F421447

General Info

Members Datasets Scaffolds Average Seq Length
359 223 718 162

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100393434|Ga0070708_1003934342
Length 166
Sequence VRLGIIADTHGLLRPEVFEIFQDLDRILHAGDIGDLDLLAELEAIAPVTAVWGNTDGFDLRGRIPEVVETRIEGFDFLLIHGHQLGVPTPDKLNQAYPNAEVIIFGHTHKPVLTIVDQVVTVMNPGGAGPFRFGLPASVGIMELEPGIPPRARLVPLADPGDADDS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.19
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 20.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100393434 3300005445 Bacteria 1307
2 Ga0070676_10215203 3300005328 Bacteria 1266
3 Ga0068869_100023825 3300005334 Unclassified 4234
4 Ga0068869_100475721 3300005334 Unclassified 1039
5 Ga0070666_10087980 3300005335 Bacteria 2130
6 Ga0070680_100374732 3300005336 Bacteria 1211
7 Ga0070680_100492061 3300005336 Bacteria 1049
8 Ga0070680_100528281 3300005336 Bacteria 1010
9 Ga0070680_100877792 3300005336 Unclassified 773
10 Ga0070660_100408759 3300005339 Unclassified 1123
11 Ga0070689_100311101 3300005340 Bacteria 1313
12 Ga0070692_10282115 3300005345 Bacteria 1007
13 Ga0070668_100575427 3300005347 Bacteria 983
14 Ga0070669_100021379 3300005353 Unclassified 4623
15 Ga0070675_100439851 3300005354 Bacteria 1168
16 Ga0070674_100005022 3300005356 Bacteria 7599
17 Ga0070673_100951041 3300005364 Bacteria 798
18 Ga0070659_100457055 3300005366 Bacteria 1084
19 Ga0070667_100038599 3300005367 Unclassified 4004
20 Ga0070709_10001490 3300005434 Bacteria 12646
21 Ga0070701_10027414 3300005438 Bacteria 2790
22 Ga0070701_10727543 3300005438 Bacteria 670
23 Ga0070711_100739978 3300005439 Bacteria 830
24 Ga0070705_100004845 3300005440 Bacteria 6547
25 Ga0070705_100035504 3300005440 Bacteria 2795
26 Ga0070694_100040364 3300005444 Bacteria 3111
27 Ga0070708_100013032 3300005445 Bacteria 6795
28 Ga0070708_100050924 3300005445 Bacteria 3668
29 Ga0070708_100420432 3300005445 Bacteria 1261
30 Ga0070708_100948483 3300005445 Unclassified 807
31 Ga0070663_100905245 3300005455 Bacteria 762
32 Ga0070678_100165667 3300005456 Bacteria 1795
33 Ga0070662_100033361 3300005457 Unclassified 3624
34 Ga0070662_100186222 3300005457 Bacteria 1639
35 Ga0068867_100000139 3300005459 Bacteria 46718
36 Ga0068867_100116490 3300005459 Bacteria 2059
37 Ga0068867_100150363 3300005459 Bacteria 1828
38 Ga0070706_100002879 3300005467 Bacteria 17145
39 Ga0070706_100356106 3300005467 Bacteria 1364
40 Ga0070706_100491279 3300005467 Bacteria 1142
41 Ga0070706_100581603 3300005467 Bacteria 1041
42 Ga0070707_100001918 3300005468 Bacteria 19934
43 Ga0070707_100017849 3300005468 Bacteria 6671
44 Ga0070707_100023587 3300005468 Bacteria 5820
45 Ga0070707_100152274 3300005468 Bacteria 2252
46 Ga0070707_100168763 3300005468 Unclassified 2133
47 Ga0070707_100543165 3300005468 Bacteria 1124
48 Ga0070707_101070773 3300005468 Bacteria 772
49 Ga0070698_100005058 3300005471 Bacteria 14453
50 Ga0070698_100011821 3300005471 Bacteria 9263
51 Ga0070698_100077979 3300005471 Bacteria 3312
52 Ga0070698_100121664 3300005471 Bacteria 2569
53 Ga0070698_100177261 3300005471 Bacteria 2070
54 Ga0070698_100341027 3300005471 Unclassified 1430
55 Ga0070699_100000263 3300005518 Bacteria 50474
56 Ga0070699_100000532 3300005518 Bacteria 36038
57 Ga0070699_100007652 3300005518 Bacteria 9392
58 Ga0070699_100042913 3300005518 Bacteria 3914
59 Ga0070699_100355664 3300005518 Unclassified 1320
60 Ga0070699_100655782 3300005518 Bacteria 958
61 Ga0070697_100169320 3300005536 Bacteria 1848
