F421448

General Info

Members Datasets Scaffolds Average Seq Length
359 222 354 237

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100031427|Ga0070678_1000314273
Length 255
Sequence LFEVLVSNLKHQTLNLKQKNRMTPIIHIESLRKSYFMGKQALPVLKGITLDISKNEYVALMGPSGSGKSTLMNILGCLDSPTAGIYVLNGNDVSKMEDNQLAEIRNKEIGFVFQQFNLLPRLTAVDNVALPLVYAGIPKKRRTEMAMDVLKKVGLEDRSHHKPNELSGGQSQRVAIARALVNNPSMILADEPTGNLDSKTSNEIMEIFSKIQSAGNTVVLVTHEEDIANYAHRIVRLRDGVIETDKRKSPATAMV

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
3 2738541295 Bacillus sp. OK085 Isolate Unclassified
4 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
5 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.28
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 1.11
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10004858 3300003320 Bacteria 14814
2 rootH2_10052963 3300003320 Bacteria 13053
3 rootH2_10126634 3300003320 Bacteria 1674
4 rootL2_10272237 3300003322 Bacteria 2628
5 rootH1_10053349 3300003323 Bacteria 7037
6 rootH1_10274040 3300003323 Bacteria 1780
7 Ga0065712_10156106 3300005290 Bacteria 1334
8 Ga0065712_10203119 3300005290 Bacteria 1093
9 Ga0065707_10083958 3300005295 Bacteria 7893
10 Ga0065707_10203625 3300005295 Bacteria 1299
11 Ga0070658_10014553 3300005327 Bacteria 6313
12 Ga0070658_10278700 3300005327 Bacteria 1423
13 Ga0070658_10446742 3300005327 Bacteria 1114
14 Ga0070676_10083088 3300005328 Bacteria 1947
15 Ga0070683_100012609 3300005329 Bacteria 7348
16 Ga0070683_100393487 3300005329 Bacteria 1321
17 Ga0070690_100013413 3300005330 Bacteria 4841
18 Ga0070690_100046005 3300005330 Bacteria 2774
19 Ga0070670_100210247 3300005331 Bacteria 1691
20 Ga0070670_100593438 3300005331 Bacteria 991
21 Ga0070677_10060249 3300005333 Bacteria 1563
22 Ga0068869_100007580 3300005334 Bacteria 6944
23 Ga0070666_10000179 3300005335 Bacteria 43394
24 Ga0070666_10000325 3300005335 Bacteria 30448
25 Ga0070666_10213946 3300005335 Bacteria 1358
26 Ga0070680_100022370 3300005336 Bacteria 5035
27 Ga0070682_100070562 3300005337 Bacteria 2234
28 Ga0068868_100010177 3300005338 Bacteria 6797
29 Ga0068868_100084410 3300005338 Unclassified 2551
30 Ga0070689_100000960 3300005340 Bacteria 17956
31 Ga0070687_100013856 3300005343 Bacteria 3605
32 Ga0070687_100380445 3300005343 Bacteria 920
33 Ga0070661_100031714 3300005344 Bacteria 3822
34 Ga0070692_10076214 3300005345 Bacteria 1797
35 Ga0070668_100116744 3300005347 Bacteria 2129
36 Ga0070668_100280946 3300005347 Bacteria 1390
37 Ga0070669_100033585 3300005353 Bacteria 3712
38 Ga0070669_100201543 3300005353 Bacteria 1566
39 Ga0070675_100017857 3300005354 Bacteria 5643
40 Ga0070675_100210761 3300005354 Bacteria 1689
41 Ga0070675_100274484 3300005354 Bacteria 1480
42 Ga0070675_100520852 3300005354 Bacteria 1073
43 Ga0070671_100087796 3300005355 Bacteria 2602
44 Ga0070671_100144953 3300005355 Bacteria 2004
45 Ga0070671_100283864 3300005355 Bacteria 1408
46 Ga0070674_100085151 3300005356 Bacteria 2268
47 Ga0070674_100343632 3300005356 Bacteria 1203
48 Ga0070673_100009464 3300005364 Bacteria 6539
49 Ga0070673_100012732 3300005364 Bacteria 5786
50 Ga0070688_100036363 3300005365 Bacteria 2995
51 Ga0070688_100379206 3300005365 Bacteria 1042
52 Ga0070659_100008709 3300005366 Bacteria 7422
53 Ga0070667_100002333 3300005367 Bacteria 16608
54 Ga0070667_100219311 3300005367 Bacteria 1693
55 Ga0070667_100220616 3300005367 Bacteria 1688
56 Ga0070678_100031427 3300005456 Bacteria 3663
57 Ga0070678_100349923 3300005456 Bacteria 1270
58 Ga0070662_100191977 3300005457 Bacteria 1616
59 Ga0070662_100632068 3300005457 Bacteria 902
60 Ga0070681_10004917 3300005458 Bacteria 12834
61 Ga0070681_10065108 3300005458 Bacteria 3614
62 Ga0068867_100021486 3300005459 Bacteria 4604
63 Ga0070706_100001783 3300005467 Bacteria 22292
64 Ga0070707_100119926 3300005468 Bacteria 2554
65 Ga0070679_100014009 3300005530 Bacteria 7687
66 Ga0070684_100007996 3300005535 Bacteria 8255
67 Ga0070684_100011418 3300005535 Bacteria 7077
68 Ga0070684_100038846 3300005535 Bacteria 4091
69 Ga0068853_100033440 3300005539 Bacteria 4363
70 Ga0068853_100177556 3300005539 Bacteria 1930
71 Ga0068853_100505589 3300005539 Bacteria 1141
72 Ga0070672_100031872 3300005543 Bacteria 3972
73 Ga0070686_100009285 3300005544 Bacteria 5522
74 Ga0070686_100173035 3300005544 Bacteria 1529
75 Ga0070695_100001271 3300005545 Bacteria 13890
76 Ga0070665_100000001 3300005548 Bacteria 1083363
77 Ga0070664_100026896 3300005564 Bacteria 4778
78 Ga0070664_100059032 3300005564 Bacteria 3264
79 Ga0068857_100090220 3300005577 Bacteria 2743
80 Ga0068857_100122584 3300005577 Bacteria 2341
81 Ga0068856_100053319 3300005614 Bacteria 3987
82 Ga0068856_100238905 3300005614 Bacteria 1832
83 Ga0070702_100047776 3300005615 Unclassified 2433
84 Ga0068852_100014910 3300005616 Bacteria 6006
85 Ga0068852_100046734 3300005616 Bacteria 3690
86 Ga0068852_100089273 3300005616 Bacteria 2754
87 Ga0068852_100114972 3300005616 Unclassified 2452
88 Ga0068852_100391040 3300005616 Bacteria 1366
89 Ga0068859_100001025 3300005617 Bacteria 28627
90 Ga0068859_100010302 3300005617 Bacteria 9408
