F421479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 221 | 331 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100132068|Ga0068860_1001320682 |
| Length | 367 |
| Sequence | MYQRLSGLTECENDFLAGCSRLYSSLPLIKTRKAKGSGQQAEKYPLPLLASNFYITTYCYISMKHISILIPHDSVMASIVDPRIIFTGVNDFLAAAGKAPVFKVQLVGLTREVQLHNGTFTVHSDVLIGEVKKTDLILVPAIGGDLKTAIKKNEAFLPWIVDQYHQGAEVASLCIGAFLLASTGLLNGKECSSHWLTANEFREMFPEVTLVDGRIVTEQQGLYSSGGASSYWNLLLHLIEKHAGREMAIMAAKVYALEIDRKTQSPFIMFNGQKKHEDESIKQAQEFIEKNVTERISVEELAIRYAIGKRHFIRRFKKATNNTPIEYIQRVKIEAAKKQLENSRKNVNEVMYDVGYSDVKAFRTVEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 3 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 4 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 5 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 6 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 7 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 8 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 9 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 10 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 11 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 12 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 13 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 14 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 15 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 16 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 17 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 18 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 19 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 20 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 21 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 22 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 23 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 28 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 155 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 168 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 172 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 173 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 198 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 201 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 202 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 208 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 210 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 211 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 212 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 213 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 214 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 215 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 216 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 217 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 219 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 220 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 221 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.2 |
| Metatranscriptomes | 0 |
| Isolates | 7.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 73.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007889 | 3300001979 | Bacteria | 4294 |
| 2 | JGI24740J21852_10010245 | 3300001979 | Bacteria | 3622 |
| 3 | JGI24739J22299_10000559 | 3300001989 | Bacteria | 13370 |
| 4 | JGI24739J22299_10004452 | 3300001989 | Bacteria | 5368 |
| 5 | JGI24739J22299_10022352 | 3300001989 | Unclassified | 2244 |
| 6 | JGI24735J21928_10000012 | 3300002067 | Bacteria | 208921 |
| 7 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 8 | JGI25154J39366_1000014 | 3300002738 | Bacteria | 265287 |
| 9 | JGI25154J39366_1007466 | 3300002738 | Bacteria | 1494 |
| 10 | JGI25158J39367_1013426 | 3300002739 | Bacteria | 1071 |
| 11 | JGI25157J39369_1005206 | 3300002741 | Bacteria | 2164 |
| 12 | JGI25406J46586_10002154 | 3300003203 | Bacteria | 9315 |
| 13 | JGI25153J46596_10011686 | 3300003215 | Unclassified | 3858 |
| 14 | JGI25153J46596_10012591 | 3300003215 | Bacteria | 3635 |
| 15 | JGI25153J46596_10034455 | 3300003215 | Bacteria | 1655 |
| 16 | rootH2_10006056 | 3300003320 | Bacteria | 27891 |
| 17 | rootH2_10201560 | 3300003320 | Bacteria | 1403 |
| 18 | rootL2_10049556 | 3300003322 | Bacteria | 4932 |
| 19 | rootH1_10004563 | 3300003323 | Bacteria | 12500 |
| 20 | rootH1_10132616 | 3300003323 | Bacteria | 3907 |
| 21 | rootH1_10243521 | 3300003323 | Bacteria | 1403 |
| 22 | rootH1_10335630 | 3300003323 | Bacteria | 1962 |
| 23 | JGI25160J50197_1000961 | 3300003354 | Bacteria | 15091 |
| 24 | JGI25160J50197_1001079 | 3300003354 | Bacteria | 13985 |
| 25 | JGI25160J50197_1002671 | 3300003354 | Bacteria | 8208 |
| 26 | JGI25160J50197_1007413 | 3300003354 | Bacteria | 4295 |
| 27 | Ga0055535_1003099 | 3300003761 | Bacteria | 5015 |
| 28 | Ga0055542_1003308 | 3300003762 | Bacteria | 4461 |
| 29 | Ga0055528_1000177 | 3300003790 | Bacteria | 53906 |
| 30 | Ga0055530_10002240 | 3300003791 | Bacteria | 12734 |
| 31 | Ga0055531_10000041 | 3300003794 | Bacteria | 135600 |
| 32 | Ga0065165_1000022 | 3300005262 | Bacteria | 253404 |
| 33 | Ga0065165_1017255 | 3300005262 | Bacteria | 2667 |
| 34 | Ga0065714_10073811 | 3300005288 | Bacteria | 3127 |
| 35 | Ga0065714_10083631 | 3300005288 | Unclassified | 2229 |
| 36 | Ga0070658_10031923 | 3300005327 | Bacteria | 4232 |
| 37 | Ga0070658_10136808 | 3300005327 | Unclassified | 2044 |
| 38 | Ga0070658_10282310 | 3300005327 | Bacteria | 1413 |
| 39 | Ga0070670_100194023 | 3300005331 | Bacteria | 1764 |
| 40 | Ga0070666_10005054 | 3300005335 | Bacteria | 8069 |
| 41 | Ga0070666_10035022 | 3300005335 | Bacteria | 3328 |
| 42 | Ga0070680_100004810 | 3300005336 | Bacteria | 10166 |
| 43 | Ga0070682_100000018 | 3300005337 | Bacteria | 229427 |
| 44 | Ga0068868_100004350 | 3300005338 | Bacteria | 9933 |
| 45 | Ga0070660_100038718 | 3300005339 | Bacteria | 3620 |
| 46 | Ga0070675_100347754 | 3300005354 | Unclassified | 1314 |
| 47 | Ga0070688_100143949 | 3300005365 | Bacteria | 1622 |
| 48 | Ga0070659_100034511 | 3300005366 | Bacteria | 3935 |
| 49 | Ga0070667_100002577 | 3300005367 | Bacteria | 15746 |
| 50 | Ga0070667_100005891 | 3300005367 | Bacteria | 10210 |
| 51 | Ga0070667_100309129 | 3300005367 | Bacteria | 1424 |
| 52 | Ga0070663_100191448 | 3300005455 | Bacteria | 1592 |