62 Ga0070697_100303312 3300005536 Bacteria 1373
63 Ga0070697_100663236 3300005536 Bacteria 919
64 Ga0070697_100716492 3300005536 Bacteria 883
65 Ga0070672_100046269 3300005543 Unclassified 3371
66 Ga0070686_100239199 3300005544 Bacteria 1321
67 Ga0070695_100030457 3300005545 Bacteria 3361
68 Ga0070695_100275898 3300005545 Bacteria 1233
69 Ga0070695_100285201 3300005545 Bacteria 1215
70 Ga0070696_100002798 3300005546 Bacteria 11577
71 Ga0070696_100006651 3300005546 Bacteria 7723
72 Ga0070696_100042236 3300005546 Bacteria 3153
73 Ga0070696_100068083 3300005546 Bacteria 2499
74 Ga0070696_100105656 3300005546 Bacteria 2023
75 Ga0070696_100221051 3300005546 Bacteria 1421
76 Ga0070696_100321401 3300005546 Unclassified 1191
77 Ga0070693_100525509 3300005547 Bacteria 843
78 Ga0070665_100137508 3300005548 Bacteria 2446
79 Ga0070704_100043698 3300005549 Bacteria 3108
80 Ga0068855_100948057 3300005563 Bacteria 907
81 Ga0070664_100023284 3300005564 Bacteria 5115
82 Ga0070664_100129977 3300005564 Bacteria 2212
83 Ga0068857_100034709 3300005577 Bacteria 4461
84 Ga0068854_100389227 3300005578 Bacteria 1151
85 Ga0070702_100003757 3300005615 Bacteria 6852
86 Ga0070702_100055448 3300005615 Bacteria 2285
87 Ga0070702_100061164 3300005615 Bacteria 2192
88 Ga0068859_100046860 3300005617 Bacteria 4341
89 Ga0068859_100089931 3300005617 Bacteria 3121
90 Ga0068864_100000728 3300005618 Bacteria 27514
91 Ga0068864_100299963 3300005618 Unclassified 1504
92 Ga0068866_10007517 3300005718 Unclassified 4565
93 Ga0068861_101078992 3300005719 Bacteria 771
94 Ga0068870_10007408 3300005840 Bacteria 4888
95 Ga0068863_100597711 3300005841 Unclassified 1092
96 Ga0068863_101806123 3300005841 Bacteria 621
97 Ga0068858_100061320 3300005842 Bacteria 3477
98 Ga0068858_100123803 3300005842 Bacteria 2420
99 Ga0068860_100196869 3300005843 Unclassified 1952
100 Ga0068860_100634948 3300005843 Bacteria 1075
101 Ga0068862_100501364 3300005844 Bacteria 1152
102 Ga0068862_100726328 3300005844 Bacteria 964
103 Ga0081538_10026818 3300005981 Bacteria 4016
104 Ga0070712_100063680 3300006175 Bacteria 2612
105 Ga0075428_101128584 3300006844 Unclassified 827
106 Ga0075430_100152892 3300006846 Bacteria 1921
107 Ga0075430_101041852 3300006846 Unclassified 674
108 Ga0075431_100046930 3300006847 Bacteria 4454
109 Ga0075431_100050760 3300006847 Bacteria 4277
110 Ga0075431_100272737 3300006847 Bacteria 1714
111 Ga0075433_10153242 3300006852 Bacteria 2050
112 Ga0075429_100030294 3300006880 Bacteria 4700
113 Ga0075429_100187470 3300006880 Bacteria 1813
114 Ga0075429_100345212 3300006880 Unclassified 1303
115 Ga0075436_100016042 3300006914 Bacteria 5129
116 Ga0097620_100046862 3300006931 Bacteria 4341
117 Ga0097620_100089928 3300006931 Bacteria 3121
118 Ga0075435_100313724 3300007076 Bacteria 1342
119 Ga0099794_10089529 3300007265 Unclassified 1526
120 Ga0111539_10812531 3300009094 Unclassified 1088
121 Ga0114129_10436105 3300009147 Bacteria 1721
122 Ga0114129_11264551 3300009147 Unclassified 916
123 Ga0105243_10002056 3300009148 Bacteria 17077
124 Ga0105243_10990986 3300009148 Unclassified 842
125 Ga0105241_10031426 3300009174 Unclassified 3976
126 Ga0105242_10038055 3300009176 Bacteria 3866
127 Ga0105248_10029681 3300009177 Bacteria 6101
128 Ga0105237_10456234 3300009545 Bacteria 1284
129 Ga0105249_10068306 3300009553 Bacteria 3277
130 Ga0105239_10001440 3300010375 Bacteria 31706
131 Ga0105239_10769651 3300010375 Bacteria 1102
