F421455

General Info

Members Datasets Scaffolds Average Seq Length
359 260 336 253

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100050326|Ga0070698_1000503266
Length 298
Sequence VTEAPKSKDAGFAPNLLQPFSNAQLWANLAIRRIARQLTKVKRNYNIKTMKLIVIGGTGLIGTKVVKDLREKGHEVVAASPSQGINSVTGEGLAEALVGAQVVVDVSNSPSWEDKAVLEFFEKSERNLAAAEAAAGVGHHVALSVVGTDRMLASGYFRAKMAQENLIKASKIPFTIVRATQFFEFVGAIAQFSTEGATVRLPSALMQPIVSDDVAAALADVAIAEPLNDTVEVAGPEPIRMDELVRRFLSAKGDPRKVITDVRALYYGIEVNDQSLVPGDNPRLGPTRFSEWLARSAK

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
3 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
7 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
10 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
11 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
12 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
13 2857472729 Cohnella sp. R-74144 Isolate Unclassified
14 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
17 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
18 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
19 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
20 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
198 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
253 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
254 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
260 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.92
Metatranscriptomes 1.67
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.48
Nodule 1.67
Rhizoplane 2.51
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1009881 3300002987 Bacteria 2481
2 JGI25153J46596_10000019 3300003215 Bacteria 260291
3 rootH2_10002962 3300003320 Bacteria 41064
4 rootL2_10077848 3300003322 Bacteria 1958
5 rootH1_10044024 3300003323 Bacteria 7166
6 JGI25160J50197_1000034 3300003354 Bacteria 169670
7 JGI25160J50197_1000881 3300003354 Bacteria 15796
8 JGI25160J50197_1003911 3300003354 Bacteria 6522
9 JGI25161J50226_1000019 3300003374 Bacteria 169670
10 Ga0055526_1001812 3300003771 Bacteria 14801
11 Ga0055528_1000084 3300003790 Bacteria 74596
12 Ga0055530_10000574 3300003791 Bacteria 31890
13 Ga0055530_10005693 3300003791 Bacteria 5818
14 Ga0055543_1000018 3300004625 Bacteria 169708
15 Ga0055543_1008170 3300004625 Bacteria 2340
16 Ga0058862_11945906 3300004803 Bacteria 1402
17 Ga0065165_1000121 3300005262 Bacteria 134128
18 Ga0065165_1000312 3300005262 Bacteria 79663
19 Ga0065165_1000592 3300005262 Bacteria 53128
20 Ga0065704_10088550 3300005289 Bacteria 2930
21 Ga0065712_10020085 3300005290 Bacteria 2112
22 Ga0065712_10069379 3300005290 Bacteria 7412
23 Ga0065715_10038108 3300005293 Bacteria 1509
24 Ga0065715_10100134 3300005293 Bacteria 3333
25 Ga0065715_10131978 3300005293 Bacteria 1990
26 Ga0070683_100183176 3300005329 Bacteria 1988
27 Ga0070670_100242597 3300005331 Bacteria 1569
28 Ga0070670_100248840 3300005331 Unclassified 1548
29 Ga0068869_100069717 3300005334 Bacteria 2600
30 Ga0068869_100175495 3300005334 Bacteria 1677
31 Ga0070666_10088713 3300005335 Bacteria 2122
32 Ga0070680_100093214 3300005336 Bacteria 2495
33 Ga0070689_100028658 3300005340 Bacteria 4211
34 Ga0070689_100541641 3300005340 Bacteria 1002
35 Ga0070691_10004239 3300005341 Bacteria 6522
36 Ga0070675_100100714 3300005354 Bacteria 2433
37 Ga0070675_100231297 3300005354 Bacteria 1613
38 Ga0070671_100005676 3300005355 Bacteria 9933
39 Ga0070671_100265927 3300005355 Bacteria 1458
40 Ga0070674_100307553 3300005356 Bacteria 1266
41 Ga0070688_100026161 3300005365 Bacteria 3464
42 Ga0070667_100127469 3300005367 Bacteria 2219
43 Ga0070667_100196797 3300005367 Bacteria 1787
44 Ga0070703_10000967 3300005406 Bacteria 9094
45 Ga0070714_100181147 3300005435 Bacteria 1917
46 Ga0070714_100718626 3300005435 Bacteria 965
47 Ga0070713_100137494 3300005436 Bacteria 2160
48 Ga0070710_10092800 3300005437 Bacteria 1784
49 Ga0070701_10074041 3300005438 Bacteria 1828
50 Ga0070705_100000110 3300005440 Bacteria 46763
51 Ga0070700_100005313 3300005441 Bacteria 6807
52 Ga0070694_100000271 3300005444 Bacteria 27422
53 Ga0070694_100074493 3300005444 Bacteria 2346
54 Ga0070708_100232344 3300005445 Bacteria 1730
55 Ga0070708_100442879 3300005445 Bacteria 1225
56 Ga0070708_100483057 3300005445 Bacteria 1169
57 Ga0070663_100005464 3300005455 Bacteria 7550
58 Ga0070678_100484440 3300005456 Bacteria 1089
59 Ga0070662_100308412 3300005457 Bacteria 1288
60 Ga0070681_10013036 3300005458 Bacteria 8255
61 Ga0068867_100000438 3300005459 Bacteria 27700
62 Ga0070685_10092190 3300005466 Bacteria 1836
63 Ga0070706_100042496 3300005467 Bacteria 4200
64 Ga0070706_100156632 3300005467 Bacteria 2126
65 Ga0070706_100227875 3300005467 Bacteria 1739
66 Ga0070706_100572110 3300005467 Bacteria 1051
67 Ga0070707_100232475 3300005468 Bacteria 1794
68 Ga0070707_100257901 3300005468 Bacteria 1696
69 Ga0070707_100469987 3300005468 Bacteria 1219
70 Ga0070698_100021753 3300005471 Bacteria 6716
71 Ga0070698_100050326 3300005471 Bacteria 4249
72 Ga0070698_100138080 3300005471 Bacteria 2391
73 Ga0070698_100207751 3300005471 Bacteria 1893