91 Ga0068859_100291646 3300005617 Bacteria 1724
92 Ga0068859_100555259 3300005617 Bacteria 1243
93 Ga0068864_100000555 3300005618 Bacteria 31945
94 Ga0068851_10014929 3300005834 Bacteria 3695
95 Ga0068851_10015002 3300005834 Bacteria 3686
96 Ga0068863_100001590 3300005841 Bacteria 22477
97 Ga0068863_100019473 3300005841 Bacteria 6493
98 Ga0068858_100011792 3300005842 Bacteria 8245
99 Ga0068858_100258590 3300005842 Bacteria 1655
100 Ga0068860_100000004 3300005843 Bacteria 506126
101 Ga0068860_100007414 3300005843 Bacteria 10972
102 Ga0068860_100026972 3300005843 Bacteria 5536
103 Ga0068860_100697171 3300005843 Bacteria 1025
104 Ga0081538_10045232 3300005981 Bacteria 2732
105 Ga0081540_1019344 3300005983 Bacteria 4144
106 Ga0097621_100086036 3300006237 Bacteria 2623
107 Ga0075431_100010071 3300006847 Bacteria 9498
108 Ga0075429_100020793 3300006880 Bacteria 5697
109 Ga0097620_100001025 3300006931 Bacteria 28627
110 Ga0097620_100010301 3300006931 Bacteria 9408
111 Ga0097620_100291635 3300006931 Bacteria 1724
112 Ga0097620_100555302 3300006931 Bacteria 1243
113 Ga0105240_10000061 3300009093 Bacteria 218897
114 Ga0105240_10000087 3300009093 Bacteria 187637
115 Ga0105240_10030932 3300009093 Bacteria 6951
116 Ga0111539_10025107 3300009094 Bacteria 7304
117 Ga0111539_10083755 3300009094 Unclassified 3750
118 Ga0105245_10697259 3300009098 Bacteria 1048
119 Ga0105247_10003332 3300009101 Bacteria 10520
120 Ga0114129_10005173 3300009147 Bacteria 18361
121 Ga0105241_10000471 3300009174 Bacteria 30433
122 Ga0105241_10000491 3300009174 Bacteria 29828
123 Ga0105237_10000377 3300009545 Bacteria 63580
124 Ga0105237_10007186 3300009545 Bacteria 12227
125 Ga0105237_10013400 3300009545 Bacteria 8601
126 Ga0105237_10061073 3300009545 Bacteria 3769
127 Ga0105237_10765004 3300009545 Bacteria 972
128 Ga0105238_10028281 3300009551 Bacteria 5713
129 Ga0105249_10002038 3300009553 Bacteria 17526
130 Ga0105239_10000029 3300010375 Bacteria 234749
131 Ga0105239_10088338 3300010375 Bacteria 3418
132 Ga0105239_10108734 3300010375 Bacteria 3072
133 Ga0105239_10120127 3300010375 Bacteria 2917
134 Ga0105239_10134362 3300010375 Bacteria 2753
135 Ga0105239_10224330 3300010375 Bacteria 2107
136 Ga0157371_10013093 3300013102 Bacteria 6315
137 Ga0157371_10029780 3300013102 Bacteria 3943
138 Ga0157371_10126258 3300013102 Bacteria 1819
139 Ga0157369_10024171 3300013105 Bacteria 6763
140 Ga0157369_10051343 3300013105 Bacteria 4462
141 Ga0157369_10421144 3300013105 Bacteria 1384
142 Ga0157374_10000001 3300013296 Bacteria 1077351
143 Ga0157374_10097083 3300013296 Bacteria 2819
144 Ga0157378_10002603 3300013297 Bacteria 16059
145 Ga0157378_10006378 3300013297 Bacteria 10314
146 Ga0157378_10026764 3300013297 Bacteria 5085
147 Ga0163162_10000944 3300013306 Bacteria 27022
148 Ga0163162_10001306 3300013306 Bacteria 23316
149 Ga0163162_10358083 3300013306 Bacteria 1592
150 Ga0157372_10000535 3300013307 Bacteria 41817
151 Ga0157372_10053854 3300013307 Bacteria 4486
152 Ga0157372_10073972 3300013307 Bacteria 3841
153 Ga0157372_10109488 3300013307 Bacteria 3163
154 Ga0157372_10114135 3300013307 Bacteria 3097
155 Ga0157372_10168164 3300013307 Bacteria 2536
156 Ga0157372_10290450 3300013307 Bacteria 1902
157 Ga0157372_10445154 3300013307 Bacteria 1510
158 Ga0157372_10643085 3300013307 Bacteria 1235
159 Ga0157375_10573231 3300013308 Bacteria 1289
160 Ga0157375_10705529 3300013308 Bacteria 1162
161 Ga0163163_10107636 3300014325 Bacteria 2814
162 Ga0163163_10213907 3300014325 Bacteria 1976
163 Ga0157380_10703847 3300014326 Bacteria 1015
164 Ga0157377_10007983 3300014745 Bacteria 5141
165 Ga0157379_10027159 3300014968 Bacteria 5096
166 Ga0157379_10211502 3300014968 Bacteria 1756
167 Ga0157376_10007182 3300014969 Bacteria 7920
168 Ga0163161_10311785 3300017792 Bacteria 1242
169 Ga0206353_10900167 3300020082 Bacteria 1204
170 Ga0207656_10224219 3300025321 Bacteria 914
171 Ga0207680_10000068 3300025903 Bacteria 45911
172 Ga0207680_10000741 3300025903 Bacteria 15371
173 Ga0207680_10130123 3300025903 Bacteria 1658
174 Ga0207647_10000017 3300025904 Bacteria 129999
175 Ga0207647_10230298 3300025904 Bacteria 1066
176 Ga0207645_10081221 3300025907 Bacteria 2078
177 Ga0207705_10218710 3300025909 Bacteria 1446
178 Ga0207684_10014629 3300025910 Bacteria 6761
179 Ga0207654_10004541 3300025911 Bacteria 7013
180 Ga0207654_10022428 3300025911 Bacteria 3369
181 Ga0207707_10086128 3300025912 Bacteria 2746
182 Ga0207707_10153557 3300025912 Bacteria 2013
183 Ga0207707_10616803 3300025912 Bacteria 917
184 Ga0207695_10000057 3300025913 Bacteria 376090
185 Ga0207695_10001216 3300025913 Bacteria 44107
186 Ga0207695_10003352 3300025913 Bacteria 22653
187 Ga0207695_10068990 3300025913 Bacteria 3620
188 Ga0207671_10001122 3300025914 Bacteria 32272
189 Ga0207671_10006310 3300025914 Bacteria 10589
190 Ga0207671_10176455 3300025914 Bacteria 1661
191 Ga0207671_10480392 3300025914 Bacteria 990
192 Ga0207662_10007559 3300025918 Bacteria 5920
193 Ga0207652_10011528 3300025921 Bacteria 7126
194 Ga0207646_10078100 3300025922 Bacteria 2958
