148 2929182317 321
142 iso_pu_bacteria 2929921140 2929922269 321
143 iso_pu_bacteria 2929921140 2929923776 321
144 iso_pu_bacteria 2932082852 2932083749 321
145 iso_pu_bacteria 2939664404 2939664471 321
146 iso_pu_bacteria 2945977869 2945978233 321
147 iso_pu_bacteria 2946013367 2946015906 321
148 iso_pu_bacteria 8003151029 8003153792 321
149 iso_pu_bacteria 8003151029 8003154774 321
150 3300046459 Ga0495629_0061978 Ga0495629_0061978_1391_2362 322
151 3300046517 Ga0495630_0227948 Ga0495630_0227948_256_1227 322
152 3300047319 Ga0495674_0048961 Ga0495674_0048961_880_1851 322
153 iso_pu_bacteria 2842903701 2842907882 322
154 iso_pu_bacteria 2929239360 2929241080 322
155 3300005354 Ga0070675_100347754 Ga0070675_1003477541 323
156 3300005842 Ga0068858_100093772 Ga0068858_1000937725 323
157 3300009093 Ga0105240_10058814 Ga0105240_100588143 323
158 3300013296 Ga0157374_10238226 Ga0157374_102382262 323
159 3300025913 Ga0207695_10077407 Ga0207695_100774075 323
160 3300025925 Ga0207650_10180384 Ga0207650_101803842 323
161 3300025926 Ga0207659_10300670 Ga0207659_103006702 323
162 3300026035 Ga0207703_10129669 Ga0207703_101296693 323
163 3300031548 Ga0307408_100001563 Ga0307408_10000156316 323
164 3300038443 Ga0395901_0245627 Ga0395901_0245627_733_1710 323
165 3300044712 Ga0453684_0037529 Ga0453684_0037529_739_1713 323
166 iso_pu_bacteria 2929921140 2929922268 323
167 iso_pu_bacteria 8003151029 8003154775 323
168 3300005327 Ga0070658_10136808 Ga0070658_101368083 324
169 3300005336 Ga0070680_100004810 Ga0070680_10000481010 324
170 3300005337 Ga0070682_100000018 Ga0070682_100000018129 324
171 3300005339 Ga0070660_100038718 Ga0070660_1000387183 324
172 3300005366 Ga0070659_100034511 Ga0070659_1000345113 324
173 3300005458 Ga0070681_10068307 Ga0070681_100683072 324
174 3300005530 Ga0070679_100081385 Ga0070679_1000813852 324
175 3300005530 Ga0070679_100314930 Ga0070679_1003149301 324
176 3300005539 Ga0068853_100108821 Ga0068853_1001088212 324
177 3300005577 Ga0068857_100048086 Ga0068857_1000480861 324
178 3300013102 Ga0157371_10042322 Ga0157371_100423223 324
179 3300013102 Ga0157371_10095384 Ga0157371_100953842 324
180 3300013306 Ga0163162_10423041 Ga0163162_104230412 324
181 3300013307 Ga0157372_10108334 Ga0157372_101083342 324
182 3300025904 Ga0207647_10089237 Ga0207647_100892373 324
183 3300025919 Ga0207657_10028650 Ga0207657_100286504 324
184 3300025921 Ga0207652_10101845 Ga0207652_101018452 324
185 3300025932 Ga0207690_10056078 Ga0207690_100560782 324
186 3300001979 JGI24740J21852_10010245 JGI24740J21852_100102453 325
187 3300001989 JGI24739J22299_10000559 JGI24739J22299_100005596 325
188 3300002738 JGI25154J39366_1000014 JGI25154J39366_100001425 325
189 3300002739 JGI25158J39367_1013426 JGI25158J39367_10134261 325
190 3300002741 JGI25157J39369_1005206 JGI25157J39369_10052061 325
191 3300003215 JGI25153J46596_10012591 JGI25153J46596_100125912 325
192 3300003215 JGI25153J46596_10034455 JGI25153J46596_100344552 325
193 3300003320 rootH2_10006056 rootH2_1000605611 325
194 3300003320 rootH2_10201560 rootH2_102015602 325
195 3300003323 rootH1_10004563 rootH1_100045635 325
196 3300003323 rootH1_10335630 rootH1_103356303 325
197 3300003354 JGI25160J50197_1000961 JGI25160J50197_10009617 325
198 3300003354 JGI25160J50197_1002671 JGI25160J50197_10026715 325
199 3300003761 Ga0055535_1003099 Ga0055535_10030994 325
200 3300003762 Ga0055542_1003308 Ga0055542_10033084 325
201 3300003790 Ga0055528_1000177 Ga0055528_100017725 325
202 3300003791 Ga0055530_10002240 Ga0055530_100022405 325
203 3300003794 Ga0055531_10000041 Ga0055531_1000004139 325