| 53 | Ga0070681_10068307 | 3300005458 | Bacteria | 3521 |
| 54 | Ga0068867_100038944 | 3300005459 | Unclassified | 3463 |
| 55 | Ga0070685_10026046 | 3300005466 | Bacteria | 3221 |
| 56 | Ga0070679_100081385 | 3300005530 | Bacteria | 3227 |
| 57 | Ga0070679_100104857 | 3300005530 | Unclassified | 2813 |
| 58 | Ga0070679_100314930 | 3300005530 | Bacteria | 1514 |
| 59 | Ga0068853_100108821 | 3300005539 | Unclassified | 2459 |
| 60 | Ga0070672_100227878 | 3300005543 | Bacteria | 1565 |
| 61 | Ga0068855_100018883 | 3300005563 | Bacteria | 8287 |
| 62 | Ga0068855_100343723 | 3300005563 | Bacteria | 1645 |
| 63 | Ga0068857_100048086 | 3300005577 | Bacteria | 3787 |
| 64 | Ga0068857_100265675 | 3300005577 | Unclassified | 1576 |
| 65 | Ga0068856_100013212 | 3300005614 | Bacteria | 7996 |
| 66 | Ga0068852_100045744 | 3300005616 | Bacteria | 3725 |
| 67 | Ga0068852_100146426 | 3300005616 | Bacteria | 2191 |
| 68 | Ga0068852_100365285 | 3300005616 | Bacteria | 1413 |
| 69 | Ga0068859_100000089 | 3300005617 | Bacteria | 83676 |
| 70 | Ga0068859_100201256 | 3300005617 | Unclassified | 2076 |
| 71 | Ga0068859_100509235 | 3300005617 | Unclassified | 1299 |
| 72 | Ga0068866_10130829 | 3300005718 | Unclassified | 1427 |
| 73 | Ga0068851_10000104 | 3300005834 | Bacteria | 45630 |
| 74 | Ga0068851_10126220 | 3300005834 | Bacteria | 1380 |
| 75 | Ga0068863_100008477 | 3300005841 | Bacteria | 10040 |
| 76 | Ga0068863_100010261 | 3300005841 | Bacteria | 9105 |
| 77 | Ga0068863_100203680 | 3300005841 | Unclassified | 1904 |
| 78 | Ga0068858_100093772 | 3300005842 | Bacteria | 2795 |
| 79 | Ga0068860_100002698 | 3300005843 | Bacteria | 18476 |
| 80 | Ga0068860_100005329 | 3300005843 | Bacteria | 13054 |
| 81 | Ga0068860_100008876 | 3300005843 | Bacteria | 10014 |
| 82 | Ga0068860_100079229 | 3300005843 | Unclassified | 3123 |
| 83 | Ga0068860_100132068 | 3300005843 | Bacteria | 2397 |
| 84 | Ga0068862_100131073 | 3300005844 | Unclassified | 2217 |
| 85 | Ga0068862_100353589 | 3300005844 | Unclassified | 1364 |
| 86 | Ga0081539_10000284 | 3300005985 | Bacteria | 114545 |
| 87 | Ga0070716_100110710 | 3300006173 | Bacteria | 1701 |
| 88 | Ga0075366_10013051 | 3300006195 | Bacteria | 4725 |
| 89 | Ga0097621_100000978 | 3300006237 | Bacteria | 20034 |
| 90 | Ga0097621_100015270 | 3300006237 | Bacteria | 5774 |
| 91 | Ga0097621_100053493 | 3300006237 | Bacteria | 3291 |
| 92 | Ga0097621_100126748 | 3300006237 | Bacteria | 2169 |
| 93 | Ga0068871_100000089 | 3300006358 | Bacteria | 52827 |
| 94 | Ga0068871_100017241 | 3300006358 | Bacteria | 5461 |
| 95 | Ga0097620_100000089 | 3300006931 | Bacteria | 83676 |
| 96 | Ga0097620_100201258 | 3300006931 | Unclassified | 2076 |
| 97 | Ga0097620_100509227 | 3300006931 | Unclassified | 1299 |
| 98 | Ga0105240_10058814 | 3300009093 | Bacteria | 4798 |
| 99 | Ga0105240_10064879 | 3300009093 | Bacteria | 4535 |
| 100 | Ga0105240_10339399 | 3300009093 | Bacteria | 1707 |
| 101 | Ga0111539_10028371 | 3300009094 | Bacteria | 6830 |
| 102 | Ga0111539_10570402 | 3300009094 | Bacteria | 1318 |
| 103 | Ga0114129_10001037 | 3300009147 | Bacteria | 36347 |
| 104 | Ga0105241_10012002 | 3300009174 | Bacteria | 6362 |
| 105 | Ga0105241_10035856 | 3300009174 | Bacteria | 3731 |
| 106 | Ga0105241_10166099 | 3300009174 | Bacteria | 1819 |
| 107 | Ga0105242_10130900 | 3300009176 | Unclassified | 2166 |
| 108 | Ga0105237_10001373 | 3300009545 | Bacteria | 32120 |
| 109 | Ga0105237_10063442 | 3300009545 | Bacteria | 3692 |
| 110 | Ga0105237_10076970 | 3300009545 | Bacteria | 3326 |
| 111 | Ga0105238_10441330 | 3300009551 | Bacteria | 1298 |
| 112 | Ga0105249_10006300 | 3300009553 | Bacteria | 10308 |
| 113 | Ga0105249_10129368 | 3300009553 | Bacteria | 2408 |
| 114 | Ga0105249_10471192 | 3300009553 | Bacteria | 1297 |
| 115 | Ga0105239_10075129 | 3300010375 | Bacteria | 3715 |
| 116 | Ga0105246_10154289 | 3300011119 | Bacteria | 1742 |
| 117 | Ga0157373_10054985 | 3300013100 | Unclassified | 2828 |
| 118 | Ga0157373_10058440 | 3300013100 | Bacteria | 2734 |
| 119 | Ga0157371_10000830 | 3300013102 | Bacteria | 35437 |
| 120 | Ga0157371_10001566 | 3300013102 | Bacteria | 23489 |
| 121 | Ga0157371_10015653 | 3300013102 | Bacteria | 5681 |
| 122 | Ga0157371_10042322 | 3300013102 | Bacteria | 3246 |
| 123 | Ga0157371_10079071 | 3300013102 | Bacteria | 2329 |
| 124 | Ga0157371_10095384 | 3300013102 | Bacteria | 2108 |
| 125 | Ga0157370_10042391 | 3300013104 | Bacteria | 4387 |
| 126 | Ga0157370_10245756 | 3300013104 | Bacteria | 1655 |
| 127 | Ga0157370_10262336 | 3300013104 | Bacteria | 1596 |
| 128 | Ga0157370_10276769 | 3300013104 | Bacteria | 1551 |
| 129 | Ga0157369_10021418 | 3300013105 | Bacteria | 7232 |
| 130 | Ga0157374_10025755 | 3300013296 | Bacteria | 5286 |
| 131 | Ga0157374_10238226 | 3300013296 | Bacteria | 1789 |
| 132 | Ga0157378_10014388 | 3300013297 | Bacteria | 6927 |
| 133 | Ga0157378_10015487 | 3300013297 | Bacteria | 6680 |
| 134 | Ga0157378_10068631 | 3300013297 | Bacteria | 3179 |
| 135 | Ga0163162_10000241 | 3300013306 | Bacteria | 49773 |
| 136 | Ga0163162_10000306 | 3300013306 | Bacteria | 45352 |
| 137 | Ga0163162_10001396 | 3300013306 | Bacteria | 22467 |
| 138 | Ga0163162_10004654 | 3300013306 | Bacteria | 13225 |
| 139 | Ga0163162_10067292 | 3300013306 | Bacteria | 3632 |
| 140 | Ga0163162_10423041 | 3300013306 | Bacteria | 1464 |
| 141 | Ga0157372_10000484 | 3300013307 | Bacteria | 43921 |
| 142 | Ga0157372_10008100 | 3300013307 | Bacteria | 11179 |
| 143 | Ga0157372_10037218 | 3300013307 | Bacteria | 5365 |
| 144 | Ga0157372_10108334 | 3300013307 | Unclassified | 3179 |
| 145 | Ga0157372_10302990 | 3300013307 | Bacteria | 1859 |
| 146 | Ga0157372_10532625 | 3300013307 | Bacteria | 1369 |
| 147 | Ga0157375_10000119 | 3300013308 | Bacteria | 77124 |
| 148 | Ga0157375_10047752 | 3300013308 | Bacteria | 4183 |
| 149 | Ga0157375_10055070 | 3300013308 | Bacteria | 3920 |
| 150 | Ga0157375_10099648 | 3300013308 | Bacteria | 2985 |
| 151 | Ga0157375_10272536 | 3300013308 | Bacteria | 1855 |
| 152 | Ga0163163_10000204 | 3300014325 | Bacteria | 61513 |
| 153 | Ga0163163_10738882 | 3300014325 | Bacteria | 1047 |
| 154 | Ga0157379_10011726 | 3300014968 | Bacteria | 7654 |
| 155 | Ga0157379_10088456 | 3300014968 | Bacteria | 2778 |
| 156 | Ga0157376_10000365 | 3300014969 | Bacteria | 29732 |