74 Ga0070698_100292927 3300005471 Bacteria 1558
75 Ga0070699_100000653 3300005518 Bacteria 32414
76 Ga0070699_100003616 3300005518 Bacteria 13665
77 Ga0070679_100047557 3300005530 Bacteria 4275
78 Ga0070679_100081858 3300005530 Bacteria 3218
79 Ga0068853_100014210 3300005539 Bacteria 6515
80 Ga0068853_100790929 3300005539 Bacteria 908
81 Ga0070695_100001347 3300005545 Bacteria 13614
82 Ga0070695_100044867 3300005545 Bacteria 2816
83 Ga0070695_100350583 3300005545 Bacteria 1106
84 Ga0070696_100000720 3300005546 Bacteria 21146
85 Ga0070693_100086047 3300005547 Bacteria 1885
86 Ga0070693_100274610 3300005547 Bacteria 1126
87 Ga0070665_100088770 3300005548 Bacteria 3097
88 Ga0070704_100002027 3300005549 Bacteria 11229
89 Ga0070704_100111687 3300005549 Bacteria 2081
90 Ga0070704_100774530 3300005549 Bacteria 856
91 Ga0068855_100016284 3300005563 Bacteria 8941
92 Ga0068855_100081083 3300005563 Bacteria 3762
93 Ga0068855_100893823 3300005563 Bacteria 939
94 Ga0068857_100003069 3300005577 Bacteria 13811
95 Ga0068857_100006048 3300005577 Bacteria 10337
96 Ga0068852_100769224 3300005616 Bacteria 976
97 Ga0068859_100004051 3300005617 Bacteria 14940
98 Ga0068864_100016826 3300005618 Bacteria 6093
99 Ga0068864_100145990 3300005618 Bacteria 2138
100 Ga0068866_10131729 3300005718 Bacteria 1423
101 Ga0068861_100065458 3300005719 Bacteria 2800
102 Ga0068870_10333935 3300005840 Bacteria 967
103 Ga0068863_100324079 3300005841 Bacteria 1497
104 Ga0068858_100014030 3300005842 Bacteria 7559
105 Ga0068862_100003144 3300005844 Bacteria 14355
106 Ga0068862_100026593 3300005844 Bacteria 4864
107 Ga0081455_10031838 3300005937 Bacteria 4763
108 Ga0081538_10037725 3300005981 Bacteria 3128
109 Ga0081538_10137230 3300005981 Bacteria 1136
110 Ga0081540_1073873 3300005983 Bacteria 1565
111 Ga0081539_10034457 3300005985 Bacteria 3061
112 Ga0070717_10130551 3300006028 Bacteria 2160
113 Ga0075365_10008306 3300006038 Bacteria 5884
114 Ga0075363_100041085 3300006048 Bacteria 2439
115 Ga0075364_10001085 3300006051 Bacteria 14508
116 Ga0075364_10001859 3300006051 Bacteria 11714
117 Ga0070715_10012508 3300006163 Bacteria 3092
118 Ga0075362_10001708 3300006177 Bacteria 7119
119 Ga0075362_10004655 3300006177 Bacteria 4947
120 Ga0075369_10090088 3300006186 Bacteria 1368
121 Ga0075428_100195781 3300006844 Bacteria 2186
122 Ga0075433_10168481 3300006852 Bacteria 1949
123 Ga0097620_100004051 3300006931 Bacteria 14940
124 Ga0075435_100171127 3300007076 Bacteria 1832
125 Ga0105240_10003087 3300009093 Bacteria 26186
126 Ga0105240_10017466 3300009093 Bacteria 9667
127 Ga0111539_10001024 3300009094 Bacteria 36666
128 Ga0114129_10001385 3300009147 Bacteria 32641
129 Ga0105243_10002772 3300009148 Bacteria 14575
130 Ga0105243_10296308 3300009148 Bacteria 1464
131 Ga0105242_10092831 3300009176 Bacteria 2543
132 Ga0105248_10666954 3300009177 Bacteria 1173
133 Ga0105248_10689029 3300009177 Bacteria 1153
134 Ga0105237_10772054 3300009545 Bacteria 968
135 Ga0105238_10098170 3300009551 Bacteria 2913
136 Ga0105238_10810457 3300009551 Bacteria 952
137 Ga0105249_10017500 3300009553 Bacteria 6364
138 Ga0105249_10082938 3300009553 Bacteria 2983
139 Ga0105249_10650586 3300009553 Bacteria 1112
140 Ga0105239_10636122 3300010375 Bacteria 1218
141 Ga0157370_10000195 3300013104 Bacteria 76072
142 Ga0157369_10265403 3300013105 Bacteria 1790
143 Ga0157369_10347297 3300013105 Bacteria 1541
144 Ga0157378_10027265 3300013297 Bacteria 5042
145 Ga0163162_10058184 3300013306 Bacteria 3894
146 Ga0157372_10004135 3300013307 Bacteria 15539
147 Ga0157372_10012078 3300013307 Bacteria 9200
148 Ga0157372_10123962 3300013307 Bacteria 2970
149 Ga0157372_10480539 3300013307 Bacteria 1448
150 Ga0182008_10021694 3300014497 Bacteria 3297
151 Ga0157377_10000061 3300014745 Bacteria 82275
152 Ga0157379_10048312 3300014968 Bacteria 3798
153 Ga0157376_10266139 3300014969 Bacteria 1608
154 Ga0197907_11468597 3300020069 Bacteria 2883
155 Ga0206356_10511008 3300020070 Bacteria 2523
156 Ga0206351_10906902 3300020077 Bacteria 3071
157 Ga0206354_10904066 3300020081 Bacteria 2561
158 Ga0213872_10046560 3300021361 Bacteria 1974
159 Ga0224712_10012223 3300022467 Bacteria 2693
160 Ga0209436_112359 3300025208 Bacteria 1453
161 Ga0209673_1001095 3300025273 Bacteria 30448
162 Ga0209130_1000077 3300025284 Bacteria 169722
163 Ga0207673_1002620 3300025290 Bacteria 2063
164 Ga0209564_1001323 3300025295 Bacteria 26522
165 Ga0209758_1000028 3300025297 Bacteria 530102
166 Ga0209050_1000192 3300025298 Bacteria 138262
167 Ga0209050_1000358 3300025298 Bacteria 87785
168 Ga0209050_1000630 3300025298 Bacteria 54802
169 Ga0207426_1000054 3300025302 Bacteria 384435
170 Ga0207426_1001502 3300025302 Bacteria 19089
171 Ga0209051_1045695 3300025303 Bacteria 1513
172 Ga0209257_1003292 3300025304 Bacteria 14079
173 Ga0207697_10043743 3300025315 Bacteria 1841
174 Ga0207653_10001311 3300025885 Bacteria 8083
175 Ga0207680_10054271 3300025903 Bacteria 2410
176 Ga0207647_10014133 3300025904 Bacteria 5513
177 Ga0207643_10188914 3300025908 Bacteria 1250
178 Ga0207684_10086285 3300025910 Bacteria 2673