132 Ga0105246_10064977 3300011119 Bacteria 2551
133 Ga0157372_11124583 3300013307 Bacteria 908
134 Ga0157375_10796109 3300013308 Bacteria 1094
135 Ga0157375_11798573 3300013308 Bacteria 726
136 Ga0163163_10035191 3300014325 Bacteria 4856
137 Ga0163163_12200804 3300014325 Bacteria 611
138 Ga0157380_10015821 3300014326 Bacteria 5549
139 Ga0157379_10136088 3300014968 Unclassified 2214
140 Ga0157376_10605892 3300014969 Bacteria 1091
141 Ga0157376_12465544 3300014969 Bacteria 560
142 Ga0163161_10012974 3300017792 Bacteria 5789
143 Ga0207680_10089026 3300025903 Unclassified 1958
144 Ga0207699_10001440 3300025906 Bacteria 11290
145 Ga0207645_10015286 3300025907 Bacteria 5106
146 Ga0207645_10216463 3300025907 Bacteria 1262
147 Ga0207643_10035813 3300025908 Bacteria 2784
148 Ga0207643_10427925 3300025908 Bacteria 840
149 Ga0207684_10072445 3300025910 Bacteria 2926
150 Ga0207684_10258896 3300025910 Bacteria 1501
151 Ga0207654_10010840 3300025911 Unclassified 4641
152 Ga0207693_10061457 3300025915 Bacteria 2942
153 Ga0207663_10491612 3300025916 Bacteria 952
154 Ga0207660_10493575 3300025917 Bacteria 993
155 Ga0207649_10337343 3300025920 Unclassified 1112
156 Ga0207646_10011058 3300025922 Bacteria 8763
157 Ga0207646_10061617 3300025922 Bacteria 3348
158 Ga0207646_10138557 3300025922 Bacteria 2191
159 Ga0207646_10732562 3300025922 Unclassified 883
160 Ga0207681_10010463 3300025923 Bacteria 5677
161 Ga0207687_10085674 3300025927 Unclassified 2286
162 Ga0207690_10287780 3300025932 Bacteria 1282
163 Ga0207706_10000015 3300025933 Bacteria 174140
164 Ga0207706_10225471 3300025933 Bacteria 1640
165 Ga0207686_10000135 3300025934 Bacteria 58492
166 Ga0207670_10366798 3300025936 Bacteria 1144
167 Ga0207669_10022434 3300025937 Unclassified 3353
168 Ga0207704_10362428 3300025938 Bacteria 1132
169 Ga0207691_10407273 3300025940 Bacteria 1160
170 Ga0207711_10011820 3300025941 Bacteria 7254
171 Ga0207689_10002305 3300025942 Bacteria 17865
172 Ga0207689_10549333 3300025942 Bacteria 970
173 Ga0207667_10608095 3300025949 Bacteria 1102
174 Ga0207651_10561341 3300025960 Bacteria 994
175 Ga0207668_10454118 3300025972 Bacteria 1094
176 Ga0207640_10034977 3300025981 Unclassified 3140
177 Ga0207703_10008343 3300026035 Bacteria 8189
178 Ga0207703_10809785 3300026035 Unclassified 894
179 Ga0207639_10032949 3300026041 Bacteria 3819
180 Ga0207648_10000010 3300026089 Bacteria 202461
181 Ga0207648_10452159 3300026089 Bacteria 1170
182 Ga0207676_10001490 3300026095 Bacteria 17316
183 Ga0207676_10241920 3300026095 Unclassified 1619
184 Ga0207676_10243800 3300026095 Unclassified 1614
185 Ga0207674_10007389 3300026116 Bacteria 12799
186 Ga0207675_100090811 3300026118 Unclassified 2872
187 Ga0207675_100706247 3300026118 Bacteria 1018
188 Ga0207683_10154818 3300026121 Bacteria 2070
189 Ga0209966_1022774 3300027695 Bacteria 1227
190 Ga0268266_10100423 3300028379 Bacteria 2549
191 Ga0268265_10690960 3300028380 Unclassified 985
192 Ga0268265_11092793 3300028380 Bacteria 791
193 Ga0268264_11421482 3300028381 Bacteria 704
194 Ga0307408_100037997 3300031548 Bacteria 3395
195 Ga0307408_100872260 3300031548 Bacteria 822
196 Ga0316579_10002081 3300031691 Bacteria 7499
197 Ga0316576_10010648 3300031727 Bacteria 5988
198 Ga0316578_10000447 3300031728 Bacteria 13687
199 Ga0316577_10003606 3300031733 Bacteria 7851
200 Ga0307413_10271922 3300031824 Bacteria 1269
201 Ga0307413_10318919 3300031824 Unclassified 1186
202 Ga0307410_10068703 3300031852 Bacteria 2448