204 3300005262 Ga0065165_1000022 Ga0065165_100002295 325
205 3300005262 Ga0065165_1017255 Ga0065165_10172552 325
206 3300005288 Ga0065714_10073811 Ga0065714_100738114 325
207 3300005327 Ga0070658_10031923 Ga0070658_100319232 325
208 3300005335 Ga0070666_10005054 Ga0070666_100050545 325
209 3300005365 Ga0070688_100143949 Ga0070688_1001439491 325
210 3300005367 Ga0070667_100309129 Ga0070667_1003091292 325
211 3300005455 Ga0070663_100191448 Ga0070663_1001914481 325
212 3300005543 Ga0070672_100227878 Ga0070672_1002278782 325
213 3300005563 Ga0068855_100343723 Ga0068855_1003437232 325
214 3300005577 Ga0068857_100265675 Ga0068857_1002656752 325
215 3300005616 Ga0068852_100045744 Ga0068852_1000457445 325
216 3300005616 Ga0068852_100365285 Ga0068852_1003652852 325
217 3300005617 Ga0068859_100000089 Ga0068859_1000000895 325
218 3300005617 Ga0068859_100509235 Ga0068859_1005092352 325
219 3300005834 Ga0068851_10126220 Ga0068851_101262202 325
220 3300005841 Ga0068863_100008477 Ga0068863_1000084776 325
221 3300005843 Ga0068860_100008876 Ga0068860_1000088766 325
222 3300005844 Ga0068862_100131073 Ga0068862_1001310732 325
223 3300005844 Ga0068862_100353589 Ga0068862_1003535891 325
224 3300006237 Ga0097621_100053493 Ga0097621_1000534932 325
225 3300006237 Ga0097621_100126748 Ga0097621_1001267482 325
226 3300006931 Ga0097620_100000089 Ga0097620_1000000895 325
227 3300006931 Ga0097620_100509227 Ga0097620_1005092272 325
228 3300009093 Ga0105240_10339399 Ga0105240_103393991 325
229 3300009545 Ga0105237_10076970 Ga0105237_100769701 325
230 3300009553 Ga0105249_10129368 Ga0105249_101293684 325
231 3300011119 Ga0105246_10154289 Ga0105246_101542892 325
232 3300013100 Ga0157373_10054985 Ga0157373_100549852 325
233 3300013100 Ga0157373_10058440 Ga0157373_100584403 325
234 3300013102 Ga0157371_10001566 Ga0157371_1000156620 325
235 3300013102 Ga0157371_10079071 Ga0157371_100790713 325
236 3300013104 Ga0157370_10042391 Ga0157370_100423912 325
237 3300013104 Ga0157370_10245756 Ga0157370_102457562 325
238 3300013104 Ga0157370_10262336 Ga0157370_102623362 325
239 3300013104 Ga0157370_10276769 Ga0157370_102767691 325
240 3300013105 Ga0157369_10021418 Ga0157369_100214183 325
241 3300013306 Ga0163162_10067292 Ga0163162_100672925 325
242 3300013307 Ga0157372_10302990 Ga0157372_103029901 325
243 3300013308 Ga0157375_10099648 Ga0157375_100996482 325
244 3300014968 Ga0157379_10088456 Ga0157379_100884561 325
245 3300014969 Ga0157376_10066086 Ga0157376_100660862 325
246 3300017792 Ga0163161_10000012 Ga0163161_1000001226 325
247 3300021384 Ga0213876_10141042 Ga0213876_101410421 325
248 3300025208 Ga0209436_101749 Ga0209436_1017492 325
249 3300025242 Ga0209258_100041 Ga0209258_100041282 325
250 3300025246 Ga0209646_1000002 Ga0209646_10000021102 325
251 3300025250 Ga0209026_1000268 Ga0209026_100026824 325
252 3300025254 Ga0209148_1000375 Ga0209148_100037520 325
253 3300025273 Ga0209673_1000287 Ga0209673_10002879 325
254 3300025295 Ga0209564_1002562 Ga0209564_100256211 325
255 3300025297 Ga0209758_1003380 Ga0209758_100338010 325
256 3300025298 Ga0209050_1001109 Ga0209050_10011096 325
257 3300025302 Ga0207426_1001825 Ga0207426_100182513 325
258 3300025302 Ga0207426_1002074 Ga0207426_100207413 325
259 3300025302 Ga0207426_1002202 Ga0207426_100220210 325
260 3300025303 Ga0209051_1011003 Ga0209051_10110033 325
261 3300025304 Ga0209257_1000001 Ga0209257_1000001831 325
262 3300025304 Ga0209257_1001992 Ga0209257_10019923 325
263 3300025903 Ga0207680_10002345 Ga0207680_100023456 325
264 3300025909 Ga0207705_10147806 Ga0207705_101478062 325
265 3300025911 Ga0207654_10053199 Ga0207654_100531992 325