179 Ga0207684_10188329 3300025910 Bacteria 1779
180 Ga0207684_10556526 3300025910 Bacteria 981
181 Ga0207707_10009885 3300025912 Bacteria 8271
182 Ga0207707_10033510 3300025912 Bacteria 4495
183 Ga0207707_10061643 3300025912 Bacteria 3264
184 Ga0207695_10007579 3300025913 Bacteria 13761
185 Ga0207671_10523890 3300025914 Unclassified 945
186 Ga0207693_10060194 3300025915 Bacteria 2975
187 Ga0207693_10152971 3300025915 Bacteria 1815
188 Ga0207660_10101567 3300025917 Bacteria 2149
189 Ga0207662_10138957 3300025918 Bacteria 1537
190 Ga0207652_10070798 3300025921 Bacteria 3029
191 Ga0207652_10177308 3300025921 Bacteria 1914
192 Ga0207652_10270771 3300025921 Bacteria 1532
193 Ga0207646_10042802 3300025922 Bacteria 4068
194 Ga0207646_10113657 3300025922 Bacteria 2431
195 Ga0207646_10122108 3300025922 Bacteria 2340
196 Ga0207646_10410626 3300025922 Bacteria 1223
197 Ga0207659_10025481 3300025926 Bacteria 3975
198 Ga0207687_10189818 3300025927 Bacteria 1598
199 Ga0207700_10272670 3300025928 Bacteria 1453
200 Ga0207700_10746299 3300025928 Bacteria 875
201 Ga0207664_10177609 3300025929 Bacteria 1826
202 Ga0207644_10155849 3300025931 Bacteria 1771
203 Ga0207709_10001164 3300025935 Bacteria 19115
204 Ga0207670_10071159 3300025936 Bacteria 2404
205 Ga0207665_10363799 3300025939 Bacteria 1094
206 Ga0207711_10076835 3300025941 Bacteria 2909
207 Ga0207661_10360450 3300025944 Bacteria 1313
208 Ga0207667_10152217 3300025949 Bacteria 2380
209 Ga0207667_10434765 3300025949 Bacteria 1334
210 Ga0207667_10521193 3300025949 Bacteria 1204
211 Ga0207651_10090989 3300025960 Bacteria 2232
212 Ga0207712_10152638 3300025961 Bacteria 1786
213 Ga0207668_10447216 3300025972 Bacteria 1102
214 Ga0207668_10534333 3300025972 Bacteria 1014
215 Ga0207640_10425518 3300025981 Bacteria 1088
216 Ga0207658_10082040 3300025986 Bacteria 2475
217 Ga0207678_10009366 3300026067 Bacteria 8620
218 Ga0207708_10010622 3300026075 Bacteria 6838
219 Ga0207641_10254598 3300026088 Bacteria 1641
220 Ga0207648_10001306 3300026089 Bacteria 27754
221 Ga0207676_10007890 3300026095 Bacteria 7573
222 Ga0207674_10002699 3300026116 Bacteria 22159
223 Ga0207674_10006430 3300026116 Bacteria 13815
224 Ga0207674_10375109 3300026116 Bacteria 1375
225 Ga0207675_100086866 3300026118 Bacteria 2937
226 Ga0207683_10041453 3300026121 Bacteria 4020
227 Ga0207428_10031756 3300027907 Bacteria 4352
228 Ga0207428_10116130 3300027907 Bacteria 2055
229 Ga0268266_10005228 3300028379 Bacteria 12201
230 Ga0268266_10051892 3300028379 Bacteria 3521
231 Ga0268265_10000395 3300028380 Bacteria 46647
232 Ga0268265_10012463 3300028380 Bacteria 5761
233 Ga0307410_10525124 3300031852 Bacteria 977
234 Ga0307406_10003760 3300031901 Bacteria 8252
235 Ga0307412_10011300 3300031911 Bacteria 5166
236 Ga0307412_10475420 3300031911 Unclassified 1035
237 Ga0307414_10118816 3300032004 Bacteria 2028
238 Ga0307411_10022862 3300032005 Bacteria 3691
239 Ga0307411_10154069 3300032005 Unclassified 1712
240 Ga0307411_10280144 3300032005 Bacteria 1327
241 Ga0307411_10485793 3300032005 Bacteria 1041
242 Ga0307415_100501677 3300032126 Bacteria 1061
243 Ga0307507_10209314 3300033179 Bacteria 1333
244 Ga0373955_0248578 3300035172 Bacteria 1066
245 Ga0373962_0054080 3300035242 Bacteria 1163
246 Ga0373937_0012856 3300036401 Bacteria 7372
247 Ga0373937_0209409 3300036401 Bacteria 1834
248 Ga0395899_0002227 3300037312 Bacteria 15895
249 Ga0395899_0002298 3300037312 Bacteria 15592
250 Ga0395900_0042819 3300037418 Bacteria 4664
251 Ga0395898_0020493 3300037466 Bacteria 6715
252 Ga0395898_0098144 3300037466 Bacteria 2813
253 Ga0395898_0184017 3300037466 Bacteria 1996
254 Ga0395905_0010646 3300037471 Bacteria 8922
255 Ga0395905_0093469 3300037471 Bacteria 2820
256 Ga0395905_0376257 3300037471 Bacteria 1314
257 Ga0395905_0538332 3300037471 Bacteria 1069
258 Ga0395901_0005992 3300038443 Bacteria 12310
259 Ga0436361_0293156 3300039447 Bacteria 2255
260 Ga0436361_1064329 3300039447 Bacteria 4682
261 Ga0451833_0951109 3300041491 Bacteria 6092
262 Ga0451837_0041791 3300041494 Bacteria 3914
263 Ga0451839_0130424 3300041496 Bacteria 4918
264 Ga0451841_0288371 3300041498 Bacteria 4189
265 Ga0451845_0049690 3300041501 Bacteria 2329
266 Ga0451847_0104981 3300041503 Bacteria 2179
267 Ga0451849_0792881 3300041505 Bacteria 5115
268 Ga0451851_0786675 3300041507 Bacteria 2063
269 Ga0451843_0321215 3300041509 Bacteria 3016
270 Ga0451855_0377549 3300041511 Bacteria 2459
271 Ga0451853_1412436 3300041512 Bacteria 1983
272 Ga0451576_0182199 3300045051 Bacteria 2193
273 Ga0495596_0004974 3300046500 Bacteria 6370
274 Ga0495606_0198866 3300046507 Bacteria 1144
275 Ga0495608_0181500 3300046511 Bacteria 1331
276 Ga0495618_0365675 3300046514 Bacteria 887
277 Ga0495667_0270563 3300046559 Bacteria 1080
278 Ga0495634_0197007 3300046642 Bacteria 1253
279 Ga0495611_0045390 3300046648 Bacteria 1968
280 Ga0495613_0002812 3300046689 Bacteria 13063
281 Ga0495670_0239411 3300046691 Bacteria 966
282 Ga0495660_0128326 3300046810 Bacteria 1275
283 Ga0495672_0109985 3300047320 Bacteria 1480
284 Ga0495684_0061058 3300047471 Bacteria 2868