195 Ga0207681_10135184 3300025923 Bacteria 1829
196 Ga0207681_10273076 3300025923 Bacteria 1328
197 Ga0207694_10248062 3300025924 Bacteria 1456
198 Ga0207650_10469703 3300025925 Bacteria 1049
199 Ga0207659_10079243 3300025926 Unclassified 2423
200 Ga0207687_10370496 3300025927 Bacteria 1171
201 Ga0207700_10530927 3300025928 Bacteria 1043
202 Ga0207644_10033083 3300025931 Bacteria 3611
203 Ga0207690_10023217 3300025932 Bacteria 3869
204 Ga0207706_10069230 3300025933 Bacteria 3104
205 Ga0207686_10044440 3300025934 Bacteria 2727
206 Ga0207670_10000546 3300025936 Bacteria 20777
207 Ga0207670_10171443 3300025936 Bacteria 1627
208 Ga0207669_10481517 3300025937 Bacteria 989
209 Ga0207665_10044683 3300025939 Bacteria 2964
210 Ga0207691_10037910 3300025940 Bacteria 4462
211 Ga0207689_10002325 3300025942 Bacteria 17792
212 Ga0207661_10004853 3300025944 Bacteria 9423
213 Ga0207661_10031805 3300025944 Bacteria 4081
214 Ga0207679_10018494 3300025945 Bacteria 4669
215 Ga0207679_10084672 3300025945 Bacteria 2434
216 Ga0207679_10172177 3300025945 Bacteria 1783
217 Ga0207679_10375225 3300025945 Bacteria 1246
218 Ga0207667_10100746 3300025949 Bacteria 2980
219 Ga0207651_10179702 3300025960 Bacteria 1677
220 Ga0207651_10490311 3300025960 Bacteria 1060
221 Ga0207651_10516495 3300025960 Bacteria 1034
222 Ga0207712_10018567 3300025961 Bacteria 4531
223 Ga0207658_10045739 3300025986 Bacteria 3192
224 Ga0207677_10002937 3300026023 Bacteria 9004
225 Ga0207677_10083883 3300026023 Bacteria 2295
226 Ga0207677_10228858 3300026023 Bacteria 1496
227 Ga0207703_10008589 3300026035 Bacteria 8062
228 Ga0207703_10313657 3300026035 Bacteria 1434
229 Ga0207639_10020200 3300026041 Bacteria 4765
230 Ga0207639_10042943 3300026041 Bacteria 3391
231 Ga0207639_10248243 3300026041 Bacteria 1551
232 Ga0207702_10160260 3300026078 Bacteria 2054
233 Ga0207702_10358258 3300026078 Bacteria 1397
234 Ga0207641_10000176 3300026088 Bacteria 88863
235 Ga0207648_10019405 3300026089 Bacteria 6136
236 Ga0207648_10162964 3300026089 Bacteria 1970
237 Ga0207676_10041846 3300026095 Bacteria 3520
238 Ga0207674_10070260 3300026116 Bacteria 3520
239 Ga0207674_10089192 3300026116 Bacteria 3076
240 Ga0207683_10011208 3300026121 Bacteria 7641
241 Ga0207683_10154705 3300026121 Bacteria 2071
242 Ga0207698_10006380 3300026142 Bacteria 7352
243 Ga0207698_10060269 3300026142 Bacteria 2951
244 Ga0207698_10077077 3300026142 Bacteria 2671
245 Ga0207698_10293901 3300026142 Bacteria 1509
246 Ga0268266_10000065 3300028379 Bacteria 246498
247 Ga0268264_10000011 3300028381 Bacteria 580884
248 Ga0268264_10000998 3300028381 Bacteria 28836
249 Ga0268264_10004291 3300028381 Bacteria 12166
250 Ga0307515_10157702 3300028794 Bacteria 2333
251 Ga0307511_10014449 3300030521 Bacteria 7688
252 Ga0265327_10015377 3300031251 Bacteria 4944
253 Ga0307513_10101841 3300031456 Bacteria 2893
254 Ga0307509_10033445 3300031507 Bacteria 5659
255 Ga0307509_10232850 3300031507 Bacteria 1643
256 Ga0307509_10234457 3300031507 Bacteria 1634
257 Ga0307509_10266876 3300031507 Bacteria 1482
258 Ga0307508_10001362 3300031616 Bacteria 27521
259 Ga0307516_10001871 3300031730 Bacteria 28796
260 Ga0307413_10220789 3300031824 Bacteria 1384
261 Ga0307412_10118640 3300031911 Bacteria 1901
262 Ga0307416_100232881 3300032002 Bacteria 1777
263 Ga0307415_100168109 3300032126 Bacteria 1707
264 Ga0307510_10008932 3300033180 Bacteria 11935
265 Ga0307510_10041116 3300033180 Bacteria 5062
266 Ga0373956_0082775 3300035119 Bacteria 1474
267 Ga0373935_0072485 3300035692 Bacteria 2224
268 Ga0373937_0003426 3300036401 Bacteria 13306
269 Ga0373925_0259504 3300037068 Bacteria 1396
270 Ga0395899_0025460 3300037312 Bacteria 4467
271 Ga0395900_0019525 3300037418 Bacteria 6909
272 Ga0395900_0055550 3300037418 Bacteria 4077
273 Ga0395900_0086650 3300037418 Bacteria 3218
274 Ga0395898_0026696 3300037466 Bacteria 5806
275 Ga0395898_0086673 3300037466 Bacteria 3017
276 Ga0395898_0227820 3300037466 Bacteria 1777
277 Ga0395898_0381051 3300037466 Bacteria 1345
278 Ga0395905_0038119 3300037471 Bacteria 4509
279 Ga0395905_0226860 3300037471 Bacteria 1747
280 Ga0439431_0071759 3300041997 Bacteria 923
281 Ga0439434_0019602 3300042435 Bacteria 2029
282 Ga0451577_0006213 3300042876 Bacteria 11983
283 Ga0451577_0604818 3300042876 Bacteria 995
284 Ga0453683_0111391 3300044673 Bacteria 1721
285 Ga0466961_0075923 3300044693 Bacteria 2130
286 Ga0453684_0001062 3300044712 Bacteria 87471
287 Ga0466971_0020395 3300044719 Bacteria 2948
288 Ga0466970_0040604 3300044765 Bacteria 2471
289 Ga0466959_0000681 3300045049 Bacteria 19853
290 Ga0495592_0267147 3300046454 Bacteria 1124
291 Ga0495641_0019749 3300046461 Bacteria 3437
292 Ga0495580_0002301 3300046472 Bacteria 16670
293 Ga0495582_0020671 3300046473 Bacteria 3604
294 Ga0495605_0079533 3300046474 Bacteria 1535
295 Ga0495584_0062254 3300046491 Bacteria 1875
296 Ga0495607_0144654 3300046501 Bacteria 1223
297 Ga0495606_0015722 3300046507 Bacteria 5811
298 Ga0495637_0088802 3300046520 Bacteria 1222
299 Ga0495648_0007147 3300046524 Bacteria 8975