203 Ga0307410_10163712 3300031852 Unclassified 1669
204 Ga0307406_10116769 3300031901 Unclassified 1847
205 Ga0307406_10293495 3300031901 Bacteria 1246
206 Ga0307407_10088938 3300031903 Bacteria 1888
207 Ga0307407_11048326 3300031903 Bacteria 632
208 Ga0307412_10052501 3300031911 Unclassified 2700
209 Ga0307409_100727918 3300031995 Unclassified 994
210 Ga0307416_100105957 3300032002 Unclassified 2463
211 Ga0307416_101598475 3300032002 Bacteria 757
212 Ga0307414_10050598 3300032004 Bacteria 2879
213 Ga0307414_10235036 3300032004 Bacteria 1514
214 Ga0307411_10012053 3300032005 Bacteria 4697
215 Ga0307411_10215576 3300032005 Unclassified 1485
216 Ga0307411_10443485 3300032005 Bacteria 1084
217 Ga0307411_10479764 3300032005 Bacteria 1047
218 Ga0307415_100046244 3300032126 Unclassified 2923
219 Ga0307415_100395099 3300032126 Bacteria 1179
220 Ga0316585_10086623 3300032137 Unclassified 1022
221 Ga0316580_10004246 3300032139 Bacteria 4140
222 Ga0373948_0038055 3300034817 Unclassified 997
223 Ga0373959_0020028 3300034820 Unclassified 1273
224 Ga0373929_0005860 3300035085 Bacteria 2219
225 Ga0373929_0066485 3300035085 Unclassified 854
226 Ga0373940_0018315 3300035088 Bacteria 1756
227 Ga0373940_0049230 3300035088 Unclassified 1179
228 Ga0373951_0017275 3300035091 Bacteria 1632
229 Ga0373932_0055571 3300035112 Unclassified 1188
230 Ga0373939_0115330 3300035114 Unclassified 941
231 Ga0373941_0060723 3300035115 Unclassified 1229
232 Ga0373961_0046830 3300035241 Unclassified 1268
233 Ga0373962_0024823 3300035242 Unclassified 1606
234 Ga0316574_0074720 3300035398 Bacteria 2145
235 Ga0316574_0193199 3300035398 Bacteria 1309
236 Ga0373931_0015129 3300035691 Unclassified 3781
237 Ga0373931_0051964 3300035691 Bacteria 2184
238 Ga0373937_0502435 3300036401 Bacteria 1152
239 Ga0316582_0025698 3300036647 Bacteria 3538
240 Ga0316584_0000667 3300036712 Bacteria 18825
241 Ga0395900_1773811 3300037418 Unclassified 528
242 Ga0395905_0286500 3300037471 Bacteria 1534
243 Ga0395901_0565993 3300038443 Unclassified 1150
244 Ga0395901_1047954 3300038443 Bacteria 789
245 Ga0242420_015807 3300038996 Unclassified 1308
246 Ga0439439_0134600 3300041406 Unclassified 695
247 Ga0451800_1634569 3300041459 Bacteria 1212
248 Ga0451807_1969093 3300041486 Bacteria 754
249 Ga0451833_1502611 3300041491 Bacteria 871
250 Ga0439446_0027451 3300042156 Bacteria 1634
251 Ga0439446_0216261 3300042156 Unclassified 651
252 Ga0451577_0650730 3300042876 Bacteria 956
253 Ga0453683_0036321 3300044673 Bacteria 3101
254 Ga0453683_0371901 3300044673 Bacteria 919
255 Ga0451576_0034014 3300045051 Bacteria 5415
256 Ga0451576_0188112 3300045051 Bacteria 2156
257 Ga0451576_0242022 3300045051 Bacteria 1885
258 Ga0495603_0249710 3300046455 Bacteria 1021
259 Ga0495580_0978507 3300046472 Bacteria 540
260 Ga0495582_0021057 3300046473 Bacteria 3570
261 Ga0495639_0067691 3300046475 Bacteria 1645
262 Ga0495662_0031608 3300046476 Bacteria 2557
263 Ga0495594_0037302 3300046499 Bacteria 2651
264 Ga0495594_0398849 3300046499 Bacteria 783
265 Ga0495618_0266903 3300046514 Bacteria 1070
266 Ga0495630_0008508 3300046517 Bacteria 7366
267 Ga0495666_0000448 3300046526 Bacteria 18360
268 Ga0495665_0258137 3300046531 Bacteria 896
269 Ga0495640_0014767 3300046533 Bacteria 5899
270 Ga0495586_0014586 3300046535 Bacteria 4174
271 Ga0495634_0038596 3300046642 Bacteria 3255
272 Ga0495659_0041069 3300046664 Unclassified 1651
273 Ga0495657_0411448 3300046675 Bacteria 795