| 157 | Ga0157376_10010817 | 3300014969 | Bacteria | 6697 |
| 158 | Ga0157376_10051261 | 3300014969 | Bacteria | 3428 |
| 159 | Ga0157376_10066086 | 3300014969 | Bacteria | 3056 |
| 160 | Ga0157376_10595803 | 3300014969 | Unclassified | 1099 |
| 161 | Ga0157376_10681091 | 3300014969 | Bacteria | 1032 |
| 162 | Ga0163161_10000012 | 3300017792 | Bacteria | 264639 |
| 163 | Ga0163161_10007618 | 3300017792 | Bacteria | 7489 |
| 164 | Ga0213876_10141042 | 3300021384 | Bacteria | 1282 |
| 165 | Ga0209436_101749 | 3300025208 | Bacteria | 7136 |
| 166 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 167 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 168 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 169 | Ga0209646_1011081 | 3300025246 | Bacteria | 1400 |
| 170 | Ga0209026_1000132 | 3300025250 | Bacteria | 119048 |
| 171 | Ga0209026_1000268 | 3300025250 | Bacteria | 62806 |
| 172 | Ga0209148_1000375 | 3300025254 | Bacteria | 54278 |
| 173 | Ga0209673_1000287 | 3300025273 | Bacteria | 94132 |
| 174 | Ga0209564_1002562 | 3300025295 | Bacteria | 13980 |
| 175 | Ga0209758_1003380 | 3300025297 | Bacteria | 14604 |
| 176 | Ga0209758_1019180 | 3300025297 | Unclassified | 3312 |
| 177 | Ga0209050_1001109 | 3300025298 | Bacteria | 32601 |
| 178 | Ga0207426_1000316 | 3300025302 | Bacteria | 94148 |
| 179 | Ga0207426_1001825 | 3300025302 | Bacteria | 15760 |
| 180 | Ga0207426_1002074 | 3300025302 | Bacteria | 13904 |
| 181 | Ga0207426_1002202 | 3300025302 | Bacteria | 13112 |
| 182 | Ga0209051_1011003 | 3300025303 | Bacteria | 4510 |
| 183 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 184 | Ga0209257_1001992 | 3300025304 | Bacteria | 21936 |
| 185 | Ga0207656_10000149 | 3300025321 | Bacteria | 25828 |
| 186 | Ga0207655_1000608 | 3300025728 | Bacteria | 43328 |
| 187 | Ga0207642_10107816 | 3300025899 | Unclassified | 1412 |
| 188 | Ga0207680_10002345 | 3300025903 | Bacteria | 8803 |
| 189 | Ga0207647_10051912 | 3300025904 | Bacteria | 2532 |
| 190 | Ga0207647_10089237 | 3300025904 | Unclassified | 1840 |
| 191 | Ga0207705_10147806 | 3300025909 | Unclassified | 1759 |
| 192 | Ga0207654_10013701 | 3300025911 | Bacteria | 4175 |
| 193 | Ga0207654_10053199 | 3300025911 | Bacteria | 2336 |
| 194 | Ga0207695_10077407 | 3300025913 | Bacteria | 3378 |
| 195 | Ga0207695_10097765 | 3300025913 | Bacteria | 2936 |
| 196 | Ga0207695_10211368 | 3300025913 | Bacteria | 1850 |
| 197 | Ga0207671_10003658 | 3300025914 | Bacteria | 15181 |
| 198 | Ga0207671_10037414 | 3300025914 | Bacteria | 3599 |
| 199 | Ga0207660_10022808 | 3300025917 | Bacteria | 4220 |
| 200 | Ga0207660_10183704 | 3300025917 | Unclassified | 1625 |
| 201 | Ga0207657_10000767 | 3300025919 | Bacteria | 34034 |
| 202 | Ga0207657_10028650 | 3300025919 | Bacteria | 5076 |
| 203 | Ga0207657_10252043 | 3300025919 | Bacteria | 1407 |
| 204 | Ga0207652_10079936 | 3300025921 | Unclassified | 2857 |
| 205 | Ga0207652_10101845 | 3300025921 | Bacteria | 2537 |
| 206 | Ga0207650_10050381 | 3300025925 | Bacteria | 3079 |
| 207 | Ga0207650_10106621 | 3300025925 | Bacteria | 2164 |
| 208 | Ga0207650_10180384 | 3300025925 | Bacteria | 1683 |
| 209 | Ga0207659_10300670 | 3300025926 | Unclassified | 1318 |
| 210 | Ga0207644_10016188 | 3300025931 | Bacteria | 5017 |
| 211 | Ga0207644_10091378 | 3300025931 | Bacteria | 2270 |
| 212 | Ga0207690_10056078 | 3300025932 | Bacteria | 2656 |
| 213 | Ga0207704_10217975 | 3300025938 | Bacteria | 1409 |
| 214 | Ga0207665_10163934 | 3300025939 | Bacteria | 1601 |
| 215 | Ga0207691_10122833 | 3300025940 | Bacteria | 2299 |
| 216 | Ga0207691_10226049 | 3300025940 | Bacteria | 1621 |
| 217 | Ga0207689_10022455 | 3300025942 | Bacteria | 5306 |
| 218 | Ga0207689_10043866 | 3300025942 | Bacteria | 3697 |
| 219 | Ga0207667_10023905 | 3300025949 | Bacteria | 6722 |
| 220 | Ga0207667_10026286 | 3300025949 | Bacteria | 6361 |
| 221 | Ga0207651_10019872 | 3300025960 | Bacteria | 4038 |
| 222 | Ga0207712_10097756 | 3300025961 | Bacteria | 2176 |
| 223 | Ga0207658_10002320 | 3300025986 | Bacteria | 14003 |
| 224 | Ga0207658_10004011 | 3300025986 | Bacteria | 10305 |
| 225 | Ga0207703_10015907 | 3300026035 | Bacteria | 5868 |
| 226 | Ga0207703_10129669 | 3300026035 | Unclassified | 2176 |
| 227 | Ga0207678_10032428 | 3300026067 | Bacteria | 4552 |
| 228 | Ga0207708_10120272 | 3300026075 | Bacteria | 2046 |
| 229 | Ga0207702_10045238 | 3300026078 | Bacteria | 3703 |
| 230 | Ga0207641_10000816 | 3300026088 | Bacteria | 33227 |
| 231 | Ga0207641_10008035 | 3300026088 | Bacteria | 8745 |
| 232 | Ga0207641_10359648 | 3300026088 | Unclassified | 1389 |
| 233 | Ga0207648_10112864 | 3300026089 | Bacteria | 2386 |
| 234 | Ga0207674_10028979 | 3300026116 | Bacteria | 5836 |
| 235 | Ga0207674_10078877 | 3300026116 | Bacteria | 3298 |
| 236 | Ga0207675_100065533 | 3300026118 | Unclassified | 3395 |
| 237 | Ga0207698_10006590 | 3300026142 | Bacteria | 7259 |
| 238 | Ga0207428_10061753 | 3300027907 | Unclassified | 2965 |
| 239 | Ga0268265_10032526 | 3300028380 | Bacteria | 3782 |
| 240 | Ga0268264_10004595 | 3300028381 | Bacteria | 11733 |
| 241 | Ga0268264_10010783 | 3300028381 | Bacteria | 7550 |
| 242 | Ga0268264_10019630 | 3300028381 | Bacteria | 5521 |
| 243 | Ga0268264_10111703 | 3300028381 | Unclassified | 2395 |
| 244 | Ga0307517_10006911 | 3300028786 | Bacteria | 16690 |
| 245 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 246 | Ga0307515_10000380 | 3300028794 | Bacteria | 108537 |
| 247 | Ga0265338_10054396 | 3300028800 | Bacteria | 3570 |
| 248 | Ga0307511_10001345 | 3300030521 | Bacteria | 26061 |
| 249 | Ga0316176_1126433 | 3300030732 | Bacteria | 30105 |
| 250 | Ga0316181_1286895 | 3300030744 | Bacteria | 3148 |
| 251 | Ga0265327_10001592 | 3300031251 | Bacteria | 27689 |
| 252 | Ga0307513_10014569 | 3300031456 | Bacteria | 9574 |
| 253 | Ga0307509_10132384 | 3300031507 | Bacteria | 2446 |
| 254 | Ga0307509_10177816 | 3300031507 | Bacteria | 1997 |
| 255 | Ga0307408_100001563 | 3300031548 | Bacteria | 16927 |
| 256 | Ga0307408_100004525 | 3300031548 | Bacteria | 9427 |
| 257 | Ga0307508_10004138 | 3300031616 | Bacteria | 14278 |
| 258 | Ga0307508_10351208 | 3300031616 | Bacteria | 1066 |
| 259 | Ga0307412_10295832 | 3300031911 | Unclassified | 1277 |