285 Ga0496102_0004952 3300048905 Bacteria 11280
286 Ga0496103_0014259 3300048906 Bacteria 4719
287 Ga0496104_0174385 3300048907 Bacteria 2061
288 Ga0496106_0003499 3300048909 Bacteria 11699
289 Ga0496106_0050711 3300048909 Bacteria 3128
290 Ga0496109_0326744 3300048912 Bacteria 1448
291 Ga0496114_0130438 3300048917 Bacteria 2170
292 Ga0496118_0000829 3300048921 Bacteria 49162
293 Ga0496119_0116333 3300048922 Bacteria 1476
294 Ga0496123_0025875 3300048926 Bacteria 4411
295 Ga0496124_0173689 3300048927 Bacteria 1666
296 Ga0496125_0113550 3300048928 Bacteria 1954
297 Ga0501034_0003818 3300049571 Bacteria 16984
298 Ga0501034_0005231 3300049571 Bacteria 14237
299 Ga0501043_0065076 3300049579 Bacteria 2863
300 Ga0501047_0027437 3300049581 Bacteria 5486
301 Ga0501068_0066436 3300049584 Bacteria 2196
302 Ga0501069_0113154 3300049585 Bacteria 1547
303 Ga0501073_0169981 3300049589 Bacteria 1509
304 Ga0501073_0210130 3300049589 Bacteria 1345
305 Ga0501075_0113911 3300049591 Bacteria 2056
306 Ga0501080_0553102 3300049742 Bacteria 1025
307 Ga0501081_0060768 3300049743 Bacteria 2619
308 Ga0501035_0085912 3300049822 Bacteria 2772
309 Ga0501035_0502045 3300049822 Bacteria 998
310 Ga0501044_0239827 3300049823 Bacteria 1757
311 nmdc:mga03683_57974_c1 3300050489 Bacteria 1631
312 nmdc:mga03683_8740_c1 3300050489 Bacteria 3573
313 nmdc:mga03683_90596_c1 3300050489 Bacteria 1333
314 nmdc:mga03n38_60958_c1 3300050490 Bacteria 990
315 nmdc:mga00v17_1539_c1 3300050491 Bacteria 12034
316 nmdc:mga00v17_21615_c1 3300050491 Bacteria 3701
317 nmdc:mga00v17_890_c2 3300050491 Bacteria 14070
318 nmdc:mga0yw44_31549_c1 3300050492 Bacteria 3083
319 nmdc:mga05p37_104_c1 3300050507 Bacteria 76602
320 nmdc:mga0qj67_197132_c1 3300050509 Bacteria 1636
321 nmdc:mga08y16_13344_c1 3300050511 Bacteria 8643
322 nmdc:mga08y16_19417_c1 3300050511 Bacteria 7165
323 nmdc:mga0a205_420756_c1 3300050515 Bacteria 1198
324 nmdc:mga0a205_84151_c1 3300050515 Bacteria 3072
325 Ga0500610_0115326 3300053079 Bacteria 1377
326 Ga0495619_0542907 3300053085 Bacteria 798
327 Ga0500644_0001240 3300053088 Bacteria 7039
328 Ga0500641_0071469 3300053096 Bacteria 1461
329 Ga0500556_0010957 3300053104 Bacteria 2674
330 Ga0500561_0002142 3300053137 Bacteria 3296
331 Ga0500589_040423 3300053147 Bacteria 2177
332 Ga0500633_0001031 3300053160 Bacteria 4956
333 Ga0500634_0080157 3300053161 Bacteria 1685
334 Ga0500636_0055068 3300053177 Bacteria 2331
335 Ga0500609_002110 3300053731 Bacteria 2849
336 Ga0530510_0062306 3300061734 Bacteria 2700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10138957 Ga0207662_101389573 223
2 3300003320 rootH2_10002962 rootH2_100029627 238
3 3300005293 Ga0065715_10131978 Ga0065715_101319782 240
4 3300005331 Ga0070670_100242597 Ga0070670_1002425972 240
5 3300005356 Ga0070674_100307553 Ga0070674_1003075532 240
6 3300050489 nmdc:mga03683_57974_c1 nmdc:mga03683_57974_c1_21_746 240
7 iso_pu_bacteria 2643221722 2644670468 242
8 iso_pu_bacteria 3002998708 3003007972 245
9 3300013105 Ga0157369_10347297 Ga0157369_103472972 246
10 3300013307 Ga0157372_10012078 Ga0157372_100120785 246
11 3300025904 Ga0207647_10014133 Ga0207647_100141334 246
12 3300025961 Ga0207712_10152638 Ga0207712_101526382 246
13 3300025972 Ga0207668_10447216 Ga0207668_104472162 246
14 3300031911 Ga0307412_10475420 Ga0307412_104754201 246
15 3300032126 Ga0307415_100501677 Ga0307415_1005016772 246
16 3300048917 Ga0496114_0130438 Ga0496114_0130438_1415_2155 246
17 iso_pu_bacteria 2513237146 2513923875 246
18 iso_pu_bacteria 2585428059 2587742058 246
19 iso_pu_bacteria 2599185170 2599415914 246
20 iso_pu_bacteria 2643221572 2643877705 246
21 iso_pu_bacteria 2643221669 2644384760 246
22 iso_pu_bacteria 2643221676 2644421146 246
23 iso_pu_bacteria 2738543023 2739303650 246
24 iso_pu_bacteria 2765235802 2765466884 246
25 iso_pu_bacteria 2765235802 2765467169 246
26 iso_pu_bacteria 2808606379 2808939816 246
27 iso_pu_bacteria 2818991438 2819555390 246
28 iso_pu_bacteria 2838035591 2838036032 246
29 iso_pu_bacteria 2857472729 2857474791 246
30 iso_pu_bacteria 2894652903 2894657218 246
31 iso_pu_bacteria 2896109856 2896111643 246
32 iso_pu_bacteria 2919119836 2919124511 246
33 iso_pu_bacteria 2928521798 2928525170 246
34 iso_pu_bacteria 2945945610 2945948052 246
35 iso_pu_bacteria 2958092219 2958099929 246
36 iso_pu_bacteria 8005563573 8005567528 246
37 iso_pu_bacteria 8018163183 8018166420 246
38 3300005293 Ga0065715_10038108 Ga0065715_100381082 247
39 3300005334 Ga0068869_100175495 Ga0068869_1001754953 247
40 3300005340 Ga0070689_100541641 Ga0070689_1005416411 247
41 3300003322 rootL2_10077848 rootL2_100778482 248
42 3300003323 rootH1_10044024 rootH1_100440243 248
43 3300005290 Ga0065712_10069379 Ga0065712_100693797 248
44 3300005435 Ga0070714_100718626 Ga0070714_1007186261 248
45 3300005436 Ga0070713_100137494 Ga0070713_1001374944 248
46 3300005437 Ga0070710_10092800 Ga0070710_100928002 248
47 3300005445 Ga0070708_100232344 Ga0070708_1002323441 248
48 3300005445 Ga0070708_100483057 Ga0070708_1004830571 248
49 3300005467 Ga0070706_100572110 Ga0070706_1005721101 248