300 Ga0495663_0060021 3300046525 Bacteria 1194
301 Ga0495654_0108096 3300046530 Bacteria 1272
302 Ga0495665_0048861 3300046531 Bacteria 2243
303 Ga0495586_0068552 3300046535 Bacteria 1935
304 Ga0495609_0028844 3300046538 Bacteria 2530
305 Ga0495656_0135225 3300046615 Bacteria 1177
306 Ga0495668_0001736 3300046616 Bacteria 20049
307 Ga0495611_0000021 3300046648 Bacteria 123657
308 Ga0495588_0046807 3300046674 Bacteria 2219
309 Ga0495647_0073727 3300046681 Bacteria 1371
310 Ga0495658_0214199 3300046683 Bacteria 1204
311 Ga0495669_0078253 3300046684 Bacteria 1515
312 Ga0495671_0029812 3300046692 Bacteria 2799
313 Ga0495660_0168624 3300046810 Bacteria 1068
314 Ga0495676_0018714 3300047321 Bacteria 6107
315 Ga0495687_000001 3300047443 Bacteria 1215582
316 Ga0495686_0000094 3300047472 Bacteria 187720
317 Ga0496109_0293565 3300048912 Bacteria 1533
318 Ga0496110_0365469 3300048913 Bacteria 1315
319 Ga0496112_0020065 3300048915 Bacteria 6328
320 Ga0496112_0358737 3300048915 Bacteria 1400
321 Ga0495682_0087040 3300049460 Bacteria 1123
322 Ga0501039_0563192 3300049575 Bacteria 894
323 Ga0501047_0009215 3300049581 Bacteria 9318
324 Ga0501047_0341119 3300049581 Bacteria 1336
325 Ga0501070_0023517 3300049586 Bacteria 5162
326 Ga0501077_0014464 3300049593 Bacteria 4959
327 Ga0501217_083046 3300049661 Bacteria 889
328 Ga0501223_002673 3300049663 Bacteria 3928
329 Ga0501235_007792 3300049669 Bacteria 2335
330 Ga0501225_0018090 3300049705 Bacteria 1955
331 Ga0501079_0058286 3300049741 Bacteria 2980
332 Ga0501079_0195222 3300049741 Bacteria 1580
333 Ga0501081_0081826 3300049743 Bacteria 2262
334 Ga0501081_0597699 3300049743 Bacteria 826
335 Ga0501035_0436095 3300049822 Bacteria 1086
336 Ga0501044_0633102 3300049823 Bacteria 960
337 Ga0501045_0038734 3300049824 Bacteria 3468
338 nmdc:mga05p37_22499_c1 3300050507 Bacteria 7644
339 nmdc:mga06r32_49338_c1 3300050510 Bacteria 4025
340 nmdc:mga08y16_274133_c1 3300050511 Bacteria 1741
341 nmdc:mga0n895_139053_c1 3300050512 Bacteria 2456
342 Ga0500578_0000362 3300053086 Bacteria 55748
343 Ga0500583_0000224 3300053092 Bacteria 20897
344 Ga0500583_0004739 3300053092 Bacteria 4474
345 Ga0500583_0140849 3300053092 Bacteria 1198
346 Ga0500556_0231889 3300053104 Bacteria 728
347 Ga0500652_017957 3300053131 Bacteria 2602
348 Ga0500658_0038769 3300053134 Bacteria 1901
349 Ga0500616_0012441 3300053153 Bacteria 4978
350 Ga0500622_0002252 3300053156 Bacteria 14190
351 Ga0500645_035391 3300053730 Bacteria 1488
352 Ga0501084_0044308 3300054114 Bacteria 3725
353 Ga0501082_0447371 3300060353 Bacteria 1129
354 Ga0466962_0008385 3300061719 Bacteria 4953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_139053_c1 nmdc:mga0n895_139053_c1_23_679 206
2 3300049743 Ga0501081_0597699 Ga0501081_0597699_188_811 207
3 3300005347 Ga0070668_100280946 Ga0070668_1002809462 217
4 3300050511 nmdc:mga08y16_274133_c1 nmdc:mga08y16_274133_c1_674_1327 217
5 3300028794 Ga0307515_10157702 Ga0307515_101577023 218
6 3300053104 Ga0500556_0231889 Ga0500556_0231889_62_718 218
7 3300005333 Ga0070677_10060249 Ga0070677_100602492 219
8 3300005345 Ga0070692_10076214 Ga0070692_100762142 219
9 3300005354 Ga0070675_100274484 Ga0070675_1002744842 219
10 3300005457 Ga0070662_100191977 Ga0070662_1001919771 219
11 3300005544 Ga0070686_100173035 Ga0070686_1001730352 219
12 3300009094 Ga0111539_10083755 Ga0111539_100837553 219
13 3300009101 Ga0105247_10003332 Ga0105247_100033325 219
14 3300009174 Ga0105241_10000471 Ga0105241_1000047121 219
15 3300009545 Ga0105237_10013400 Ga0105237_100134008 219
16 3300009553 Ga0105249_10002038 Ga0105249_100020384 219
17 3300010375 Ga0105239_10088338 Ga0105239_100883383 219
18 3300010375 Ga0105239_10134362 Ga0105239_101343623 219
19 3300013306 Ga0163162_10000944 Ga0163162_1000094412 219
20 3300013308 Ga0157375_10705529 Ga0157375_107055291 219
21 3300014325 Ga0163163_10107636 Ga0163163_101076361 219
22 3300014968 Ga0157379_10027159 Ga0157379_100271595 219
23 3300017792 Ga0163161_10311785 Ga0163161_103117852 219
24 3300025923 Ga0207681_10135184 Ga0207681_101351841 219
25 3300025936 Ga0207670_10171443 Ga0207670_101714432 219
26 3300025960 Ga0207651_10516495 Ga0207651_105164952 219
27 3300031507 Ga0307509_10266876 Ga0307509_102668763 219
28 3300046648 Ga0495611_0000021 Ga0495611_0000021_61859_62518 219
29 3300005295 Ga0065707_10083958 Ga0065707_100839585 221
30 3300005468 Ga0070707_100119926 Ga0070707_1001199263 223
31 3300025922 Ga0207646_10078100 Ga0207646_100781003 223
32 3300005330 Ga0070690_100046005 Ga0070690_1000460052 224
33 3300005340 Ga0070689_100000960 Ga0070689_10000096012 224
34 3300005343 Ga0070687_100380445 Ga0070687_1003804452 224
35 3300005544 Ga0070686_100009285 Ga0070686_1000092852 224
36 3300025936 Ga0207670_10000546 Ga0207670_1000054621 224
37 3300049586 Ga0501070_0023517 Ga0501070_0023517_1326_2060 224
38 iso_pu_bacteria 2738541295 2738814921 227
39 3300003323 rootH1_10274040 rootH1_102740401 228
40 3300049743 Ga0501081_0081826 Ga0501081_0081826_254_970 228
41 3300060353 Ga0501082_0447371 Ga0501082_0447371_196_912 228
42 3300025928 Ga0207700_10530927 Ga0207700_105309271 229
43 3300025939 Ga0207665_10044683 Ga0207665_100446832 229
44 3300025945 Ga0207679_10375225 Ga0207679_103752252 229
45 3300042876 Ga0451577_0604818 Ga0451577_0604818_104_850 229
46 3300044673 Ga0453683_0111391 Ga0453683_0111391_605_1351 229
47 3300044712 Ga0453684_0001062 Ga0453684_0001062_74381_75127 229
48 3300048913 Ga0496110_0365469 Ga0496110_0365469_343_1041 229
49 3300048915 Ga0496112_0020065 Ga0496112_0020065_23_721 229
50 iso_pu_bacteria 2585428059 2587740949 229
51 iso_pu_bacteria 2643221676 2644422262 229
52 iso_pu_bacteria 2904755435 2904762202 229
53 iso_pu_bacteria 2919425241 2919429295 229
54 3300005327 Ga0070658_10014553 Ga0070658_100145538 230
55 3300005329 Ga0070683_100393487 Ga0070683_1003934871 230
56 3300005336 Ga0070680_100022370 Ga0070680_1000223703 230
57 3300005337 Ga0070682_100070562 Ga0070682_1000705622 230
58 3300005458 Ga0070681_10065108 Ga0070681_100651082 230
59 3300005530 Ga0070679_100014009 Ga0070679_1000140096 230
60 3300005535 Ga0070684_100011418 Ga0070684_1000114183 230
61 3300005577 Ga0068857_100122584 Ga0068857_1001225842 230
62 3300013105 Ga0157369_10024171 Ga0157369_100241718 230
63 3300020082 Ga0206353_10900167 Ga0206353_109001672 230
64 3300025909 Ga0207705_10218710 Ga0207705_102187102 230
65 3300025912 Ga0207707_10086128 Ga0207707_100861282 230
66 3300025912 Ga0207707_10616803 Ga0207707_106168031 230
67 3300025921 Ga0207652_10011528 Ga0207652_100115288 230
68 3300026116 Ga0207674_10070260 Ga0207674_100702602 230
69 3300048912 Ga0496109_0293565 Ga0496109_0293565_452_1156 230
70 3300048915 Ga0496112_0358737 Ga0496112_0358737_417_1121 230
71 3300025927 Ga0207687_10370496 Ga0207687_103704962 231
72 3300049741 Ga0501079_0058286 Ga0501079_0058286_2185_2889 231
73 3300003322 rootL2_10272237 rootL2_102722373 232
74 3300005356 Ga0070674_100085151 Ga0070674_1000851512 232
75 3300005467 Ga0070706_100001783 Ga0070706_1000017836 232
76 3300025910 Ga0207684_10014629 Ga0207684_100146294 232
77 3300025934 Ga0207686_10044440 Ga0207686_100444402 232
78 3300025945 Ga0207679_10018494 Ga0207679_100184943 232
79 3300037418 Ga0395900_0019525 Ga0395900_0019525_5388_6164 232
80 3300037418 Ga0395900_0086650 Ga0395900_0086650_1077_1856 232
81 3300037466 Ga0395898_0026696 Ga0395898_0026696_1661_2359 232
82 3300037466 Ga0395898_0086673 Ga0395898_0086673_1046_1825 232
83 3300037466 Ga0395898_0381051 Ga0395898_0381051_394_1170 232
84 3300046461 Ga0495641_0019749 Ga0495641_0019749_2303_3079 232
85 3300046472 Ga0495580_0002301 Ga0495580_0002301_10971_11678 232
86 3300046473 Ga0495582_0020671 Ga0495582_0020671_595_1371 232
87 3300046474 Ga0495605_0079533 Ga0495605_0079533_462_1238 232
88 3300046491 Ga0495584_0062254 Ga0495584_0062254_306_1082 232
89 3300046501 Ga0495607_0144654 Ga0495607_0144654_15_791 232
90 3300046520 Ga0495637_0088802 Ga0495637_0088802_222_998 232
91 3300046525 Ga0495663_0060021 Ga0495663_0060021_355_1131 232
92 3300046530 Ga0495654_0108096 Ga0495654_0108096_282_1058 232
93 3300046531 Ga0495665_0048861 Ga0495665_0048861_506_1282 232
94 3300046535 Ga0495586_0068552 Ga0495586_0068552_920_1696 232
95 3300046538 Ga0495609_0028844 Ga0495609_0028844_799_1575 232
96 3300046615 Ga0495656_0135225 Ga0495656_0135225_122_898 232
97 3300046674 Ga0495588_0046807 Ga0495588_0046807_1296_2072 232
98 3300046681 Ga0495647_0073727 Ga0495647_0073727_349_1125 232
99 3300046684 Ga0495669_0078253 Ga0495669_0078253_118_894 232
100 3300046692 Ga0495671_0029812 Ga0495671_0029812_436_1212 232
101 3300046810 Ga0495660_0168624 Ga0495660_0168624_88_864 232
102 3300047321 Ga0495676_0018714 Ga0495676_0018714_2370_3146 232
103 3300049741 Ga0501079_0195222 Ga0501079_0195222_481_1236 232
104 3300005327 Ga0070658_10278700 Ga0070658_102787002 233
105 3300005327 Ga0070658_10446742 Ga0070658_104467421 233
106 3300005329 Ga0070683_100012609 Ga0070683_1000126094 233
107 3300005335 Ga0070666_10000325 Ga0070666_100003259 233
108 3300005354 Ga0070675_100210761 Ga0070675_1002107612 233
109 3300005355 Ga0070671_100283864 Ga0070671_1002838642 233
110 3300005367 Ga0070667_100219311 Ga0070667_1002193112 233
111 3300005535 Ga0070684_100007996 Ga0070684_1000079969 233
112 3300005564 Ga0070664_100026896 Ga0070664_1000268964 233
113 3300005616 Ga0068852_100089273 Ga0068852_1000892733 233
114 3300005834 Ga0068851_10015002 Ga0068851_100150026 233
115 3300006847 Ga0075431_100010071 Ga0075431_1000100718 233
116 3300006880 Ga0075429_100020793 Ga0075429_1000207933 233
117 3300009098 Ga0105245_10697259 Ga0105245_106972592 233
118 3300013102 Ga0157371_10013093 Ga0157371_100130937 233
119 3300013102 Ga0157371_10029780 Ga0157371_100297803 233
120 3300013102 Ga0157371_10126258 Ga0157371_101262582 233
121 3300013105 Ga0157369_10421144 Ga0157369_104211442 233
122 3300013307 Ga0157372_10053854 Ga0157372_100538545 233
123 3300013307 Ga0157372_10073972 Ga0157372_100739724 233
124 3300013307 Ga0157372_10109488 Ga0157372_101094885 233
125 3300013307 Ga0157372_10168164 Ga0157372_101681641 233
126 3300013307 Ga0157372_10643085 Ga0157372_106430852 233
127 3300025903 Ga0207680_10000741 Ga0207680_100007417 233