| 260 | Ga0307414_10006881 | 3300032004 | Bacteria | 6365 |
| 261 | Ga0373937_0488823 | 3300036401 | Bacteria | 1169 |
| 262 | Ga0373937_0489250 | 3300036401 | Bacteria | 1169 |
| 263 | Ga0395900_0286655 | 3300037418 | Bacteria | 1637 |
| 264 | Ga0395898_0126784 | 3300037466 | Unclassified | 2445 |
| 265 | Ga0395901_0245627 | 3300038443 | Bacteria | 1866 |
| 266 | Ga0439439_0042335 | 3300041406 | Bacteria | 1183 |
| 267 | Ga0451839_1286502 | 3300041496 | Bacteria | 1194 |
| 268 | Ga0451853_1619866 | 3300041512 | Bacteria | 1296 |
| 269 | Ga0439449_0049335 | 3300042007 | Bacteria | 1558 |
| 270 | Ga0439457_006139 | 3300042014 | Bacteria | 2964 |
| 271 | Ga0439462_0002714 | 3300042015 | Bacteria | 4158 |
| 272 | Ga0439446_0029657 | 3300042156 | Bacteria | 1579 |
| 273 | Ga0466972_0000021 | 3300044658 | Bacteria | 196266 |
| 274 | Ga0466972_0000121 | 3300044658 | Bacteria | 66443 |
| 275 | Ga0466972_0003280 | 3300044658 | Bacteria | 8019 |
| 276 | Ga0453684_0037529 | 3300044712 | Bacteria | 6649 |
| 277 | Ga0466970_0000944 | 3300044765 | Bacteria | 14045 |
| 278 | Ga0466957_0000518 | 3300044842 | Bacteria | 19329 |
| 279 | Ga0466957_0008843 | 3300044842 | Bacteria | 5736 |
| 280 | Ga0451576_0000022 | 3300045051 | Bacteria | 495037 |
| 281 | Ga0495629_0061978 | 3300046459 | Bacteria | 2614 |
| 282 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 283 | Ga0495585_0000678 | 3300046492 | Bacteria | 31150 |
| 284 | Ga0495583_0061159 | 3300046506 | Bacteria | 1681 |
| 285 | Ga0495583_0110719 | 3300046506 | Bacteria | 1164 |
| 286 | Ga0495606_0001265 | 3300046507 | Bacteria | 35151 |
| 287 | Ga0495606_0003654 | 3300046507 | Bacteria | 16121 |
| 288 | Ga0495616_0004206 | 3300046513 | Bacteria | 9117 |
| 289 | Ga0495630_0227948 | 3300046517 | Bacteria | 1423 |
| 290 | Ga0495633_0000005 | 3300046558 | Bacteria | 357644 |
| 291 | Ga0495633_0080188 | 3300046558 | Bacteria | 1519 |
| 292 | Ga0495668_0000426 | 3300046616 | Bacteria | 54853 |
| 293 | Ga0495668_0001856 | 3300046616 | Bacteria | 18993 |
| 294 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 295 | Ga0495625_0225806 | 3300046660 | Bacteria | 1225 |
| 296 | Ga0495661_0001399 | 3300046665 | Bacteria | 20260 |
| 297 | Ga0495661_0016163 | 3300046665 | Bacteria | 4956 |
| 298 | Ga0495661_0030017 | 3300046665 | Bacteria | 3464 |
| 299 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 300 | Ga0495674_0048961 | 3300047319 | Bacteria | 3737 |
| 301 | Ga0495687_001271 | 3300047443 | Bacteria | 23746 |
| 302 | Ga0496100_0065220 | 3300048903 | Unclassified | 2412 |
| 303 | Ga0496105_0147396 | 3300048908 | Unclassified | 1935 |
| 304 | Ga0496126_0086075 | 3300048929 | Bacteria | 2770 |
| 305 | Ga0501047_0145742 | 3300049581 | Bacteria | 2245 |
| 306 | Ga0501217_006846 | 3300049661 | Bacteria | 2432 |
| 307 | Ga0501236_000559 | 3300049670 | Bacteria | 4197 |
| 308 | Ga0501238_004277 | 3300049671 | Bacteria | 1780 |
| 309 | Ga0501225_0002148 | 3300049705 | Bacteria | 6114 |
| 310 | Ga0501241_000388 | 3300049758 | Bacteria | 9633 |
| 311 | Ga0501264_000417 | 3300049761 | Bacteria | 6561 |
| 312 | Ga0501035_0091523 | 3300049822 | Bacteria | 2677 |
| 313 | Ga0501044_0065257 | 3300049823 | Bacteria | 3713 |
| 314 | nmdc:mga05p37_1709_c2 | 3300050507 | Bacteria | 20178 |
| 315 | nmdc:mga08y16_34233_c1 | 3300050511 | Bacteria | 5337 |
| 316 | Ga0500578_0114326 | 3300053086 | Bacteria | 1700 |
| 317 | Ga0500644_0000160 | 3300053088 | Bacteria | 42538 |
| 318 | Ga0500646_0006766 | 3300053090 | Bacteria | 2918 |
| 319 | Ga0500583_0000013 | 3300053092 | Bacteria | 150087 |
| 320 | Ga0500583_0001256 | 3300053092 | Bacteria | 7238 |
| 321 | Ga0500569_025932 | 3300053109 | Bacteria | 1601 |
| 322 | Ga0500607_072447 | 3300053121 | Bacteria | 1776 |
| 323 | Ga0500652_005048 | 3300053131 | Bacteria | 4125 |
| 324 | Ga0500652_013916 | 3300053131 | Bacteria | 2862 |
| 325 | Ga0500568_0036418 | 3300053139 | Bacteria | 2002 |
| 326 | Ga0500588_0002553 | 3300053146 | Bacteria | 3727 |
| 327 | Ga0500589_005192 | 3300053147 | Bacteria | 5034 |
| 328 | Ga0500590_052286 | 3300053148 | Bacteria | 2074 |
| 329 | Ga0500633_0012158 | 3300053160 | Bacteria | 2369 |
| 330 | Ga0500661_013822 | 3300055283 | Bacteria | 1455 |
| 331 | Ga0466962_0057446 | 3300061719 | Bacteria | 1858 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10015487 | Ga0157378_100154871 | 271 |
| 2 | 3300013308 | Ga0157375_10055070 | Ga0157375_100550702 | 278 |
| 3 | 3300006173 | Ga0070716_100110710 | Ga0070716_1001107102 | 294 |
| 4 | 3300025939 | Ga0207665_10163934 | Ga0207665_101639343 | 296 |
| 5 | 3300003323 | rootH1_10243521 | rootH1_102435212 | 299 |
| 6 | 3300009553 | Ga0105249_10006300 | Ga0105249_1000630010 | 299 |
| 7 | 3300013306 | Ga0163162_10000241 | Ga0163162_1000024118 | 299 |
| 8 | 3300013308 | Ga0157375_10272536 | Ga0157375_102725362 | 299 |
| 9 | 3300014969 | Ga0157376_10051261 | Ga0157376_100512612 | 299 |
| 10 | 3300026075 | Ga0207708_10120272 | Ga0207708_101202722 | 299 |
| 11 | 3300031507 | Ga0307509_10132384 | Ga0307509_101323842 | 299 |
| 12 | 3300001989 | JGI24739J22299_10004452 | JGI24739J22299_100044521 | 300 |
| 13 | 3300002067 | JGI24735J21928_10000012 | JGI24735J21928_10000012116 | 300 |
| 14 | 3300005563 | Ga0068855_100018883 | Ga0068855_1000188837 | 300 |
| 15 | 3300006195 | Ga0075366_10013051 | Ga0075366_100130515 | 300 |
| 16 | 3300006237 | Ga0097621_100015270 | Ga0097621_1000152701 | 300 |
| 17 | 3300006358 | Ga0068871_100017241 | Ga0068871_1000172412 | 300 |
| 18 | 3300013306 | Ga0163162_10004654 | Ga0163162_1000465412 | 300 |
| 19 | 3300013307 | Ga0157372_10000484 | Ga0157372_1000048431 | 300 |
| 20 | 3300025904 | Ga0207647_10051912 | Ga0207647_100519122 | 300 |
| 21 | 3300025949 | Ga0207667_10023905 | Ga0207667_100239053 | 300 |
| 22 | 3300026116 | Ga0207674_10078877 | Ga0207674_100788772 | 300 |
| 23 | 3300044658 | Ga0466972_0000021 | Ga0466972_0000021_25251_26234 | 300 |
| 24 | 3300044765 | Ga0466970_0000944 | Ga0466970_0000944_6424_7407 | 300 |
| 25 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_582257_583237 | 300 |
| 26 | 3300046492 | Ga0495585_0000678 | Ga0495585_0000678_16_996 | 300 |
| 27 | 3300046506 | Ga0495583_0061159 | Ga0495583_0061159_99_1079 | 300 |
| 28 | 3300046507 | Ga0495606_0001265 | Ga0495606_0001265_8441_9421 | 300 |