266 3300025913 Ga0207695_10211368 Ga0207695_102113681 325
267 3300025914 Ga0207671_10037414 Ga0207671_100374144 325
268 3300025917 Ga0207660_10022808 Ga0207660_100228083 325
269 3300025917 Ga0207660_10183704 Ga0207660_101837041 325
270 3300025919 Ga0207657_10000767 Ga0207657_1000076725 325
271 3300025919 Ga0207657_10252043 Ga0207657_102520432 325
272 3300025931 Ga0207644_10091378 Ga0207644_100913783 325
273 3300025938 Ga0207704_10217975 Ga0207704_102179752 325
274 3300025942 Ga0207689_10043866 Ga0207689_100438664 325
275 3300025949 Ga0207667_10026286 Ga0207667_100262864 325
276 3300025961 Ga0207712_10097756 Ga0207712_100977561 325
277 3300026035 Ga0207703_10015907 Ga0207703_100159074 325
278 3300026067 Ga0207678_10032428 Ga0207678_100324287 325
279 3300026088 Ga0207641_10000816 Ga0207641_1000081618 325
280 3300026116 Ga0207674_10028979 Ga0207674_100289795 325
281 3300026142 Ga0207698_10006590 Ga0207698_100065905 325
282 3300028380 Ga0268265_10032526 Ga0268265_100325263 325
283 3300028381 Ga0268264_10010783 Ga0268264_100107836 325
284 3300028786 Ga0307517_10006911 Ga0307517_100069118 325
285 3300031548 Ga0307408_100004525 Ga0307408_1000045253 325
286 3300037466 Ga0395898_0126784 Ga0395898_0126784_463_1443 325
287 3300042007 Ga0439449_0049335 Ga0439449_0049335_382_1362 325
288 3300042156 Ga0439446_0029657 Ga0439446_0029657_541_1521 325
289 3300046558 Ga0495633_0000005 Ga0495633_0000005_71992_72972 325
290 3300046616 Ga0495668_0000426 Ga0495668_0000426_48269_49252 325
291 3300046660 Ga0495625_0225806 Ga0495625_0225806_141_1121 325
292 3300048929 Ga0496126_0086075 Ga0496126_0086075_392_1372 325
293 3300049661 Ga0501217_006846 Ga0501217_006846_219_1202 325
294 3300049670 Ga0501236_000559 Ga0501236_000559_1517_2500 325
295 3300049671 Ga0501238_004277 Ga0501238_004277_11_994 325
296 3300049758 Ga0501241_000388 Ga0501241_000388_2198_3178 325
297 3300049761 Ga0501264_000417 Ga0501264_000417_1806_2789 325
298 3300053088 Ga0500644_0000160 Ga0500644_0000160_24038_25018 325
299 3300053090 Ga0500646_0006766 Ga0500646_0006766_1553_2533 325
300 3300053109 Ga0500569_025932 Ga0500569_025932_465_1445 325
301 3300053121 Ga0500607_072447 Ga0500607_072447_236_1216 325
302 3300053131 Ga0500652_013916 Ga0500652_013916_1686_2666 325
303 3300053139 Ga0500568_0036418 Ga0500568_0036418_13_993 325
304 3300053148 Ga0500590_052286 Ga0500590_052286_262_1242 325
305 3300053160 Ga0500633_0012158 Ga0500633_0012158_859_1839 325
306 3300005617 Ga0068859_100201256 Ga0068859_1002012563 326
307 3300006931 Ga0097620_100201258 Ga0097620_1002012583 326
308 3300009094 Ga0111539_10028371 Ga0111539_100283719 326
309 3300009545 Ga0105237_10001373 Ga0105237_1000137330 326
310 3300013307 Ga0157372_10008100 Ga0157372_100081005 326
311 3300025914 Ga0207671_10003658 Ga0207671_1000365817 326
312 3300026089 Ga0207648_10112864 Ga0207648_101128643 326
313 3300027907 Ga0207428_10061753 Ga0207428_100617533 326
314 3300030521 Ga0307511_10001345 Ga0307511_1000134514 326
315 3300030732 Ga0316176_1126433 Ga0316176_112643311 326
316 3300030744 Ga0316181_1286895 Ga0316181_12868953 326
317 3300031251 Ga0265327_10001592 Ga0265327_1000159211 326
318 3300037418 Ga0395900_0286655 Ga0395900_0286655_16_999 326
319 3300045051 Ga0451576_0000022 Ga0451576_0000022_430068_431051 326
320 3300050511 nmdc:mga08y16_34233_c1 nmdc:mga08y16_34233_c1_1833_2816 326
321 3300053092 Ga0500583_0001256 Ga0500583_0001256_1610_2593 326
322 3300053147 Ga0500589_005192 Ga0500589_005192_143_1126 326
323 3300001979 JGI24740J21852_10007889 JGI24740J21852_100078892 327
324 3300001989 JGI24739J22299_10022352 JGI24739J22299_100223522 327