50 3300005468 Ga0070707_100232475 Ga0070707_1002324752 248
51 3300005471 Ga0070698_100292927 Ga0070698_1002929271 248
52 3300009553 Ga0105249_10082938 Ga0105249_100829385 248
53 3300025922 Ga0207646_10113657 Ga0207646_101136573 248
54 3300046514 Ga0495618_0365675 Ga0495618_0365675_17_763 248
55 3300049589 Ga0501073_0210130 Ga0501073_0210130_472_1230 248
56 3300049742 Ga0501080_0553102 Ga0501080_0553102_218_976 248
57 3300053104 Ga0500556_0010957 Ga0500556_0010957_45_803 248
58 3300003215 JGI25153J46596_10000019 JGI25153J46596_1000001935 249
59 3300005331 Ga0070670_100248840 Ga0070670_1002488401 249
60 3300005367 Ga0070667_100196797 Ga0070667_1001967972 249
61 3300005445 Ga0070708_100442879 Ga0070708_1004428792 249
62 3300005471 Ga0070698_100050326 Ga0070698_1000503266 249
63 3300005547 Ga0070693_100274610 Ga0070693_1002746101 249
64 3300005549 Ga0070704_100774530 Ga0070704_1007745301 249
65 3300005937 Ga0081455_10031838 Ga0081455_100318382 249
66 3300005981 Ga0081538_10037725 Ga0081538_100377252 249
67 3300005983 Ga0081540_1073873 Ga0081540_10738733 249
68 3300006051 Ga0075364_10001859 Ga0075364_1000185910 249
69 3300009545 Ga0105237_10772054 Ga0105237_107720541 249
70 3300025297 Ga0209758_1000028 Ga0209758_1000028236 249
71 3300025914 Ga0207671_10523890 Ga0207671_105238901 249
72 3300025915 Ga0207693_10152971 Ga0207693_101529712 249
73 3300025922 Ga0207646_10122108 Ga0207646_101221083 249
74 3300025928 Ga0207700_10272670 Ga0207700_102726702 249
75 3300025928 Ga0207700_10746299 Ga0207700_107462991 249
76 3300025949 Ga0207667_10521193 Ga0207667_105211932 249
77 3300026116 Ga0207674_10375109 Ga0207674_103751091 249
78 3300032005 Ga0307411_10154069 Ga0307411_101540691 249
79 3300032005 Ga0307411_10485793 Ga0307411_104857932 249
80 3300036401 Ga0373937_0012856 Ga0373937_0012856_1026_1793 249
81 3300037471 Ga0395905_0376257 Ga0395905_0376257_94_861 249
82 3300046511 Ga0495608_0181500 Ga0495608_0181500_64_831 249
83 3300046559 Ga0495667_0270563 Ga0495667_0270563_61_828 249
84 3300046642 Ga0495634_0197007 Ga0495634_0197007_367_1134 249
85 3300046648 Ga0495611_0045390 Ga0495611_0045390_228_983 249
86 3300046689 Ga0495613_0002812 Ga0495613_0002812_835_1602 249
87 3300046691 Ga0495670_0239411 Ga0495670_0239411_84_839 249
88 3300047320 Ga0495672_0109985 Ga0495672_0109985_223_978 249
89 3300047471 Ga0495684_0061058 Ga0495684_0061058_384_1151 249
90 3300048926 Ga0496123_0025875 Ga0496123_0025875_2467_3219 249
91 3300048927 Ga0496124_0173689 Ga0496124_0173689_396_1148 249
92 3300049581 Ga0501047_0027437 Ga0501047_0027437_3382_4140 249
93 3300049589 Ga0501073_0169981 Ga0501073_0169981_150_917 249
94 3300050491 nmdc:mga00v17_890_c2 nmdc:mga00v17_890_c2_4777_5535 249
95 3300053088 Ga0500644_0001240 Ga0500644_0001240_3294_4046 249
96 3300053096 Ga0500641_0071469 Ga0500641_0071469_40_789 249
97 3300053137 Ga0500561_0002142 Ga0500561_0002142_520_1272 249
98 3300053147 Ga0500589_040423 Ga0500589_040423_648_1409 249
99 3300053160 Ga0500633_0001031 Ga0500633_0001031_3153_3905 249
100 3300053161 Ga0500634_0080157 Ga0500634_0080157_435_1187 249
101 3300053177 Ga0500636_0055068 Ga0500636_0055068_857_1609 249
102 3300053731 Ga0500609_002110 Ga0500609_002110_1702_2454 249
103 3300002987 JGI25159J45721_1009881 JGI25159J45721_10098812 250
104 3300003354 JGI25160J50197_1000034 JGI25160J50197_1000034133 250
105 3300003354 JGI25160J50197_1000881 JGI25160J50197_10008812 250
106 3300003354 JGI25160J50197_1003911 JGI25160J50197_10039112 250
107 3300003374 JGI25161J50226_1000019 JGI25161J50226_100001944 250
108 3300003771 Ga0055526_1001812 Ga0055526_10018129 250
109 3300003790 Ga0055528_1000084 Ga0055528_100008425 250
110 3300003791 Ga0055530_10000574 Ga0055530_100005748 250
111 3300003791 Ga0055530_10005693 Ga0055530_100056934 250
112 3300004625 Ga0055543_1000018 Ga0055543_1000018133 250
113 3300004625 Ga0055543_1008170 Ga0055543_10081701 250
114 3300004803 Ga0058862_11945906 Ga0058862_119459062 250
115 3300005262 Ga0065165_1000121 Ga0065165_1000121133 250
116 3300005262 Ga0065165_1000312 Ga0065165_100031213 250
117 3300005262 Ga0065165_1000592 Ga0065165_100059215 250
118 3300005289 Ga0065704_10088550 Ga0065704_100885502 250
119 3300005290 Ga0065712_10020085 Ga0065712_100200853 250
120 3300005293 Ga0065715_10100134 Ga0065715_101001342 250
121 3300005329 Ga0070683_100183176 Ga0070683_1001831761 250
122 3300005334 Ga0068869_100069717 Ga0068869_1000697171 250
123 3300005335 Ga0070666_10088713 Ga0070666_100887133 250
124 3300005336 Ga0070680_100093214 Ga0070680_1000932143 250
125 3300005340 Ga0070689_100028658 Ga0070689_1000286584 250
126 3300005341 Ga0070691_10004239 Ga0070691_100042393 250
127 3300005354 Ga0070675_100100714 Ga0070675_1001007142 250
128 3300005354 Ga0070675_100231297 Ga0070675_1002312972 250
129 3300005355 Ga0070671_100005676 Ga0070671_1000056768 250
130 3300005355 Ga0070671_100265927 Ga0070671_1002659272 250
131 3300005365 Ga0070688_100026161 Ga0070688_1000261614 250
132 3300005367 Ga0070667_100127469 Ga0070667_1001274693 250
133 3300005406 Ga0070703_10000967 Ga0070703_100009678 250
134 3300005435 Ga0070714_100181147 Ga0070714_1001811472 250
135 3300005438 Ga0070701_10074041 Ga0070701_100740412 250
136 3300005440 Ga0070705_100000110 Ga0070705_10000011010 250
137 3300005441 Ga0070700_100005313 Ga0070700_1000053134 250
138 3300005444 Ga0070694_100000271 Ga0070694_10000027118 250
139 3300005444 Ga0070694_100074493 Ga0070694_1000744932 250
140 3300005455 Ga0070663_100005464 Ga0070663_1000054645 250
141 3300005456 Ga0070678_100484440 Ga0070678_1004844402 250
142 3300005457 Ga0070662_100308412 Ga0070662_1003084122 250
143 3300005458 Ga0070681_10013036 Ga0070681_100130365 250
144 3300005459 Ga0068867_100000438 Ga0068867_10000043820 250
145 3300005466 Ga0070685_10092190 Ga0070685_100921902 250
146 3300005467 Ga0070706_100042496 Ga0070706_1000424965 250
147 3300005467 Ga0070706_100156632 Ga0070706_1001566322 250
148 3300005467 Ga0070706_100227875 Ga0070706_1002278752 250
149 3300005468 Ga0070707_100257901 Ga0070707_1002579012 250
150 3300005468 Ga0070707_100469987 Ga0070707_1004699871 250
151 3300005471 Ga0070698_100021753 Ga0070698_1000217534 250
152 3300005471 Ga0070698_100138080 Ga0070698_1001380803 250
153 3300005471 Ga0070698_100207751 Ga0070698_1002077513 250
154 3300005518 Ga0070699_100000653 Ga0070699_10000065311 250
155 3300005518 Ga0070699_100003616 Ga0070699_1000036162 250
156 3300005530 Ga0070679_100047557 Ga0070679_1000475572 250
157 3300005530 Ga0070679_100081858 Ga0070679_1000818582 250
158 3300005539 Ga0068853_100014210 Ga0068853_1000142103 250
159 3300005539 Ga0068853_100790929 Ga0068853_1007909291 250
160 3300005545 Ga0070695_100001347 Ga0070695_1000013477 250
161 3300005545 Ga0070695_100044867 Ga0070695_1000448673 250
162 3300005545 Ga0070695_100350583 Ga0070695_1003505831 250
163 3300005546 Ga0070696_100000720 Ga0070696_10000072011 250
164 3300005547 Ga0070693_100086047 Ga0070693_1000860472 250
165 3300005548 Ga0070665_100088770 Ga0070665_1000887704 250
166 3300005549 Ga0070704_100002027 Ga0070704_1000020277 250
167 3300005549 Ga0070704_100111687 Ga0070704_1001116872 250
168 3300005563 Ga0068855_100016284 Ga0068855_1000162846 250
169 3300005563 Ga0068855_100081083 Ga0068855_1000810835 250
170 3300005563 Ga0068855_100893823 Ga0068855_1008938231 250
171 3300005577 Ga0068857_100003069 Ga0068857_10000306911 250
172 3300005577 Ga0068857_100006048 Ga0068857_1000060485 250
173 3300005616 Ga0068852_100769224 Ga0068852_1007692241 250
174 3300005617 Ga0068859_100004051 Ga0068859_1000040518 250
175 3300005618 Ga0068864_100016826 Ga0068864_1000168262 250
176 3300005618 Ga0068864_100145990 Ga0068864_1001459902 250
177 3300005718 Ga0068866_10131729 Ga0068866_101317292 250
178 3300005719 Ga0068861_100065458 Ga0068861_1000654583 250
179 3300005840 Ga0068870_10333935 Ga0068870_103339352 250
180 3300005841 Ga0068863_100324079 Ga0068863_1003240792 250
181 3300005842 Ga0068858_100014030 Ga0068858_1000140306 250
182 3300005844 Ga0068862_100003144 Ga0068862_1000031445 250
183 3300005844 Ga0068862_100026593 Ga0068862_1000265932 250
184 3300005981 Ga0081538_10137230 Ga0081538_101372302 250
185 3300005985 Ga0081539_10034457 Ga0081539_100344572 250
186 3300006028 Ga0070717_10130551 Ga0070717_101305513 250
187 3300006038 Ga0075365_10008306 Ga0075365_100083063 250
188 3300006048 Ga0075363_100041085 Ga0075363_1000410853 250
189 3300006051 Ga0075364_10001085 Ga0075364_100010855 250
190 3300006163 Ga0070715_10012508 Ga0070715_100125084 250
191 3300006177 Ga0075362_10001708 Ga0075362_100017085 250
192 3300006177 Ga0075362_10004655 Ga0075362_100046552 250
193 3300006186 Ga0075369_10090088 Ga0075369_100900882 250
194 3300006844 Ga0075428_100195781 Ga0075428_1001957812 250
195 3300006852 Ga0075433_10168481 Ga0075433_101684812 250
196 3300006931 Ga0097620_100004051 Ga0097620_1000040518 250
197 3300007076 Ga0075435_100171127 Ga0075435_1001711272 250
198 3300009093 Ga0105240_10003087 Ga0105240_1000308718 250
199 3300009093 Ga0105240_10017466 Ga0105240_100174668 250
200 3300009094 Ga0111539_10001024 Ga0111539_1000102416 250
201 3300009147 Ga0114129_10001385 Ga0114129_100013855 250
202 3300009148 Ga0105243_10002772 Ga0105243_100027728 250
203 3300009148 Ga0105243_10296308 Ga0105243_102963082 250
204 3300009176 Ga0105242_10092831 Ga0105242_100928312 250
205 3300009177 Ga0105248_10666954 Ga0105248_106669543 250
206 3300009177 Ga0105248_10689029 Ga0105248_106890291 250
207 3300009551 Ga0105238_10098170 Ga0105238_100981702 250
208 3300009551 Ga0105238_10810457 Ga0105238_108104572 250
209 3300009553 Ga0105249_10017500 Ga0105249_100175005 250
210 3300009553 Ga0105249_10650586 Ga0105249_106505861 250
211 3300010375 Ga0105239_10636122 Ga0105239_106361221 250
212 3300013104 Ga0157370_10000195 Ga0157370_100001954 250
213 3300013105 Ga0157369_10265403 Ga0157369_102654031 250
214 3300013297 Ga0157378_10027265 Ga0157378_100272653 250
215 3300013306 Ga0163162_10058184 Ga0163162_100581845 250
216 3300013307 Ga0157372_10004135 Ga0157372_1000413514 250
217 3300013307 Ga0157372_10123962 Ga0157372_101239624 250
218 3300013307 Ga0157372_10480539 Ga0157372_104805392 250
219 3300014497 Ga0182008_10021694 Ga0182008_100216942 250
220 3300014745 Ga0157377_10000061 Ga0157377_1000006163 250
221 3300014968 Ga0157379_10048312 Ga0157379_100483124 250
222 3300014969 Ga0157376_10266139 Ga0157376_102661392 250
223 3300020069 Ga0197907_11468597 Ga0197907_114685971 250
224 3300020070 Ga0206356_10511008 Ga0206356_105110081 250
225 3300020077 Ga0206351_10906902 Ga0206351_109069021 250
226 3300020081 Ga0206354_10904066 Ga0206354_109040662 250
227 3300021361 Ga0213872_10046560 Ga0213872_100465603 250
228 3300022467 Ga0224712_10012223 Ga0224712_100122232 250
229 3300025208 Ga0209436_112359 Ga0209436_1123593 250
230 3300025273 Ga0209673_1001095 Ga0209673_100109526 250
231 3300025284 Ga0209130_1000077 Ga0209130_1000077128 250
232 3300025290 Ga0207673_1002620 Ga0207673_10026203 250
233 3300025295 Ga0209564_1001323 Ga0209564_10013231 250
234 3300025298 Ga0209050_1000192 Ga0209050_1000192122 250
235 3300025298 Ga0209050_1000358 Ga0209050_100035861 250
236 3300025298 Ga0209050_1000630 Ga0209050_100063020 250
237 3300025302 Ga0207426_1000054 Ga0207426_1000054128 250
238 3300025302 Ga0207426_1001502 Ga0207426_100150211 250
239 3300025303 Ga0209051_1045695 Ga0209051_10456952 250
240 3300025304 Ga0209257_1003292 Ga0209257_10032926 250
241 3300025315 Ga0207697_10043743 Ga0207697_100437432 250
242 3300025885 Ga0207653_10001311 Ga0207653_100013117 250
243 3300025903 Ga0207680_10054271 Ga0207680_100542713 250
244 3300025908 Ga0207643_10188914 Ga0207643_101889141 250
245 3300025910 Ga0207684_10086285 Ga0207684_100862853 250
246 3300025910 Ga0207684_10188329 Ga0207684_101883292 250
247 3300025910 Ga0207684_10556526 Ga0207684_105565261 250
248 3300025912 Ga0207707_10009885 Ga0207707_100098855 250
249 3300025912 Ga0207707_10033510 Ga0207707_100335105 250
250 3300025912 Ga0207707_10061643 Ga0207707_100616433 250
251 3300025913 Ga0207695_10007579 Ga0207695_100075796 250
252 3300025915 Ga0207693_10060194 Ga0207693_100601944 250
253 3300025917 Ga0207660_10101567 Ga0207660_101015673 250
254 3300025921 Ga0207652_10070798 Ga0207652_100707984 250
255 3300025921 Ga0207652_10177308 Ga0207652_101773081 250
256 3300025921 Ga0207652_10270771 Ga0207652_102707713 250
257 3300025922 Ga0207646_10042802 Ga0207646_100428024 250
258 3300025922 Ga0207646_10410626 Ga0207646_104106262 250
259 3300025926 Ga0207659_10025481 Ga0207659_100254816 250
260 3300025927 Ga0207687_10189818 Ga0207687_101898182 250
261 3300025929 Ga0207664_10177609 Ga0207664_101776093 250
262 3300025931 Ga0207644_10155849 Ga0207644_101558492 250
263 3300025935 Ga0207709_10001164 Ga0207709_1000116419 250
264 3300025936 Ga0207670_10071159 Ga0207670_100711593 250
265 3300025939 Ga0207665_10363799 Ga0207665_103637991 250
266 3300025941 Ga0207711_10076835 Ga0207711_100768352 250
267 3300025944 Ga0207661_10360450 Ga0207661_103604502 250
268 3300025949 Ga0207667_10152217 Ga0207667_101522173 250
269 3300025949 Ga0207667_10434765 Ga0207667_104347652 250
270 3300025960 Ga0207651_10090989 Ga0207651_100909892 250
271 3300025972 Ga0207668_10534333 Ga0207668_105343331 250
272 3300025981 Ga0207640_10425518 Ga0207640_104255182 250
273 3300025986 Ga0207658_10082040 Ga0207658_100820403 250
274 3300026067 Ga0207678_10009366 Ga0207678_100093665 250
275 3300026075 Ga0207708_10010622 Ga0207708_100106224 250
276 3300026088 Ga0207641_10254598 Ga0207641_102545982 250
277 3300026089 Ga0207648_10001306 Ga0207648_1000130618 250
278 3300026095 Ga0207676_10007890 Ga0207676_100078903 250
279 3300026116 Ga0207674_10002699 Ga0207674_100026999 250
280 3300026116 Ga0207674_10006430 Ga0207674_100064301 250
281 3300026118 Ga0207675_100086866 Ga0207675_1000868662 250
282 3300026121 Ga0207683_10041453 Ga0207683_100414533 250
283 3300027907 Ga0207428_10031756 Ga0207428_100317563 250
284 3300027907 Ga0207428_10116130 Ga0207428_101161303 250
285 3300028379 Ga0268266_10005228 Ga0268266_100052282 250
286 3300028379 Ga0268266_10051892 Ga0268266_100518926 250
287 3300028380 Ga0268265_10000395 Ga0268265_100003959 250
288 3300028380 Ga0268265_10012463 Ga0268265_100124632 250
289 3300031852 Ga0307410_10525124 Ga0307410_105251242 250
290 3300031901 Ga0307406_10003760 Ga0307406_100037602 250
291 3300031911 Ga0307412_10011300 Ga0307412_100113002 250
292 3300032004 Ga0307414_10118816 Ga0307414_101188162 250
293 3300032005 Ga0307411_10022862 Ga0307411_100228621 250
294 3300032005 Ga0307411_10280144 Ga0307411_102801442 250
295 3300033179 Ga0307507_10209314 Ga0307507_102093141 250
296 3300035172 Ga0373955_0248578 Ga0373955_0248578_168_947 250
297 3300035242 Ga0373962_0054080 Ga0373962_0054080_303_1064 250
298 3300036401 Ga0373937_0209409 Ga0373937_0209409_67_873 250
299 3300037312 Ga0395899_0002227 Ga0395899_0002227_7906_8706 250
300 3300037312 Ga0395899_0002298 Ga0395899_0002298_10040_10810 250
301 3300037418 Ga0395900_0042819 Ga0395900_0042819_3196_3993 250
302 3300037466 Ga0395898_0020493 Ga0395898_0020493_4353_5153 250
303 3300037466 Ga0395898_0098144 Ga0395898_0098144_1221_1979 250
304 3300037466 Ga0395898_0184017 Ga0395898_0184017_222_1019 250
305 3300037471 Ga0395905_0010646 Ga0395905_0010646_7246_8046 250
306 3300037471 Ga0395905_0093469 Ga0395905_0093469_977_1774 250
307 3300037471 Ga0395905_0538332 Ga0395905_0538332_218_1009 250
308 3300038443 Ga0395901_0005992 Ga0395901_0005992_7246_8046 250
309 3300039447 Ga0436361_0293156 Ga0436361_0293156_844_1611 250
310 3300039447 Ga0436361_1064329 Ga0436361_1064329_972_1727 250
311 3300041491 Ga0451833_0951109 Ga0451833_0951109_2384_3139 250
312 3300041494 Ga0451837_0041791 Ga0451837_0041791_847_1602 250
313 3300041496 Ga0451839_0130424 Ga0451839_0130424_3267_4022 250
314 3300041498 Ga0451841_0288371 Ga0451841_0288371_1461_2216 250
315 3300041501 Ga0451845_0049690 Ga0451845_0049690_604_1359 250
316 3300041503 Ga0451847_0104981 Ga0451847_0104981_1036_1791 250
317 3300041505 Ga0451849_0792881 Ga0451849_0792881_872_1627 250
318 3300041507 Ga0451851_0786675 Ga0451851_0786675_48_803 250
319 3300041509 Ga0451843_0321215 Ga0451843_0321215_847_1602 250
320 3300041511 Ga0451855_0377549 Ga0451855_0377549_1168_1923 250
321 3300041512 Ga0451853_1412436 Ga0451853_1412436_604_1359 250
322 3300045051 Ga0451576_0182199 Ga0451576_0182199_32_817 250
323 3300046500 Ga0495596_0004974 Ga0495596_0004974_5570_6322 250
324 3300046507 Ga0495606_0198866 Ga0495606_0198866_14_775 250
325 3300046810 Ga0495660_0128326 Ga0495660_0128326_419_1177 250
326 3300048905 Ga0496102_0004952 Ga0496102_0004952_2656_3420 250
327 3300048906 Ga0496103_0014259 Ga0496103_0014259_194_958 250
328 3300048907 Ga0496104_0174385 Ga0496104_0174385_928_1707 250
329 3300048909 Ga0496106_0003499 Ga0496106_0003499_349_1113 250
330 3300048909 Ga0496106_0050711 Ga0496106_0050711_1996_2769 250
331 3300048912 Ga0496109_0326744 Ga0496109_0326744_99_854 250
332 3300048921 Ga0496118_0000829 Ga0496118_0000829_11440_12195 250
333 3300048922 Ga0496119_0116333 Ga0496119_0116333_533_1285 250
334 3300048928 Ga0496125_0113550 Ga0496125_0113550_837_1589 250
335 3300049571 Ga0501034_0003818 Ga0501034_0003818_1787_2554 250
336 3300049571 Ga0501034_0005231 Ga0501034_0005231_8790_9551 250
337 3300049579 Ga0501043_0065076 Ga0501043_0065076_1685_2440 250
338 3300049584 Ga0501068_0066436 Ga0501068_0066436_1178_1939 250
339 3300049585 Ga0501069_0113154 Ga0501069_0113154_237_998 250
340 3300049591 Ga0501075_0113911 Ga0501075_0113911_555_1310 250
341 3300049743 Ga0501081_0060768 Ga0501081_0060768_275_1030 250
342 3300049822 Ga0501035_0085912 Ga0501035_0085912_325_1080 250
343 3300049822 Ga0501035_0502045 Ga0501035_0502045_40_810 250
344 3300049823 Ga0501044_0239827 Ga0501044_0239827_728_1489 250
345 3300050489 nmdc:mga03683_8740_c1 nmdc:mga03683_8740_c1_326_1081 250
346 3300050489 nmdc:mga03683_90596_c1 nmdc:mga03683_90596_c1_468_1223 250
347 3300050490 nmdc:mga03n38_60958_c1 nmdc:mga03n38_60958_c1_68_823 250
348 3300050491 nmdc:mga00v17_1539_c1 nmdc:mga00v17_1539_c1_11124_11888 250
349 3300050491 nmdc:mga00v17_21615_c1 nmdc:mga00v17_21615_c1_600_1355 250
350 3300050492 nmdc:mga0yw44_31549_c1 nmdc:mga0yw44_31549_c1_1988_2743 250
351 3300050507 nmdc:mga05p37_104_c1 nmdc:mga05p37_104_c1_19583_20338 250
352 3300050509 nmdc:mga0qj67_197132_c1 nmdc:mga0qj67_197132_c1_813_1568 250
353 3300050511 nmdc:mga08y16_13344_c1 nmdc:mga08y16_13344_c1_7448_8221 250
354 3300050511 nmdc:mga08y16_19417_c1 nmdc:mga08y16_19417_c1_1914_2675 250
355 3300050515 nmdc:mga0a205_420756_c1 nmdc:mga0a205_420756_c1_113_868 250
356 3300050515 nmdc:mga0a205_84151_c1 nmdc:mga0a205_84151_c1_2214_2987 250
357 3300053079 Ga0500610_0115326 Ga0500610_0115326_440_1195 250
358 3300053085 Ga0495619_0542907 Ga0495619_0542907_12_767 250
359 3300061734 Ga0530510_0062306 Ga0530510_0062306_1735_2490 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

84

232

0.75

PF13460

NAD_binding_10

NAD(P)H-binding

56

225

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8888 2 130
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.8621 2 129
7qsn-assembly1.cif.gz_P bovine complex i in lipid nanodisc, deactive-apo 0.8522 1 202
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8253 3 211
8esw-assembly1.cif.gz_A9 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.8083 1 247
ID Description Score Start End Superfamily
2gn9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8282 1 129 3.40.50.720
af_Q54TU9_1_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8218 2 211 3.40.50.720
af_P75822_3_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8209 1 212 3.40.50.720
af_Q0J9V1_1_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8174 2 129 3.40.50.720
af_A0A0R0J5S1_4_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8159 36 117 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V7CXT5-F1-model_v4 NmrA family transcriptional regulator 1.003 1 129
AF-A0A2V6I120-F1-model_v4 NmrA family transcriptional regulator 1 1 120
AF-H0G2Z3-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 1 1 113
AF-A0A4V1T6H8-F1-model_v4 deleted 0.9989 1 91
AF-A0A1C9I4A5-F1-model_v4 Putative nucleoside-diphosphate-sugar epimerase 0.9988 1 245

Feature Viewer

pLDDT pTM Quality
96.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map