| 29 | 3300046507 | Ga0495606_0003654 | Ga0495606_0003654_1345_2325 | 300 |
| 30 | 3300046513 | Ga0495616_0004206 | Ga0495616_0004206_4675_5655 | 300 |
| 31 | 3300046558 | Ga0495633_0080188 | Ga0495633_0080188_523_1503 | 300 |
| 32 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_518438_519418 | 300 |
| 33 | 3300046665 | Ga0495661_0030017 | Ga0495661_0030017_99_1079 | 300 |
| 34 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_699196_700176 | 300 |
| 35 | 3300047443 | Ga0495687_001271 | Ga0495687_001271_6230_7210 | 300 |
| 36 | 3300009174 | Ga0105241_10166099 | Ga0105241_101660992 | 301 |
| 37 | 3300025942 | Ga0207689_10022455 | Ga0207689_100224556 | 301 |
| 38 | 3300026118 | Ga0207675_100065533 | Ga0207675_1000655333 | 301 |
| 39 | 3300003203 | JGI25406J46586_10002154 | JGI25406J46586_100021541 | 302 |
| 40 | 3300005331 | Ga0070670_100194023 | Ga0070670_1001940232 | 302 |
| 41 | 3300005335 | Ga0070666_10035022 | Ga0070666_100350225 | 302 |
| 42 | 3300005367 | Ga0070667_100005891 | Ga0070667_1000058916 | 302 |
| 43 | 3300005459 | Ga0068867_100038944 | Ga0068867_1000389444 | 302 |
| 44 | 3300005718 | Ga0068866_10130829 | Ga0068866_101308292 | 302 |
| 45 | 3300005841 | Ga0068863_100203680 | Ga0068863_1002036803 | 302 |
| 46 | 3300005985 | Ga0081539_10000284 | Ga0081539_1000028465 | 302 |
| 47 | 3300006237 | Ga0097621_100000978 | Ga0097621_1000009789 | 302 |
| 48 | 3300006358 | Ga0068871_100000089 | Ga0068871_10000008939 | 302 |
| 49 | 3300013297 | Ga0157378_10014388 | Ga0157378_100143882 | 302 |
| 50 | 3300013306 | Ga0163162_10001396 | Ga0163162_1000139616 | 302 |
| 51 | 3300013308 | Ga0157375_10000119 | Ga0157375_100001195 | 302 |
| 52 | 3300014325 | Ga0163163_10000204 | Ga0163163_1000020432 | 302 |
| 53 | 3300014968 | Ga0157379_10011726 | Ga0157379_100117265 | 302 |
| 54 | 3300014969 | Ga0157376_10000365 | Ga0157376_1000036519 | 302 |
| 55 | 3300017792 | Ga0163161_10007618 | Ga0163161_100076182 | 302 |
| 56 | 3300025899 | Ga0207642_10107816 | Ga0207642_101078161 | 302 |
| 57 | 3300025925 | Ga0207650_10050381 | Ga0207650_100503812 | 302 |
| 58 | 3300025931 | Ga0207644_10016188 | Ga0207644_100161881 | 302 |
| 59 | 3300025986 | Ga0207658_10004011 | Ga0207658_100040116 | 302 |
| 60 | 3300026088 | Ga0207641_10359648 | Ga0207641_103596482 | 302 |
| 61 | 3300031616 | Ga0307508_10351208 | Ga0307508_103512081 | 302 |
| 62 | 3300036401 | Ga0373937_0489250 | Ga0373937_0489250_161_1144 | 302 |
| 63 | 3300044658 | Ga0466972_0000121 | Ga0466972_0000121_17062_18042 | 302 |
| 64 | 3300048903 | Ga0496100_0065220 | Ga0496100_0065220_208_1197 | 302 |
| 65 | 3300048908 | Ga0496105_0147396 | Ga0496105_0147396_616_1605 | 302 |
| 66 | 3300028794 | Ga0307515_10000380 | Ga0307515_10000380113 | 303 |
| 67 | 3300005843 | Ga0068860_100132068 | Ga0068860_1001320682 | 304 |
| 68 | 3300025940 | Ga0207691_10226049 | Ga0207691_102260492 | 304 |
| 69 | 3300028800 | Ga0265338_10054396 | Ga0265338_100543965 | 304 |
| 70 | 3300031616 | Ga0307508_10004138 | Ga0307508_100041381 | 304 |
| 71 | 3300041512 | Ga0451853_1619866 | Ga0451853_1619866_138_1118 | 304 |
| 72 | 3300044842 | Ga0466957_0000518 | Ga0466957_0000518_10253_11233 | 304 |
| 73 | 3300044842 | Ga0466957_0008843 | Ga0466957_0008843_2786_3766 | 304 |
| 74 | 3300049823 | Ga0501044_0065257 | Ga0501044_0065257_1827_2807 | 304 |
| 75 | 3300061719 | Ga0466962_0057446 | Ga0466962_0057446_29_1009 | 304 |
| 76 | 3300005327 | Ga0070658_10282310 | Ga0070658_102823102 | 305 |
| 77 | 3300009147 | Ga0114129_10001037 | Ga0114129_1000103718 | 305 |
| 78 | 3300009176 | Ga0105242_10130900 | Ga0105242_101309001 | 305 |
| 79 | 3300050507 | nmdc:mga05p37_1709_c2 | nmdc:mga05p37_1709_c2_18777_19757 | 305 |
| 80 | 3300041496 | Ga0451839_1286502 | Ga0451839_1286502_93_1073 | 307 |
| 81 | 3300046665 | Ga0495661_0001399 | Ga0495661_0001399_7438_8409 | 307 |
| 82 | 3300002738 | JGI25154J39366_1007466 | JGI25154J39366_10074662 | 308 |
| 83 | 3300009094 | Ga0111539_10570402 | Ga0111539_105704021 | 308 |
| 84 | 3300013296 | Ga0157374_10025755 | Ga0157374_100257552 | 308 |
| 85 | 3300046506 | Ga0495583_0110719 | Ga0495583_0110719_152_1123 | 308 |
| 86 | 3300046665 | Ga0495661_0016163 | Ga0495661_0016163_2271_3242 | 308 |
| 87 | 3300003354 | JGI25160J50197_1001079 | JGI25160J50197_100107911 | 309 |
| 88 | 3300005616 | Ga0068852_100146426 | Ga0068852_1001464262 | 309 |
| 89 | 3300013102 | Ga0157371_10000830 | Ga0157371_1000083024 | 309 |
| 90 | 3300014969 | Ga0157376_10010817 | Ga0157376_100108177 | 309 |
| 91 | 3300025246 | Ga0209646_1011081 | Ga0209646_10110812 | 309 |
| 92 | 3300044658 | Ga0466972_0003280 | Ga0466972_0003280_6017_6997 | 309 |
| 93 | 3300049581 | Ga0501047_0145742 | Ga0501047_0145742_190_1329 | 309 |
| 94 | 3300053086 | Ga0500578_0114326 | Ga0500578_0114326_394_1374 | 309 |
| 95 | 3300055283 | Ga0500661_013822 | Ga0500661_013822_391_1371 | 309 |
| 96 | 3300031507 | Ga0307509_10177816 | Ga0307509_101778161 | 310 |
| 97 | 3300049705 | Ga0501225_0002148 | Ga0501225_0002148_3451_4431 | 310 |
| 98 | 3300013297 | Ga0157378_10068631 | Ga0157378_100686313 | 311 |
| 99 | 3300036401 | Ga0373937_0488823 | Ga0373937_0488823_97_1071 | 311 |
| 100 | 3300005843 | Ga0068860_100002698 | Ga0068860_10000269814 | 313 |
| 101 | 3300005843 | Ga0068860_100079229 | Ga0068860_1000792293 | 313 |
| 102 | 3300009174 | Ga0105241_10035856 | Ga0105241_100358564 | 313 |
| 103 | 3300013306 | Ga0163162_10000306 | Ga0163162_1000030622 | 313 |
| 104 | 3300014969 | Ga0157376_10681091 | Ga0157376_106810911 | 313 |
| 105 | 3300028381 | Ga0268264_10019630 | Ga0268264_100196302 | 313 |
| 106 | 3300041406 | Ga0439439_0042335 | Ga0439439_0042335_88_1068 | 313 |
| 107 | 3300042014 | Ga0439457_006139 | Ga0439457_006139_797_1777 | 313 |
| 108 | 3300042015 | Ga0439462_0002714 | Ga0439462_0002714_633_1613 | 313 |
| 109 | 3300053092 | Ga0500583_0000013 | Ga0500583_0000013_109713_110693 | 313 |
| 110 | 3300005614 | Ga0068856_100013212 | Ga0068856_1000132123 | 314 |
| 111 | 3300009093 | Ga0105240_10064879 | Ga0105240_100648794 | 314 |
| 112 | 3300009174 | Ga0105241_10012002 | Ga0105241_100120024 | 314 |
| 113 | 3300009545 | Ga0105237_10063442 | Ga0105237_100634424 | 314 |
| 114 | 3300025911 | Ga0207654_10013701 | Ga0207654_100137014 | 314 |
| 115 | 3300025913 | Ga0207695_10097765 | Ga0207695_100977654 | 314 |