128 3300025944 Ga0207661_10004853 Ga0207661_100048537 233
129 3300026142 Ga0207698_10077077 Ga0207698_100770773 233
130 3300031507 Ga0307509_10234457 Ga0307509_102344572 233
131 3300035119 Ga0373956_0082775 Ga0373956_0082775_286_1020 233
132 3300036401 Ga0373937_0003426 Ga0373937_0003426_5398_6132 233
133 3300037068 Ga0373925_0259504 Ga0373925_0259504_379_1113 233
134 3300037471 Ga0395905_0226860 Ga0395905_0226860_106_807 233
135 3300046454 Ga0495592_0267147 Ga0495592_0267147_76_810 233
136 3300046683 Ga0495658_0214199 Ga0495658_0214199_272_1006 233
137 3300049581 Ga0501047_0009215 Ga0501047_0009215_4972_5673 233
138 3300049822 Ga0501035_0436095 Ga0501035_0436095_231_932 233
139 3300049823 Ga0501044_0633102 Ga0501044_0633102_87_788 233
140 3300050510 nmdc:mga06r32_49338_c1 nmdc:mga06r32_49338_c1_1956_2657 233
141 3300053092 Ga0500583_0000224 Ga0500583_0000224_12790_13491 233
142 3300053131 Ga0500652_017957 Ga0500652_017957_567_1268 233
143 3300053134 Ga0500658_0038769 Ga0500658_0038769_723_1424 233
144 3300003320 rootH2_10052963 rootH2_100529633 234
145 3300003323 rootH1_10053349 rootH1_100533492 234
146 3300005290 Ga0065712_10156106 Ga0065712_101561062 234
147 3300005290 Ga0065712_10203119 Ga0065712_102031192 234
148 3300005295 Ga0065707_10203625 Ga0065707_102036252 234
149 3300005328 Ga0070676_10083088 Ga0070676_100830882 234
150 3300005330 Ga0070690_100013413 Ga0070690_1000134132 234
151 3300005331 Ga0070670_100210247 Ga0070670_1002102472 234
152 3300005331 Ga0070670_100593438 Ga0070670_1005934382 234
153 3300005334 Ga0068869_100007580 Ga0068869_1000075808 234
154 3300005335 Ga0070666_10000179 Ga0070666_1000017922 234
155 3300005338 Ga0068868_100010177 Ga0068868_1000101779 234
156 3300005338 Ga0068868_100084410 Ga0068868_1000844103 234
157 3300005343 Ga0070687_100013856 Ga0070687_1000138564 234
158 3300005344 Ga0070661_100031714 Ga0070661_1000317146 234
159 3300005347 Ga0070668_100116744 Ga0070668_1001167442 234
160 3300005353 Ga0070669_100033585 Ga0070669_1000335855 234
161 3300005353 Ga0070669_100201543 Ga0070669_1002015432 234
162 3300005354 Ga0070675_100017857 Ga0070675_1000178576 234
163 3300005355 Ga0070671_100087796 Ga0070671_1000877963 234
164 3300005355 Ga0070671_100144953 Ga0070671_1001449533 234
165 3300005356 Ga0070674_100343632 Ga0070674_1003436322 234
166 3300005364 Ga0070673_100009464 Ga0070673_1000094647 234
167 3300005364 Ga0070673_100012732 Ga0070673_1000127322 234
168 3300005365 Ga0070688_100036363 Ga0070688_1000363631 234
169 3300005366 Ga0070659_100008709 Ga0070659_1000087094 234
170 3300005367 Ga0070667_100002333 Ga0070667_1000023338 234
171 3300005367 Ga0070667_100220616 Ga0070667_1002206162 234
172 3300005459 Ga0068867_100021486 Ga0068867_1000214863 234
173 3300005539 Ga0068853_100033440 Ga0068853_1000334403 234
174 3300005539 Ga0068853_100505589 Ga0068853_1005055892 234
175 3300005543 Ga0070672_100031872 Ga0070672_1000318724 234
176 3300005545 Ga0070695_100001271 Ga0070695_1000012712 234
177 3300005564 Ga0070664_100059032 Ga0070664_1000590322 234
178 3300005615 Ga0070702_100047776 Ga0070702_1000477762 234
179 3300005616 Ga0068852_100014910 Ga0068852_1000149108 234
180 3300005616 Ga0068852_100046734 Ga0068852_1000467343 234
181 3300005616 Ga0068852_100114972 Ga0068852_1001149722 234
182 3300005617 Ga0068859_100001025 Ga0068859_1000010255 234
183 3300005617 Ga0068859_100010302 Ga0068859_10001030210 234
184 3300005617 Ga0068859_100291646 Ga0068859_1002916462 234
185 3300005617 Ga0068859_100555259 Ga0068859_1005552592 234
186 3300005618 Ga0068864_100000555 Ga0068864_10000055518 234
187 3300005834 Ga0068851_10014929 Ga0068851_100149297 234
188 3300005841 Ga0068863_100001590 Ga0068863_1000015908 234
189 3300005841 Ga0068863_100019473 Ga0068863_10001947310 234
190 3300005842 Ga0068858_100011792 Ga0068858_1000117922 234
191 3300005842 Ga0068858_100258590 Ga0068858_1002585902 234
192 3300005843 Ga0068860_100007414 Ga0068860_1000074144 234
193 3300005843 Ga0068860_100026972 Ga0068860_1000269726 234
194 3300005981 Ga0081538_10045232 Ga0081538_100452322 234
195 3300005983 Ga0081540_1019344 Ga0081540_10193445 234
196 3300006237 Ga0097621_100086036 Ga0097621_1000860364 234
197 3300006931 Ga0097620_100001025 Ga0097620_1000010255 234
198 3300006931 Ga0097620_100010301 Ga0097620_1000103011 234
199 3300006931 Ga0097620_100291635 Ga0097620_1002916352 234
200 3300006931 Ga0097620_100555302 Ga0097620_1005553022 234
201 3300009094 Ga0111539_10025107 Ga0111539_100251077 234
202 3300009147 Ga0114129_10005173 Ga0114129_100051737 234
203 3300013105 Ga0157369_10051343 Ga0157369_100513433 234
204 3300013296 Ga0157374_10097083 Ga0157374_100970834 234
205 3300013297 Ga0157378_10002603 Ga0157378_1000260315 234
206 3300013297 Ga0157378_10006378 Ga0157378_1000637810 234
207 3300013306 Ga0163162_10358083 Ga0163162_103580832 234
208 3300013307 Ga0157372_10114135 Ga0157372_101141352 234
209 3300013307 Ga0157372_10290450 Ga0157372_102904503 234
210 3300013307 Ga0157372_10445154 Ga0157372_104451542 234
211 3300014325 Ga0163163_10213907 Ga0163163_102139072 234