274 Ga0495647_0010293 3300046681 Bacteria 3183
275 Ga0495658_0000883 3300046683 Bacteria 16094
276 Ga0495613_0422183 3300046689 Bacteria 907
277 Ga0495674_0008579 3300047319 Bacteria 9728
278 Ga0495680_0057134 3300047322 Bacteria 3019
279 Ga0495680_0784650 3300047322 Bacteria 623
280 Ga0496100_0024436 3300048903 Bacteria 3686
281 Ga0496100_0322932 3300048903 Bacteria 1160
282 Ga0496101_0094347 3300048904 Bacteria 2230
283 Ga0496101_0201949 3300048904 Unclassified 1537
284 Ga0496102_0003752 3300048905 Bacteria 12841
285 Ga0496102_0052825 3300048905 Bacteria 3704
286 Ga0496103_0014892 3300048906 Bacteria 4623
287 Ga0496103_0135130 3300048906 Bacteria 1576
288 Ga0496104_0002832 3300048907 Bacteria 14969
289 Ga0496105_0062949 3300048908 Bacteria 3061
290 Ga0496106_0053552 3300048909 Bacteria 3048
291 Ga0496106_0650185 3300048909 Bacteria 842
292 Ga0496108_0000243 3300048911 Bacteria 48725
293 Ga0496108_0004500 3300048911 Bacteria 11230
294 Ga0496108_0008573 3300048911 Bacteria 8289
295 Ga0496109_0000477 3300048912 Bacteria 34049
296 Ga0496109_0012492 3300048912 Bacteria 7332
297 Ga0496109_0038248 3300048912 Bacteria 4337
298 Ga0496110_0001614 3300048913 Bacteria 16515
299 Ga0496110_0121831 3300048913 Bacteria 2350
300 Ga0496111_0008450 3300048914 Bacteria 6817
301 Ga0496112_0000563 3300048915 Bacteria 25479
302 Ga0496112_0000910 3300048915 Bacteria 21341
303 Ga0496112_0002695 3300048915 Bacteria 14360
304 Ga0496112_0234505 3300048915 Bacteria 1789
305 Ga0496113_0001107 3300048916 Bacteria 14603
306 Ga0496113_0002708 3300048916 Bacteria 10404
307 Ga0496113_0010286 3300048916 Bacteria 6182
308 Ga0496114_0423870 3300048917 Bacteria 1179
309 Ga0496115_0143297 3300048918 Bacteria 1971
310 Ga0496115_0251405 3300048918 Bacteria 1455
311 Ga0501034_0023156 3300049571 Bacteria 6330
312 Ga0501037_0320909 3300049573 Unclassified 1072
313 Ga0501043_0220795 3300049579 Unclassified 1466
314 Ga0501047_0300933 3300049581 Bacteria 1446
315 Ga0501068_0099252 3300049584 Bacteria 1804
316 Ga0501072_0214384 3300049588 Bacteria 1534
317 Ga0501074_0053600 3300049590 Bacteria 2909
318 Ga0501075_0267145 3300049591 Bacteria 1304
319 Ga0501075_1280057 3300049591 Bacteria 556
320 Ga0501076_0350553 3300049592 Bacteria 1212
321 Ga0501077_0618835 3300049593 Bacteria 696
322 Ga0501079_0092007 3300049741 Bacteria 2350
323 Ga0501080_0015006 3300049742 Bacteria 7136
324 Ga0501080_0080723 3300049742 Bacteria 3023
325 Ga0501080_0664308 3300049742 Bacteria 921
326 Ga0501081_0053629 3300049743 Bacteria 2784
327 Ga0501083_0088886 3300049744 Bacteria 2042
328 Ga0501035_0922234 3300049822 Unclassified 691
329 Ga0501044_0055511 3300049823 Bacteria 4068
330 Ga0501045_0452301 3300049824 Unclassified 955
331 nmdc:mga05p37_18006_c1 3300050507 Bacteria 8530
332 nmdc:mga05p37_596007_c1 3300050507 Bacteria 1248
333 nmdc:mga09592_12979_c1 3300050508 Bacteria 6798
334 nmdc:mga09592_733723_c1 3300050508 Bacteria 839
335 nmdc:mga09592_930469_c1 3300050508 Bacteria 729
336 nmdc:mga0qj67_128000_c1 3300050509 Bacteria 2055
337 nmdc:mga06r32_23007_c1 3300050510 Bacteria 5764
338 nmdc:mga06r32_78962_c1 3300050510 Bacteria 3200
339 nmdc:mga06r32_860094_c1 3300050510 Bacteria 865
340 nmdc:mga08y16_1453076_c1 3300050511 Bacteria 647
341 nmdc:mga0n895_1135661_c1 3300050512 Unclassified 757
342 nmdc:mga0n895_459213_c1 3300050512 Bacteria 1285
343 nmdc:mga0n895_495755_c1 3300050512 Bacteria 1231
344 nmdc:mga0n895_578693_c1 3300050512 Bacteria 1127