| 116 | 3300026078 | Ga0207702_10045238 | Ga0207702_100452384 | 314 |
| 117 | 3300028381 | Ga0268264_10111703 | Ga0268264_101117031 | 315 |
| 118 | 3300031456 | Ga0307513_10014569 | Ga0307513_100145693 | 315 |
| 119 | 3300003322 | rootL2_10049556 | rootL2_100495563 | 317 |
| 120 | 3300053146 | Ga0500588_0002553 | Ga0500588_0002553_159_1145 | 317 |
| 121 | iso_pu_bacteria | 2852623160 | 2852625590 | 317 |
| 122 | iso_pu_bacteria | 2884933994 | 2884934589 | 317 |
| 123 | 3300005530 | Ga0070679_100104857 | Ga0070679_1001048573 | 319 |
| 124 | 3300025921 | Ga0207652_10079936 | Ga0207652_100799363 | 319 |
| 125 | 3300009551 | Ga0105238_10441330 | Ga0105238_104413302 | 321 |
| 126 | 3300009553 | Ga0105249_10471192 | Ga0105249_104711922 | 321 |
| 127 | 3300014969 | Ga0157376_10595803 | Ga0157376_105958031 | 321 |
| 128 | iso_pu_bacteria | 2738541278 | 2738728733 | 321 |
| 129 | iso_pu_bacteria | 2738541279 | 2738732484 | 321 |
| 130 | iso_pu_bacteria | 2738541285 | 2738765049 | 321 |
| 131 | iso_pu_bacteria | 2738543007 | 2739214064 | 321 |
| 132 | iso_pu_bacteria | 2818991444 | 2819589589 | 321 |
| 133 | iso_pu_bacteria | 2840677318 | 2840677814 | 321 |
| 134 | iso_pu_bacteria | 2881247448 | 2881248489 | 321 |
| 135 | iso_pu_bacteria | 2896085136 | 2896085632 | 321 |
| 136 | iso_pu_bacteria | 2896109856 | 2896112267 | 321 |
| 137 | iso_pu_bacteria | 2911138879 | 2911143337 | 321 |
| 138 | iso_pu_bacteria | 2919186247 | 2919188262 | 321 |
| 139 | iso_pu_bacteria | 2928078545 | 2928079542 | 321 |
| 140 | iso_pu_bacteria | 2928147474 | 2928147975 | 321 |
| 141 | iso_pu_bacteria | 2929177148 | 2929182317 | 321 |
| 142 | iso_pu_bacteria | 2929921140 | 2929922269 | 321 |
| 143 | iso_pu_bacteria | 2929921140 | 2929923776 | 321 |
| 144 | iso_pu_bacteria | 2932082852 | 2932083749 | 321 |
| 145 | iso_pu_bacteria | 2939664404 | 2939664471 | 321 |
| 146 | iso_pu_bacteria | 2945977869 | 2945978233 | 321 |
| 147 | iso_pu_bacteria | 2946013367 | 2946015906 | 321 |
| 148 | iso_pu_bacteria | 8003151029 | 8003153792 | 321 |
| 149 | iso_pu_bacteria | 8003151029 | 8003154774 | 321 |
| 150 | 3300046459 | Ga0495629_0061978 | Ga0495629_0061978_1391_2362 | 322 |
| 151 | 3300046517 | Ga0495630_0227948 | Ga0495630_0227948_256_1227 | 322 |
| 152 | 3300047319 | Ga0495674_0048961 | Ga0495674_0048961_880_1851 | 322 |
| 153 | iso_pu_bacteria | 2842903701 | 2842907882 | 322 |
| 154 | iso_pu_bacteria | 2929239360 | 2929241080 | 322 |
| 155 | 3300005354 | Ga0070675_100347754 | Ga0070675_1003477541 | 323 |
| 156 | 3300005842 | Ga0068858_100093772 | Ga0068858_1000937725 | 323 |
| 157 | 3300009093 | Ga0105240_10058814 | Ga0105240_100588143 | 323 |
| 158 | 3300013296 | Ga0157374_10238226 | Ga0157374_102382262 | 323 |
| 159 | 3300025913 | Ga0207695_10077407 | Ga0207695_100774075 | 323 |
| 160 | 3300025925 | Ga0207650_10180384 | Ga0207650_101803842 | 323 |
| 161 | 3300025926 | Ga0207659_10300670 | Ga0207659_103006702 | 323 |
| 162 | 3300026035 | Ga0207703_10129669 | Ga0207703_101296693 | 323 |
| 163 | 3300031548 | Ga0307408_100001563 | Ga0307408_10000156316 | 323 |
| 164 | 3300038443 | Ga0395901_0245627 | Ga0395901_0245627_733_1710 | 323 |
| 165 | 3300044712 | Ga0453684_0037529 | Ga0453684_0037529_739_1713 | 323 |
| 166 | iso_pu_bacteria | 2929921140 | 2929922268 | 323 |
| 167 | iso_pu_bacteria | 8003151029 | 8003154775 | 323 |
| 168 | 3300005327 | Ga0070658_10136808 | Ga0070658_101368083 | 324 |
| 169 | 3300005336 | Ga0070680_100004810 | Ga0070680_10000481010 | 324 |
| 170 | 3300005337 | Ga0070682_100000018 | Ga0070682_100000018129 | 324 |
| 171 | 3300005339 | Ga0070660_100038718 | Ga0070660_1000387183 | 324 |
| 172 | 3300005366 | Ga0070659_100034511 | Ga0070659_1000345113 | 324 |
| 173 | 3300005458 | Ga0070681_10068307 | Ga0070681_100683072 | 324 |
| 174 | 3300005530 | Ga0070679_100081385 | Ga0070679_1000813852 | 324 |
| 175 | 3300005530 | Ga0070679_100314930 | Ga0070679_1003149301 | 324 |
| 176 | 3300005539 | Ga0068853_100108821 | Ga0068853_1001088212 | 324 |
| 177 | 3300005577 | Ga0068857_100048086 | Ga0068857_1000480861 | 324 |
| 178 | 3300013102 | Ga0157371_10042322 | Ga0157371_100423223 | 324 |
| 179 | 3300013102 | Ga0157371_10095384 | Ga0157371_100953842 | 324 |
| 180 | 3300013306 | Ga0163162_10423041 | Ga0163162_104230412 | 324 |
| 181 | 3300013307 | Ga0157372_10108334 | Ga0157372_101083342 | 324 |
| 182 | 3300025904 | Ga0207647_10089237 | Ga0207647_100892373 | 324 |
| 183 | 3300025919 | Ga0207657_10028650 | Ga0207657_100286504 | 324 |
| 184 | 3300025921 | Ga0207652_10101845 | Ga0207652_101018452 | 324 |
| 185 | 3300025932 | Ga0207690_10056078 | Ga0207690_100560782 | 324 |
| 186 | 3300001979 | JGI24740J21852_10010245 | JGI24740J21852_100102453 | 325 |
| 187 | 3300001989 | JGI24739J22299_10000559 | JGI24739J22299_100005596 | 325 |
| 188 | 3300002738 | JGI25154J39366_1000014 | JGI25154J39366_100001425 | 325 |
| 189 | 3300002739 | JGI25158J39367_1013426 | JGI25158J39367_10134261 | 325 |
| 190 | 3300002741 | JGI25157J39369_1005206 | JGI25157J39369_10052061 | 325 |
| 191 | 3300003215 | JGI25153J46596_10012591 | JGI25153J46596_100125912 | 325 |
| 192 | 3300003215 | JGI25153J46596_10034455 | JGI25153J46596_100344552 | 325 |
| 193 | 3300003320 | rootH2_10006056 | rootH2_1000605611 | 325 |
| 194 | 3300003320 | rootH2_10201560 | rootH2_102015602 | 325 |
| 195 | 3300003323 | rootH1_10004563 | rootH1_100045635 | 325 |
| 196 | 3300003323 | rootH1_10335630 | rootH1_103356303 | 325 |
| 197 | 3300003354 | JGI25160J50197_1000961 | JGI25160J50197_10009617 | 325 |
| 198 | 3300003354 | JGI25160J50197_1002671 | JGI25160J50197_10026715 | 325 |
| 199 | 3300003761 | Ga0055535_1003099 | Ga0055535_10030994 | 325 |
| 200 | 3300003762 | Ga0055542_1003308 | Ga0055542_10033084 | 325 |
| 201 | 3300003790 | Ga0055528_1000177 | Ga0055528_100017725 | 325 |
| 202 | 3300003791 | Ga0055530_10002240 | Ga0055530_100022405 | 325 |
| 203 | 3300003794 | Ga0055531_10000041 | Ga0055531_1000004139 | 325 |
| 204 | 3300005262 | Ga0065165_1000022 | Ga0065165_100002295 | 325 |
| 205 | 3300005262 | Ga0065165_1017255 | Ga0065165_10172552 | 325 |
| 206 | 3300005288 | Ga0065714_10073811 | Ga0065714_100738114 | 325 |
| 207 | 3300005327 | Ga0070658_10031923 | Ga0070658_100319232 | 325 |
| 208 | 3300005335 | Ga0070666_10005054 | Ga0070666_100050545 | 325 |