325 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003287 327
326 3300003215 JGI25153J46596_10011686 JGI25153J46596_100116863 327
327 3300003323 rootH1_10132616 rootH1_101326164 327
328 3300003354 JGI25160J50197_1007413 JGI25160J50197_10074133 327
329 3300005288 Ga0065714_10083631 Ga0065714_100836312 327
330 3300005338 Ga0068868_100004350 Ga0068868_1000043505 327
331 3300005367 Ga0070667_100002577 Ga0070667_1000025775 327
332 3300005466 Ga0070685_10026046 Ga0070685_100260464 327
333 3300005834 Ga0068851_10000104 Ga0068851_1000010422 327
334 3300005841 Ga0068863_100010261 Ga0068863_1000102615 327
335 3300005843 Ga0068860_100005329 Ga0068860_1000053296 327
336 3300010375 Ga0105239_10075129 Ga0105239_100751292 327
337 3300013102 Ga0157371_10015653 Ga0157371_100156532 327
338 3300013307 Ga0157372_10037218 Ga0157372_100372182 327
339 3300013307 Ga0157372_10532625 Ga0157372_105326252 327
340 3300013308 Ga0157375_10047752 Ga0157375_100477521 327
341 3300014325 Ga0163163_10738882 Ga0163163_107388821 327
342 3300025246 Ga0209646_1000004 Ga0209646_100000453 327
343 3300025250 Ga0209026_1000132 Ga0209026_10001322 327
344 3300025297 Ga0209758_1019180 Ga0209758_10191803 327
345 3300025302 Ga0207426_1000316 Ga0207426_100031672 327
346 3300025321 Ga0207656_10000149 Ga0207656_1000014922 327
347 3300025728 Ga0207655_1000608 Ga0207655_100060851 327
348 3300025925 Ga0207650_10106621 Ga0207650_101066211 327
349 3300025940 Ga0207691_10122833 Ga0207691_101228331 327
350 3300025960 Ga0207651_10019872 Ga0207651_100198724 327
351 3300025986 Ga0207658_10002320 Ga0207658_100023205 327
352 3300026088 Ga0207641_10008035 Ga0207641_100080354 327
353 3300028381 Ga0268264_10004595 Ga0268264_100045959 327
354 3300028794 Ga0307515_10000001 Ga0307515_100000011520 327
355 3300031911 Ga0307412_10295832 Ga0307412_102958322 327
356 3300032004 Ga0307414_10006881 Ga0307414_100068816 327
357 3300046616 Ga0495668_0001856 Ga0495668_0001856_3829_4815 327
358 3300049822 Ga0501035_0091523 Ga0501035_0091523_914_1897 327
359 3300053131 Ga0500652_005048 Ga0500652_005048_2921_3904 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

301

365

0.94

PF01965

DJ-1_PfpI

DJ-1/PfpI family

88

241

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9605 218 318
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9588 216 319
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9409 219 315
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9322 217 318
1u8b-assembly1.cif.gz_A crystal structure of the methylated n-ada/dna complex 0.9309 217 268
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9697 267 318 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9645 217 318 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9605 218 318 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9591 217 317 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9548 262 318 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I3UER9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9887 218 324 GO:0003700
GO:0043565
AF-A0A1X7LGY3-F1-model_v4 AraC family transcriptional regulator, regulatory protein of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase 0.9833 216 317 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A2T6D8T8-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.979 217 318 GO:0003700
GO:0043565
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.9784 216 316 GO:0003700
GO:0043565
AF-A4X6Y1-F1-model_v4 Transcriptional regulator, AraC family 0.9754 215 316 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.58 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map