345 nmdc:mga0rr50_635113_c1 3300050513 Unclassified 911
346 nmdc:mga0rr50_99124_c2 3300050513 Bacteria 1065
347 nmdc:mga08x19_225993_c1 3300050514 Bacteria 1287
348 nmdc:mga08x19_31824_c1 3300050514 Bacteria 3322
349 nmdc:mga08x19_34307_c1 3300050514 Bacteria 3206
350 nmdc:mga0a205_288753_c1 3300050515 Unclassified 1515
351 nmdc:mga0a205_472455_c1 3300050515 Unclassified 1113
352 nmdc:mga0a205_748553_c1 3300050515 Unclassified 826
353 Ga0590071_000816 3300059421 Bacteria 8697
354 Ga0590071_001571 3300059421 Bacteria 5976
355 Ga0590074_003509 3300059423 Bacteria 2594
356 Ga0501082_0062598 3300060353 Unclassified 3203
357 Ga0501082_0560585 3300060353 Bacteria 999
358 Ga0501082_0949109 3300060353 Bacteria 752
359 Ga0501082_1937873 3300060353 Bacteria 514
360 Ga0070708_100393434
361 Ga0070676_10215203
362 Ga0068869_100023825
363 Ga0068869_100475721
364 Ga0070666_10087980
365 Ga0070680_100374732
366 Ga0070680_100492061
367 Ga0070680_100528281
368 Ga0070680_100877792
369 Ga0070660_100408759
370 Ga0070689_100311101
371 Ga0070692_10282115
372 Ga0070668_100575427
373 Ga0070669_100021379
374 Ga0070675_100439851
375 Ga0070674_100005022
376 Ga0070673_100951041
377 Ga0070659_100457055
378 Ga0070667_100038599
379 Ga0070709_10001490
380 Ga0070701_10027414
381 Ga0070701_10727543
382 Ga0070711_100739978
383 Ga0070705_100004845
384 Ga0070705_100035504
385 Ga0070694_100040364
386 Ga0070708_100013032
387 Ga0070708_100050924
388 Ga0070708_100420432
389 Ga0070708_100948483
390 Ga0070663_100905245
391 Ga0070678_100165667
392 Ga0070662_100033361
393 Ga0070662_100186222
394 Ga0068867_100000139
395 Ga0068867_100116490
396 Ga0068867_100150363
397 Ga0070706_100002879
398 Ga0070706_100356106
399 Ga0070706_100491279
400 Ga0070706_100581603
401 Ga0070707_100001918
402 Ga0070707_100017849
403 Ga0070707_100023587
404 Ga0070707_100152274
405 Ga0070707_100168763
406 Ga0070707_100543165
407 Ga0070707_101070773
408 Ga0070698_100005058
409 Ga0070698_100011821
410 Ga0070698_100077979
411 Ga0070698_100121664
412 Ga0070698_100177261
413 Ga0070698_100341027
414 Ga0070699_100000263
415 Ga0070699_100000532
416 Ga0070699_100007652
417 Ga0070699_100042913
418 Ga0070699_100355664
419 Ga0070699_100655782
420 Ga0070697_100169320
421 Ga0070697_100303312
422 Ga0070697_100663236
423 Ga0070697_100716492
424 Ga0070672_100046269
425 Ga0070686_100239199
426 Ga0070695_100030457
427 Ga0070695_100275898
428 Ga0070695_100285201
429 Ga0070696_100002798
430 Ga0070696_100006651
431 Ga0070696_100042236
432 Ga0070696_100068083
433 Ga0070696_100105656
434 Ga0070696_100221051
435 Ga0070696_100321401
436 Ga0070693_100525509
437 Ga0070665_100137508
438 Ga0070704_100043698
439 Ga0068855_100948057
440 Ga0070664_100023284
441 Ga0070664_100129977
442 Ga0068857_100034709
443 Ga0068854_100389227
444 Ga0070702_100003757
445 Ga0070702_100055448
446 Ga0070702_100061164
447 Ga0068859_100046860
448 Ga0068859_100089931
449 Ga0068864_100000728
450 Ga0068864_100299963
451 Ga0068866_10007517
452 Ga0068861_101078992
453 Ga0068870_10007408
454 Ga0068863_100597711
455 Ga0068863_101806123
456 Ga0068858_100061320
457 Ga0068858_100123803
458 Ga0068860_100196869
459 Ga0068860_100634948
460 Ga0068862_100501364
461 Ga0068862_100726328
462 Ga0081538_10026818
463 Ga0070712_100063680
464 Ga0075428_101128584
465 Ga0075430_100152892
466 Ga0075430_101041852
467 Ga0075431_100046930
468 Ga0075431_100050760
469 Ga0075431_100272737
470 Ga0075433_10153242
471 Ga0075429_100030294
472 Ga0075429_100187470
473 Ga0075429_100345212
474 Ga0075436_100016042
475 Ga0097620_100046862
476 Ga0097620_100089928
477 Ga0075435_100313724
478 Ga0099794_10089529
479 Ga0111539_10812531
480 Ga0114129_10436105
481 Ga0114129_11264551
482 Ga0105243_10002056
483 Ga0105243_10990986
484 Ga0105241_10031426
485 Ga0105242_10038055
486 Ga0105248_10029681
487 Ga0105237_10456234
488 Ga0105249_10068306
489 Ga0105239_10001440
490 Ga0105239_10769651
491 Ga0105246_10064977
492 Ga0157372_11124583
493 Ga0157375_10796109
494 Ga0157375_11798573
495 Ga0163163_10035191
496 Ga0163163_12200804
497 Ga0157380_10015821
498 Ga0157379_10136088
499 Ga0157376_10605892
500 Ga0157376_12465544
501 Ga0163161_10012974
502 Ga0207680_10089026
503 Ga0207699_10001440
504 Ga0207645_10015286
505 Ga0207645_10216463
506 Ga0207643_10035813
507 Ga0207643_10427925
508 Ga0207684_10072445
509 Ga0207684_10258896
510 Ga0207654_10010840
511 Ga0207693_10061457
512 Ga0207663_10491612
513 Ga0207660_10493575
514 Ga0207649_10337343
515 Ga0207646_10011058
516 Ga0207646_10061617
517 Ga0207646_10138557
518 Ga0207646_10732562
519 Ga0207681_10010463
520 Ga0207687_10085674
521 Ga0207690_10287780
522 Ga0207706_10000015
523 Ga0207706_10225471
524 Ga0207686_10000135
525 Ga0207670_10366798
526 Ga0207669_10022434
527 Ga0207704_10362428
528 Ga0207691_10407273
529 Ga0207711_10011820
530 Ga0207689_10002305
531 Ga0207689_10549333
532 Ga0207667_10608095
533 Ga0207651_10561341
534 Ga0207668_10454118
535 Ga0207640_10034977
536 Ga0207703_10008343
537 Ga0207703_10809785
538 Ga0207639_10032949
539 Ga0207648_10000010
540 Ga0207648_10452159
541 Ga0207676_10001490
542 Ga0207676_10241920
543 Ga0207676_10243800
544 Ga0207674_10007389
545 Ga0207675_100090811
546 Ga0207675_100706247
547 Ga0207683_10154818
548 Ga0209966_1022774
549 Ga0268266_10100423
550 Ga0268265_10690960
551 Ga0268265_11092793
552 Ga0268264_11421482
553 Ga0307408_100037997
554 Ga0307408_100872260
555 Ga0316579_10002081
556 Ga0316576_10010648
557 Ga0316578_10000447
558 Ga0316577_10003606
559 Ga0307413_10271922
560 Ga0307413_10318919
561 Ga0307410_10068703
562 Ga0307410_10163712
563 Ga0307406_10116769
564 Ga0307406_10293495
565 Ga0307407_10088938
566 Ga0307407_11048326
567 Ga0307412_10052501
568 Ga0307409_100727918
569 Ga0307416_100105957
570 Ga0307416_101598475
571 Ga0307414_10050598
572 Ga0307414_10235036
573 Ga0307411_10012053
574 Ga0307411_10215576
575 Ga0307411_10443485
576 Ga0307411_10479764
577 Ga0307415_100046244
578 Ga0307415_100395099
579 Ga0316585_10086623
580 Ga0316580_10004246
581 Ga0373948_0038055
582 Ga0373959_0020028
583 Ga0373929_0005860
584 Ga0373929_0066485
585 Ga0373940_0018315
586 Ga0373940_0049230
587 Ga0373951_0017275
588 Ga0373932_0055571
589 Ga0373939_0115330
590 Ga0373941_0060723
591 Ga0373961_0046830
592 Ga0373962_0024823
593 Ga0316574_0074720
594 Ga0316574_0193199
595 Ga0373931_0015129
596 Ga0373931_0051964
597 Ga0373937_0502435
598 Ga0316582_0025698
599 Ga0316584_0000667
600 Ga0395900_1773811
601 Ga0395905_0286500
602 Ga0395901_0565993
603 Ga0395901_1047954
604 Ga0242420_015807
605 Ga0439439_0134600
606 Ga0451800_1634569
607 Ga0451807_1969093
608 Ga0451833_1502611
609 Ga0439446_0027451
610 Ga0439446_0216261
611 Ga0451577_0650730
612 Ga0453683_0036321
613 Ga0453683_0371901
614 Ga0451576_0034014
615 Ga0451576_0188112
616 Ga0451576_0242022
617 Ga0495603_0249710
618 Ga0495580_0978507
619 Ga0495582_0021057
620 Ga0495639_0067691
621 Ga0495662_0031608
622 Ga0495594_0037302