| 209 | 3300005365 | Ga0070688_100143949 | Ga0070688_1001439491 | 325 |
| 210 | 3300005367 | Ga0070667_100309129 | Ga0070667_1003091292 | 325 |
| 211 | 3300005455 | Ga0070663_100191448 | Ga0070663_1001914481 | 325 |
| 212 | 3300005543 | Ga0070672_100227878 | Ga0070672_1002278782 | 325 |
| 213 | 3300005563 | Ga0068855_100343723 | Ga0068855_1003437232 | 325 |
| 214 | 3300005577 | Ga0068857_100265675 | Ga0068857_1002656752 | 325 |
| 215 | 3300005616 | Ga0068852_100045744 | Ga0068852_1000457445 | 325 |
| 216 | 3300005616 | Ga0068852_100365285 | Ga0068852_1003652852 | 325 |
| 217 | 3300005617 | Ga0068859_100000089 | Ga0068859_1000000895 | 325 |
| 218 | 3300005617 | Ga0068859_100509235 | Ga0068859_1005092352 | 325 |
| 219 | 3300005834 | Ga0068851_10126220 | Ga0068851_101262202 | 325 |
| 220 | 3300005841 | Ga0068863_100008477 | Ga0068863_1000084776 | 325 |
| 221 | 3300005843 | Ga0068860_100008876 | Ga0068860_1000088766 | 325 |
| 222 | 3300005844 | Ga0068862_100131073 | Ga0068862_1001310732 | 325 |
| 223 | 3300005844 | Ga0068862_100353589 | Ga0068862_1003535891 | 325 |
| 224 | 3300006237 | Ga0097621_100053493 | Ga0097621_1000534932 | 325 |
| 225 | 3300006237 | Ga0097621_100126748 | Ga0097621_1001267482 | 325 |
| 226 | 3300006931 | Ga0097620_100000089 | Ga0097620_1000000895 | 325 |
| 227 | 3300006931 | Ga0097620_100509227 | Ga0097620_1005092272 | 325 |
| 228 | 3300009093 | Ga0105240_10339399 | Ga0105240_103393991 | 325 |
| 229 | 3300009545 | Ga0105237_10076970 | Ga0105237_100769701 | 325 |
| 230 | 3300009553 | Ga0105249_10129368 | Ga0105249_101293684 | 325 |
| 231 | 3300011119 | Ga0105246_10154289 | Ga0105246_101542892 | 325 |
| 232 | 3300013100 | Ga0157373_10054985 | Ga0157373_100549852 | 325 |
| 233 | 3300013100 | Ga0157373_10058440 | Ga0157373_100584403 | 325 |
| 234 | 3300013102 | Ga0157371_10001566 | Ga0157371_1000156620 | 325 |
| 235 | 3300013102 | Ga0157371_10079071 | Ga0157371_100790713 | 325 |
| 236 | 3300013104 | Ga0157370_10042391 | Ga0157370_100423912 | 325 |
| 237 | 3300013104 | Ga0157370_10245756 | Ga0157370_102457562 | 325 |
| 238 | 3300013104 | Ga0157370_10262336 | Ga0157370_102623362 | 325 |
| 239 | 3300013104 | Ga0157370_10276769 | Ga0157370_102767691 | 325 |
| 240 | 3300013105 | Ga0157369_10021418 | Ga0157369_100214183 | 325 |
| 241 | 3300013306 | Ga0163162_10067292 | Ga0163162_100672925 | 325 |
| 242 | 3300013307 | Ga0157372_10302990 | Ga0157372_103029901 | 325 |
| 243 | 3300013308 | Ga0157375_10099648 | Ga0157375_100996482 | 325 |
| 244 | 3300014968 | Ga0157379_10088456 | Ga0157379_100884561 | 325 |
| 245 | 3300014969 | Ga0157376_10066086 | Ga0157376_100660862 | 325 |
| 246 | 3300017792 | Ga0163161_10000012 | Ga0163161_1000001226 | 325 |
| 247 | 3300021384 | Ga0213876_10141042 | Ga0213876_101410421 | 325 |
| 248 | 3300025208 | Ga0209436_101749 | Ga0209436_1017492 | 325 |
| 249 | 3300025242 | Ga0209258_100041 | Ga0209258_100041282 | 325 |
| 250 | 3300025246 | Ga0209646_1000002 | Ga0209646_10000021102 | 325 |
| 251 | 3300025250 | Ga0209026_1000268 | Ga0209026_100026824 | 325 |
| 252 | 3300025254 | Ga0209148_1000375 | Ga0209148_100037520 | 325 |
| 253 | 3300025273 | Ga0209673_1000287 | Ga0209673_10002879 | 325 |
| 254 | 3300025295 | Ga0209564_1002562 | Ga0209564_100256211 | 325 |
| 255 | 3300025297 | Ga0209758_1003380 | Ga0209758_100338010 | 325 |
| 256 | 3300025298 | Ga0209050_1001109 | Ga0209050_10011096 | 325 |
| 257 | 3300025302 | Ga0207426_1001825 | Ga0207426_100182513 | 325 |
| 258 | 3300025302 | Ga0207426_1002074 | Ga0207426_100207413 | 325 |
| 259 | 3300025302 | Ga0207426_1002202 | Ga0207426_100220210 | 325 |
| 260 | 3300025303 | Ga0209051_1011003 | Ga0209051_10110033 | 325 |
| 261 | 3300025304 | Ga0209257_1000001 | Ga0209257_1000001831 | 325 |
| 262 | 3300025304 | Ga0209257_1001992 | Ga0209257_10019923 | 325 |
| 263 | 3300025903 | Ga0207680_10002345 | Ga0207680_100023456 | 325 |
| 264 | 3300025909 | Ga0207705_10147806 | Ga0207705_101478062 | 325 |
| 265 | 3300025911 | Ga0207654_10053199 | Ga0207654_100531992 | 325 |
| 266 | 3300025913 | Ga0207695_10211368 | Ga0207695_102113681 | 325 |
| 267 | 3300025914 | Ga0207671_10037414 | Ga0207671_100374144 | 325 |
| 268 | 3300025917 | Ga0207660_10022808 | Ga0207660_100228083 | 325 |
| 269 | 3300025917 | Ga0207660_10183704 | Ga0207660_101837041 | 325 |
| 270 | 3300025919 | Ga0207657_10000767 | Ga0207657_1000076725 | 325 |
| 271 | 3300025919 | Ga0207657_10252043 | Ga0207657_102520432 | 325 |
| 272 | 3300025931 | Ga0207644_10091378 | Ga0207644_100913783 | 325 |
| 273 | 3300025938 | Ga0207704_10217975 | Ga0207704_102179752 | 325 |
| 274 | 3300025942 | Ga0207689_10043866 | Ga0207689_100438664 | 325 |
| 275 | 3300025949 | Ga0207667_10026286 | Ga0207667_100262864 | 325 |
| 276 | 3300025961 | Ga0207712_10097756 | Ga0207712_100977561 | 325 |
| 277 | 3300026035 | Ga0207703_10015907 | Ga0207703_100159074 | 325 |
| 278 | 3300026067 | Ga0207678_10032428 | Ga0207678_100324287 | 325 |
| 279 | 3300026088 | Ga0207641_10000816 | Ga0207641_1000081618 | 325 |
| 280 | 3300026116 | Ga0207674_10028979 | Ga0207674_100289795 | 325 |
| 281 | 3300026142 | Ga0207698_10006590 | Ga0207698_100065905 | 325 |
| 282 | 3300028380 | Ga0268265_10032526 | Ga0268265_100325263 | 325 |
| 283 | 3300028381 | Ga0268264_10010783 | Ga0268264_100107836 | 325 |
| 284 | 3300028786 | Ga0307517_10006911 | Ga0307517_100069118 | 325 |
| 285 | 3300031548 | Ga0307408_100004525 | Ga0307408_1000045253 | 325 |
| 286 | 3300037466 | Ga0395898_0126784 | Ga0395898_0126784_463_1443 | 325 |
| 287 | 3300042007 | Ga0439449_0049335 | Ga0439449_0049335_382_1362 | 325 |
| 288 | 3300042156 | Ga0439446_0029657 | Ga0439446_0029657_541_1521 | 325 |
| 289 | 3300046558 | Ga0495633_0000005 | Ga0495633_0000005_71992_72972 | 325 |
| 290 | 3300046616 | Ga0495668_0000426 | Ga0495668_0000426_48269_49252 | 325 |
| 291 | 3300046660 | Ga0495625_0225806 | Ga0495625_0225806_141_1121 | 325 |
| 292 | 3300048929 | Ga0496126_0086075 | Ga0496126_0086075_392_1372 | 325 |
| 293 | 3300049661 | Ga0501217_006846 | Ga0501217_006846_219_1202 | 325 |
| 294 | 3300049670 | Ga0501236_000559 | Ga0501236_000559_1517_2500 | 325 |
| 295 | 3300049671 | Ga0501238_004277 | Ga0501238_004277_11_994 | 325 |
| 296 | 3300049758 | Ga0501241_000388 | Ga0501241_000388_2198_3178 | 325 |