212 3300014326 Ga0157380_10703847 Ga0157380_107038472 234
213 3300014968 Ga0157379_10211502 Ga0157379_102115022 234
214 3300025321 Ga0207656_10224219 Ga0207656_102242191 234
215 3300025903 Ga0207680_10000068 Ga0207680_1000006835 234
216 3300025904 Ga0207647_10000017 Ga0207647_1000001784 234
217 3300025904 Ga0207647_10230298 Ga0207647_102302982 234
218 3300025907 Ga0207645_10081221 Ga0207645_100812212 234
219 3300025911 Ga0207654_10004541 Ga0207654_100045417 234
220 3300025914 Ga0207671_10001122 Ga0207671_1000112226 234
221 3300025918 Ga0207662_10007559 Ga0207662_100075593 234
222 3300025923 Ga0207681_10273076 Ga0207681_102730762 234
223 3300025925 Ga0207650_10469703 Ga0207650_104697032 234
224 3300025926 Ga0207659_10079243 Ga0207659_100792432 234
225 3300025931 Ga0207644_10033083 Ga0207644_100330835 234
226 3300025932 Ga0207690_10023217 Ga0207690_100232175 234
227 3300025933 Ga0207706_10069230 Ga0207706_100692305 234
228 3300025937 Ga0207669_10481517 Ga0207669_104815171 234
229 3300025940 Ga0207691_10037910 Ga0207691_100379104 234
230 3300025942 Ga0207689_10002325 Ga0207689_1000232514 234
231 3300025945 Ga0207679_10172177 Ga0207679_101721773 234
232 3300025960 Ga0207651_10179702 Ga0207651_101797023 234
233 3300025960 Ga0207651_10490311 Ga0207651_104903112 234
234 3300025961 Ga0207712_10018567 Ga0207712_100185676 234
235 3300025986 Ga0207658_10045739 Ga0207658_100457394 234
236 3300026023 Ga0207677_10002937 Ga0207677_100029378 234
237 3300026023 Ga0207677_10083883 Ga0207677_100838833 234
238 3300026023 Ga0207677_10228858 Ga0207677_102288582 234
239 3300026035 Ga0207703_10008589 Ga0207703_100085898 234
240 3300026035 Ga0207703_10313657 Ga0207703_103136572 234
241 3300026041 Ga0207639_10042943 Ga0207639_100429433 234
242 3300026078 Ga0207702_10358258 Ga0207702_103582582 234
243 3300026088 Ga0207641_10000176 Ga0207641_1000017621 234
244 3300026089 Ga0207648_10019405 Ga0207648_100194056 234
245 3300026089 Ga0207648_10162964 Ga0207648_101629642 234
246 3300026095 Ga0207676_10041846 Ga0207676_100418462 234
247 3300026121 Ga0207683_10011208 Ga0207683_100112083 234
248 3300026142 Ga0207698_10006380 Ga0207698_100063805 234
249 3300026142 Ga0207698_10060269 Ga0207698_100602693 234
250 3300028381 Ga0268264_10000998 Ga0268264_100009984 234
251 3300028381 Ga0268264_10004291 Ga0268264_1000429110 234
252 3300031251 Ga0265327_10015377 Ga0265327_100153774 234
253 3300031456 Ga0307513_10101841 Ga0307513_101018412 234
254 3300031616 Ga0307508_10001362 Ga0307508_1000136224 234
255 3300037312 Ga0395899_0025460 Ga0395899_0025460_3168_3950 234
256 3300037418 Ga0395900_0055550 Ga0395900_0055550_500_1282 234
257 3300037466 Ga0395898_0227820 Ga0395898_0227820_294_1076 234
258 3300037471 Ga0395905_0038119 Ga0395905_0038119_552_1334 234
259 3300041997 Ga0439431_0071759 Ga0439431_0071759_192_896 234
260 3300042435 Ga0439434_0019602 Ga0439434_0019602_783_1487 234
261 3300042876 Ga0451577_0006213 Ga0451577_0006213_4479_5192 234
262 3300044693 Ga0466961_0075923 Ga0466961_0075923_259_963 234
263 3300044719 Ga0466971_0020395 Ga0466971_0020395_58_762 234
264 3300045049 Ga0466959_0000681 Ga0466959_0000681_17291_17995 234
265 3300046616 Ga0495668_0001736 Ga0495668_0001736_6399_7103 234
266 3300049575 Ga0501039_0563192 Ga0501039_0563192_108_836 234
267 3300049593 Ga0501077_0014464 Ga0501077_0014464_3654_4382 234
268 3300049824 Ga0501045_0038734 Ga0501045_0038734_408_1136 234
269 3300050507 nmdc:mga05p37_22499_c1 nmdc:mga05p37_22499_c1_4991_5695 234
270 3300053086 Ga0500578_0000362 Ga0500578_0000362_45172_45876 234
271 3300053092 Ga0500583_0004739 Ga0500583_0004739_3498_4202 234
272 3300053153 Ga0500616_0012441 Ga0500616_0012441_3652_4362 234
273 3300053730 Ga0500645_035391 Ga0500645_035391_656_1363 234
274 3300054114 Ga0501084_0044308 Ga0501084_0044308_2132_2860 234
275 3300061719 Ga0466962_0008385 Ga0466962_0008385_3237_3941 234
276 3300005354 Ga0070675_100520852 Ga0070675_1005208521 235
277 3300005365 Ga0070688_100379206 Ga0070688_1003792061 235
278 3300005535 Ga0070684_100038846 Ga0070684_1000388464 235
279 3300005577 Ga0068857_100090220 Ga0068857_1000902202 235
280 3300013307 Ga0157372_10000535 Ga0157372_1000053532 235
281 3300025944 Ga0207661_10031805 Ga0207661_100318053 235
282 3300025945 Ga0207679_10084672 Ga0207679_100846723 235
283 3300026116 Ga0207674_10089192 Ga0207674_100891924 235
284 3300026121 Ga0207683_10154705 Ga0207683_101547052 235
285 3300030521 Ga0307511_10014449 Ga0307511_100144498 235
286 3300031507 Ga0307509_10033445 Ga0307509_100334453 235
287 3300033180 Ga0307510_10041116 Ga0307510_100411166 235
288 3300035692 Ga0373935_0072485 Ga0373935_0072485_341_1048 235
289 3300049460 Ga0495682_0087040 Ga0495682_0087040_118_825 235
290 3300003320 rootH2_10126634 rootH2_101266341 236
291 3300005335 Ga0070666_10213946 Ga0070666_102139462 236
292 3300005456 Ga0070678_100349923 Ga0070678_1003499232 236
293 3300005457 Ga0070662_100632068 Ga0070662_1006320682 236
294 3300005458 Ga0070681_10004917 Ga0070681_100049174 236
295 3300005539 Ga0068853_100177556 Ga0068853_1001775562 236
296 3300005548 Ga0070665_100000001 Ga0070665_10000000145 236
297 3300005614 Ga0068856_100053319 Ga0068856_1000533192 236
298 3300005614 Ga0068856_100238905 Ga0068856_1002389052 236
299 3300005616 Ga0068852_100391040 Ga0068852_1003910402 236
300 3300005843 Ga0068860_100000004 Ga0068860_100000004167 236
301 3300005843 Ga0068860_100697171 Ga0068860_1006971711 236
302 3300009093 Ga0105240_10030932 Ga0105240_100309323 236
303 3300009174 Ga0105241_10000491 Ga0105241_100004916 236
304 3300009545 Ga0105237_10007186 Ga0105237_100071861 236
305 3300009545 Ga0105237_10061073 Ga0105237_100610732 236
306 3300009551 Ga0105238_10028281 Ga0105238_100282813 236
307 3300010375 Ga0105239_10000029 Ga0105239_1000002940 236
308 3300010375 Ga0105239_10120127 Ga0105239_101201273 236
309 3300010375 Ga0105239_10224330 Ga0105239_102243303 236
310 3300013296 Ga0157374_10000001 Ga0157374_10000001645 236
311 3300013306 Ga0163162_10001306 Ga0163162_100013068 236
312 3300014969 Ga0157376_10007182 Ga0157376_100071823 236
313 3300025903 Ga0207680_10130123 Ga0207680_101301231 236
314 3300025911 Ga0207654_10022428 Ga0207654_100224284 236
315 3300025912 Ga0207707_10153557 Ga0207707_101535572 236
316 3300025913 Ga0207695_10001216 Ga0207695_1000121615 236
317 3300025914 Ga0207671_10006310 Ga0207671_1000631012 236
318 3300025914 Ga0207671_10176455 Ga0207671_101764552 236
319 3300025924 Ga0207694_10248062 Ga0207694_102480621 236
320 3300025949 Ga0207667_10100746 Ga0207667_101007463 236
321 3300026041 Ga0207639_10248243 Ga0207639_102482433 236
322 3300026078 Ga0207702_10160260 Ga0207702_101602602 236
323 3300026142 Ga0207698_10293901 Ga0207698_102939012 236
324 3300028379 Ga0268266_10000065 Ga0268266_1000006562 236
325 3300028381 Ga0268264_10000011 Ga0268264_10000011200 236
326 3300031730 Ga0307516_10001871 Ga0307516_1000187116 236
327 3300046524 Ga0495648_0007147 Ga0495648_0007147_1184_1894 236
328 3300047443 Ga0495687_000001 Ga0495687_000001_1191943_1192653 236
329 3300049581 Ga0501047_0341119 Ga0501047_0341119_43_753 236
330 3300053092 Ga0500583_0140849 Ga0500583_0140849_146_856 236
331 3300053156 Ga0500622_0002252 Ga0500622_0002252_1464_2174 236
332 3300033180 Ga0307510_10008932 Ga0307510_100089323 237
333 3300046507 Ga0495606_0015722 Ga0495606_0015722_1976_2692 237
334 3300047472 Ga0495686_0000094 Ga0495686_0000094_128475_129194 237
335 3300003320 rootH2_10004858 rootH2_100048589 238
336 3300005456 Ga0070678_100031427 Ga0070678_1000314273 238
337 3300009093 Ga0105240_10000061 Ga0105240_1000006114 238
338 3300009093 Ga0105240_10000087 Ga0105240_100000874 238
339 3300009545 Ga0105237_10000377 Ga0105237_1000037728 238
340 3300009545 Ga0105237_10765004 Ga0105237_107650041 238
341 3300010375 Ga0105239_10108734 Ga0105239_101087345 238
342 3300013297 Ga0157378_10026764 Ga0157378_100267646 238
343 3300013308 Ga0157375_10573231 Ga0157375_105732312 238
344 3300014745 Ga0157377_10007983 Ga0157377_100079834 238
345 3300025913 Ga0207695_10000057 Ga0207695_10000057118 238
346 3300025913 Ga0207695_10003352 Ga0207695_1000335211 238
347 3300025913 Ga0207695_10068990 Ga0207695_100689905 238
348 3300025914 Ga0207671_10480392 Ga0207671_104803922 238
349 3300026041 Ga0207639_10020200 Ga0207639_100202004 238
350 3300031507 Ga0307509_10232850 Ga0307509_102328502 238
351 3300031824 Ga0307413_10220789 Ga0307413_102207892 238
352 3300031911 Ga0307412_10118640 Ga0307412_101186402 238
353 3300032002 Ga0307416_100232881 Ga0307416_1002328812 238
354 3300032126 Ga0307415_100168109 Ga0307415_1001681092 238
355 3300044765 Ga0466970_0040604 Ga0466970_0040604_25_753 238
356 3300049661 Ga0501217_083046 Ga0501217_083046_72_815 238
357 3300049663 Ga0501223_002673 Ga0501223_002673_746_1489 238
358 3300049669 Ga0501235_007792 Ga0501235_007792_669_1412 238
359 3300049705 Ga0501225_0018090 Ga0501225_0018090_949_1692 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

194

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9807 7 228
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9782 7 232
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9758 9 233
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9671 6 234
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9661 7 235
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9807 7 228 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9719 6 232 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9698 7 232 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 6 235 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 7 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H5S202-F1-model_v4 deleted 0.9887 8 230
AF-W4UY91-F1-model_v4 ABC transporter ATP-binding protein 0.9833 28 232 GO:0005524
GO:0016887
AF-A0A1Y4CW73-F1-model_v4 ABC transporter ATP-binding protein 0.9798 7 230 GO:0005524
GO:0016887
AF-A0A7Z1R278-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.978 7 238 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A522W8K2-F1-model_v4 ABC transporter ATP-binding protein 0.9775 4 230 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map