623 Ga0495594_0398849
624 Ga0495618_0266903
625 Ga0495630_0008508
626 Ga0495666_0000448
627 Ga0495665_0258137
628 Ga0495640_0014767
629 Ga0495586_0014586
630 Ga0495634_0038596
631 Ga0495659_0041069
632 Ga0495657_0411448
633 Ga0495647_0010293
634 Ga0495658_0000883
635 Ga0495613_0422183
636 Ga0495674_0008579
637 Ga0495680_0057134
638 Ga0495680_0784650
639 Ga0496100_0024436
640 Ga0496100_0322932
641 Ga0496101_0094347
642 Ga0496101_0201949
643 Ga0496102_0003752
644 Ga0496102_0052825
645 Ga0496103_0014892
646 Ga0496103_0135130
647 Ga0496104_0002832
648 Ga0496105_0062949
649 Ga0496106_0053552
650 Ga0496106_0650185
651 Ga0496108_0000243
652 Ga0496108_0004500
653 Ga0496108_0008573
654 Ga0496109_0000477
655 Ga0496109_0012492
656 Ga0496109_0038248
657 Ga0496110_0001614
658 Ga0496110_0121831
659 Ga0496111_0008450
660 Ga0496112_0000563
661 Ga0496112_0000910
662 Ga0496112_0002695
663 Ga0496112_0234505
664 Ga0496113_0001107
665 Ga0496113_0002708
666 Ga0496113_0010286
667 Ga0496114_0423870
668 Ga0496115_0143297
669 Ga0496115_0251405
670 Ga0501034_0023156
671 Ga0501037_0320909
672 Ga0501043_0220795
673 Ga0501047_0300933
674 Ga0501068_0099252
675 Ga0501072_0214384
676 Ga0501074_0053600
677 Ga0501075_0267145
678 Ga0501075_1280057
679 Ga0501076_0350553
680 Ga0501077_0618835
681 Ga0501079_0092007
682 Ga0501080_0015006
683 Ga0501080_0080723
684 Ga0501080_0664308
685 Ga0501081_0053629
686 Ga0501083_0088886
687 Ga0501035_0922234
688 Ga0501044_0055511
689 Ga0501045_0452301
690 nmdc:mga05p37_18006_c1
691 nmdc:mga05p37_596007_c1
692 nmdc:mga09592_12979_c1
693 nmdc:mga09592_733723_c1
694 nmdc:mga09592_930469_c1
695 nmdc:mga0qj67_128000_c1
696 nmdc:mga06r32_23007_c1
697 nmdc:mga06r32_78962_c1
698 nmdc:mga06r32_860094_c1
699 nmdc:mga08y16_1453076_c1
700 nmdc:mga0n895_1135661_c1
701 nmdc:mga0n895_459213_c1
702 nmdc:mga0n895_495755_c1
703 nmdc:mga0n895_578693_c1
704 nmdc:mga0rr50_635113_c1
705 nmdc:mga0rr50_99124_c2
706 nmdc:mga08x19_225993_c1
707 nmdc:mga08x19_31824_c1
708 nmdc:mga08x19_34307_c1
709 nmdc:mga0a205_288753_c1
710 nmdc:mga0a205_472455_c1
711 nmdc:mga0a205_748553_c1
712 Ga0590071_000816
713 Ga0590071_001571
714 Ga0590074_003509
715 Ga0501082_0062598
716 Ga0501082_0560585
717 Ga0501082_0949109
718 Ga0501082_1937873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8648 1 146
5w8m-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.862 2 146
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8607 1 146
2a22-assembly1.cif.gz_A structure of vacuolar protein sorting 29 from cryptosporidium parvum 0.8524 2 154
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.8288 1 155
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8664 1 156 3.60.21.10
5w8mB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8648 1 146 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8612 1 156 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8584 1 156 3.60.21.10
2a22A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8524 2 154 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V7G369-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 1 1 116 GO:0016787
GO:0046872
AF-A0A2V7QF86-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9983 1 159 GO:0016787
GO:0046872
AF-A0A2V7G369-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9918 1 116 GO:0016787
GO:0046872
AF-A0A432UDC1-F1-model_v4 YfcE family phosphodiesterase 0.9901 1 65
AF-A0A1Q7JA50-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9898 21 117

Map