| 297 | 3300049761 | Ga0501264_000417 | Ga0501264_000417_1806_2789 | 325 |
| 298 | 3300053088 | Ga0500644_0000160 | Ga0500644_0000160_24038_25018 | 325 |
| 299 | 3300053090 | Ga0500646_0006766 | Ga0500646_0006766_1553_2533 | 325 |
| 300 | 3300053109 | Ga0500569_025932 | Ga0500569_025932_465_1445 | 325 |
| 301 | 3300053121 | Ga0500607_072447 | Ga0500607_072447_236_1216 | 325 |
| 302 | 3300053131 | Ga0500652_013916 | Ga0500652_013916_1686_2666 | 325 |
| 303 | 3300053139 | Ga0500568_0036418 | Ga0500568_0036418_13_993 | 325 |
| 304 | 3300053148 | Ga0500590_052286 | Ga0500590_052286_262_1242 | 325 |
| 305 | 3300053160 | Ga0500633_0012158 | Ga0500633_0012158_859_1839 | 325 |
| 306 | 3300005617 | Ga0068859_100201256 | Ga0068859_1002012563 | 326 |
| 307 | 3300006931 | Ga0097620_100201258 | Ga0097620_1002012583 | 326 |
| 308 | 3300009094 | Ga0111539_10028371 | Ga0111539_100283719 | 326 |
| 309 | 3300009545 | Ga0105237_10001373 | Ga0105237_1000137330 | 326 |
| 310 | 3300013307 | Ga0157372_10008100 | Ga0157372_100081005 | 326 |
| 311 | 3300025914 | Ga0207671_10003658 | Ga0207671_1000365817 | 326 |
| 312 | 3300026089 | Ga0207648_10112864 | Ga0207648_101128643 | 326 |
| 313 | 3300027907 | Ga0207428_10061753 | Ga0207428_100617533 | 326 |
| 314 | 3300030521 | Ga0307511_10001345 | Ga0307511_1000134514 | 326 |
| 315 | 3300030732 | Ga0316176_1126433 | Ga0316176_112643311 | 326 |
| 316 | 3300030744 | Ga0316181_1286895 | Ga0316181_12868953 | 326 |
| 317 | 3300031251 | Ga0265327_10001592 | Ga0265327_1000159211 | 326 |
| 318 | 3300037418 | Ga0395900_0286655 | Ga0395900_0286655_16_999 | 326 |
| 319 | 3300045051 | Ga0451576_0000022 | Ga0451576_0000022_430068_431051 | 326 |
| 320 | 3300050511 | nmdc:mga08y16_34233_c1 | nmdc:mga08y16_34233_c1_1833_2816 | 326 |
| 321 | 3300053092 | Ga0500583_0001256 | Ga0500583_0001256_1610_2593 | 326 |
| 322 | 3300053147 | Ga0500589_005192 | Ga0500589_005192_143_1126 | 326 |
| 323 | 3300001979 | JGI24740J21852_10007889 | JGI24740J21852_100078892 | 327 |
| 324 | 3300001989 | JGI24739J22299_10022352 | JGI24739J22299_100223522 | 327 |
| 325 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003287 | 327 |
| 326 | 3300003215 | JGI25153J46596_10011686 | JGI25153J46596_100116863 | 327 |
| 327 | 3300003323 | rootH1_10132616 | rootH1_101326164 | 327 |
| 328 | 3300003354 | JGI25160J50197_1007413 | JGI25160J50197_10074133 | 327 |
| 329 | 3300005288 | Ga0065714_10083631 | Ga0065714_100836312 | 327 |
| 330 | 3300005338 | Ga0068868_100004350 | Ga0068868_1000043505 | 327 |
| 331 | 3300005367 | Ga0070667_100002577 | Ga0070667_1000025775 | 327 |
| 332 | 3300005466 | Ga0070685_10026046 | Ga0070685_100260464 | 327 |
| 333 | 3300005834 | Ga0068851_10000104 | Ga0068851_1000010422 | 327 |
| 334 | 3300005841 | Ga0068863_100010261 | Ga0068863_1000102615 | 327 |
| 335 | 3300005843 | Ga0068860_100005329 | Ga0068860_1000053296 | 327 |
| 336 | 3300010375 | Ga0105239_10075129 | Ga0105239_100751292 | 327 |
| 337 | 3300013102 | Ga0157371_10015653 | Ga0157371_100156532 | 327 |
| 338 | 3300013307 | Ga0157372_10037218 | Ga0157372_100372182 | 327 |
| 339 | 3300013307 | Ga0157372_10532625 | Ga0157372_105326252 | 327 |
| 340 | 3300013308 | Ga0157375_10047752 | Ga0157375_100477521 | 327 |
| 341 | 3300014325 | Ga0163163_10738882 | Ga0163163_107388821 | 327 |
| 342 | 3300025246 | Ga0209646_1000004 | Ga0209646_100000453 | 327 |
| 343 | 3300025250 | Ga0209026_1000132 | Ga0209026_10001322 | 327 |
| 344 | 3300025297 | Ga0209758_1019180 | Ga0209758_10191803 | 327 |
| 345 | 3300025302 | Ga0207426_1000316 | Ga0207426_100031672 | 327 |
| 346 | 3300025321 | Ga0207656_10000149 | Ga0207656_1000014922 | 327 |
| 347 | 3300025728 | Ga0207655_1000608 | Ga0207655_100060851 | 327 |
| 348 | 3300025925 | Ga0207650_10106621 | Ga0207650_101066211 | 327 |
| 349 | 3300025940 | Ga0207691_10122833 | Ga0207691_101228331 | 327 |
| 350 | 3300025960 | Ga0207651_10019872 | Ga0207651_100198724 | 327 |
| 351 | 3300025986 | Ga0207658_10002320 | Ga0207658_100023205 | 327 |
| 352 | 3300026088 | Ga0207641_10008035 | Ga0207641_100080354 | 327 |
| 353 | 3300028381 | Ga0268264_10004595 | Ga0268264_100045959 | 327 |
| 354 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011520 | 327 |
| 355 | 3300031911 | Ga0307412_10295832 | Ga0307412_102958322 | 327 |
| 356 | 3300032004 | Ga0307414_10006881 | Ga0307414_100068816 | 327 |
| 357 | 3300046616 | Ga0495668_0001856 | Ga0495668_0001856_3829_4815 | 327 |
| 358 | 3300049822 | Ga0501035_0091523 | Ga0501035_0091523_914_1897 | 327 |
| 359 | 3300053131 | Ga0500652_005048 | Ga0500652_005048_2921_3904 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.9605 | 218 | 318 |
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.9588 | 216 | 319 |
| 3lsg-assembly1.cif.gz_A | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.9409 | 219 | 315 |
| 3oio-assembly1.cif.gz_A | crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum | 0.9322 | 217 | 318 |
| 1u8b-assembly1.cif.gz_A | crystal structure of the methylated n-ada/dna complex | 0.9309 | 217 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32677_219_275_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9697 | 267 | 318 | 1.10.10.60 |
| af_P31449_179_288_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9645 | 217 | 318 | 1.10.10.60 |
| 3w6vA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9605 | 218 | 318 | 1.10.10.60 |
| af_P09377_170_274_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9591 | 217 | 317 | 1.10.10.60 |
| 5suwA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9548 | 262 | 318 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3UER9-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9887 | 218 | 324 |
GO:0003700
GO:0043565 |
| AF-A0A1X7LGY3-F1-model_v4 | AraC family transcriptional regulator, regulatory protein of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase | 0.9833 | 216 | 317 |
GO:0003700
GO:0006281 GO:0008168 GO:0008270 GO:0032259 GO:0043565 |
| AF-A0A2T6D8T8-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.979 | 217 | 318 |
GO:0003700
GO:0043565 |
| AF-A0A5Q4T4C4-F1-model_v4 | AraC family transcriptional regulator | 0.9784 | 216 | 316 |
GO:0003700
GO:0043565 |
| AF-A4X6Y1-F1-model_v4 | Transcriptional regulator, AraC family | 0.9754 | 215 | 316 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar