F421397

General Info

Members Datasets Scaffolds Average Seq Length
359 227 718 80

Family's Representative Sequence

Representative Sequence 3300004798|Ga0058859_11821800|Ga0058859_118218002
Length 84
Sequence MARVTVEDCLEKEENRFALVILASQRTRQIMKGARVLLDTHRHRNKPPVLSLREIAAGRVKFSRHSREAVEEYINDQKRRYGGV

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
189 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
205 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 6.41
Rhizosphere 81.06
Stem 0
Stem Tuber 0
Unclassified 17.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11821800 3300004798 Bacteria 514
2 rootH2_10039465 3300003320 Bacteria 2638
3 rootH1_10056238 3300003323 Bacteria 2264
4 Ga0070683_100230625 3300005329 Bacteria 1760
5 Ga0070683_100238138 3300005329 Bacteria 1731
6 Ga0068869_102158209 3300005334 Unclassified 501
7 Ga0070682_100000215 3300005337 Bacteria 42514
8 Ga0070682_100029534 3300005337 Bacteria 3302
9 Ga0070682_100066449 3300005337 Bacteria 2294
10 Ga0070682_100147422 3300005337 Bacteria 1611
11 Ga0070682_100190731 3300005337 Bacteria 1439
12 Ga0070682_100504480 3300005337 Unclassified 938
13 Ga0068868_100008433 3300005338 Bacteria 7380
14 Ga0070689_100079690 3300005340 Bacteria 2569
15 Ga0070689_100985647 3300005340 Bacteria 749
16 Ga0070689_101004377 3300005340 Bacteria 742
17 Ga0070689_101027296 3300005340 Bacteria 734
18 Ga0070689_101375316 3300005340 Bacteria 637
19 Ga0070691_10258546 3300005341 Bacteria 936
20 Ga0070687_100893578 3300005343 Unclassified 636
21 Ga0070692_10479336 3300005345 Bacteria 802
22 Ga0070668_101040451 3300005347 Bacteria 737
23 Ga0070675_100769952 3300005354 Bacteria 879
24 Ga0070688_100626143 3300005365 Bacteria 826
25 Ga0070667_100826015 3300005367 Bacteria 861
26 Ga0070714_100148351 3300005435 Bacteria 2111
27 Ga0070701_11082437 3300005438 Bacteria 563
28 Ga0070711_100325487 3300005439 Bacteria 1229
29 Ga0070708_102261837 3300005445 Bacteria 502
30 Ga0070663_100837755 3300005455 Bacteria 791
31 Ga0070678_100015185 3300005456 Bacteria 4887
32 Ga0068867_100197233 3300005459 Bacteria 1610
33 Ga0070685_10336523 3300005466 Bacteria 1028
34 Ga0070685_10882474 3300005466 Unclassified 664
35 Ga0070679_101511937 3300005530 Bacteria 618
36 Ga0068853_101087561 3300005539 Bacteria 771
37 Ga0070672_100087392 3300005543 Bacteria 2509
38 Ga0070672_101504091 3300005543 Unclassified 603
39 Ga0070672_101775737 3300005543 Bacteria 554
40 Ga0070693_100067620 3300005547 Unclassified 2095
41 Ga0070693_100495253 3300005547 Bacteria 866
42 Ga0070665_100588335 3300005548 Bacteria 1126
43 Ga0070704_100305204 3300005549 Bacteria 1328
44 Ga0070704_101466475 3300005549 Bacteria 627
45 Ga0068855_100000008 3300005563 Bacteria 269155
46 Ga0068855_100098842 3300005563 Bacteria 3361
47 Ga0068855_100790067 3300005563 Bacteria 1010
48 Ga0068855_101960981 3300005563 Bacteria 592
49 Ga0068856_100009406 3300005614 Bacteria 9492
50 Ga0068856_100016760 3300005614 Bacteria 7099
51 Ga0068856_100168010 3300005614 Bacteria 2205
52 Ga0068856_102371442 3300005614 Bacteria 538
53 Ga0068866_10631195 3300005718 Bacteria 727
54 Ga0068861_101453553 3300005719 Bacteria 671
55 Ga0068870_10199501 3300005840 Bacteria 1212
56 Ga0068870_10977176 3300005840 Unclassified 602
57 Ga0068863_100550913 3300005841 Bacteria 1139
58 Ga0068863_100698640 3300005841 Bacteria 1008
59 Ga0068863_101002583 3300005841 Unclassified 838
60 Ga0068863_102002572 3300005841 Bacteria 589
61 Ga0068858_100583400 3300005842 Unclassified 1084
62 Ga0070716_100504117 3300006173 Bacteria 893
63 Ga0075362_10439995 3300006177 Bacteria 661
64 Ga0075366_10054820 3300006195 Bacteria 2368
65 Ga0075366_10119468 3300006195 Bacteria 1588
66 Ga0097621_100032864 3300006237 Bacteria 4127
67 Ga0097621_100249096 3300006237 Bacteria 1555
68 Ga0068871_100074339 3300006358 Bacteria 2803
69 Ga0068871_100236228 3300006358 Bacteria 1588
70 Ga0068871_100991596 3300006358 Bacteria 782
71 Ga0068871_102213543 3300006358 Bacteria 524
72 Ga0068871_102253692 3300006358 Bacteria 519
73 Ga0075428_100496921 3300006844 Bacteria 1305
74 Ga0075431_100205599 3300006847 Bacteria 2013
75 Ga0075434_100709786 3300006871 Bacteria 1023
76 Ga0075435_101069537 3300007076 Bacteria 705
77 Ga0105240_10794200 3300009093 Bacteria 1026
78 Ga0105240_11365175 3300009093 Bacteria 746
79 Ga0105240_11468411 3300009093 Bacteria 715
80 Ga0111539_10139361 3300009094 Bacteria 2840
81 Ga0111539_10282225 3300009094 Unclassified 1932
82 Ga0111539_11944845 3300009094 Unclassified 682
83 Ga0105245_10001431 3300009098 Bacteria 21619
84 Ga0105247_10003509 3300009101 Bacteria 10208
85 Ga0114129_11074495 3300009147 Bacteria 1009
86 Ga0105241_10005509 3300009174 Bacteria 9365
87 Ga0105242_10024429 3300009176 Bacteria 4773
88 Ga0105242_10702058 3300009176 Unclassified 990
89 Ga0105238_11391532 3300009551 Unclassified 729
90 Ga0105238_12218519 3300009551 Bacteria 584
91 Ga0157327_1050127 3300012512 Bacteria 591
92 Ga0157370_10170377 3300013104 Bacteria 2024
93 Ga0157370_11067558 3300013104 Bacteria 730
94 Ga0157374_10949569 3300013296 Bacteria 878
95 Ga0157374_11387235 3300013296 Bacteria 725
96 Ga0157378_11527139 3300013297 Unclassified 713
97 Ga0163162_10540071 3300013306 Unclassified 1294
98 Ga0157375_13130588 3300013308 Bacteria 552
99 Ga0163163_11253742 3300014325 Bacteria 804
100 Ga0157380_10400217 3300014326 Bacteria 1302
101 Ga0157377_11415240 3300014745 Bacteria 549
102 Ga0157379_11643998 3300014968 Bacteria 628
103 Ga0157376_10150573 3300014969 Bacteria 2098
104 Ga0157376_10176785 3300014969 Bacteria 1948
105 Ga0157376_10400708 3300014969 Bacteria 1327
106 Ga0157376_11313346 3300014969 Bacteria 753
107 Ga0157376_11485163 3300014969 Bacteria 710
108 Ga0157376_12058977 3300014969 Bacteria 609
109 Ga0163161_10347956 3300017792 Bacteria 1177
110 Ga0207682_10034522 3300025893 Unclassified 2039
111 Ga0207710_10001687 3300025900 Bacteria 10709
112 Ga0207645_11102574 3300025907 Bacteria 535
113 Ga0207705_10351261 3300025909 Unclassified 1136
114 Ga0207654_10521436 3300025911 Bacteria 841
115 Ga0207695_10361000 3300025913 Bacteria 1339
116 Ga0207695_10780761 3300025913 Unclassified 835
117 Ga0207662_10437530 3300025918 Unclassified 892
118 Ga0207652_11805389 3300025921 Unclassified 516
119 Ga0207646_10328648 3300025922 Bacteria 1381
120 Ga0207694_11297570 3300025924 Bacteria 616
121 Ga0207687_10006319 3300025927 Bacteria 7832
122 Ga0207687_10322335 3300025927 Bacteria 1251
123 Ga0207686_10080823 3300025934 Bacteria 2120
124 Ga0207686_10251869 3300025934 Bacteria 1291
125 Ga0207670_10061241 3300025936 Bacteria 2568
126 Ga0207670_11106174 3300025936 Bacteria 669
127 Ga0207704_11331337 3300025938 Bacteria 614
128 Ga0207665_10787013 3300025939 Bacteria 751
129 Ga0207691_10058299 3300025940 Bacteria 3512
130 Ga0207691_11483890 3300025940 Bacteria 555
131 Ga0207661_10307981 3300025944 Bacteria 1421
132 Ga0207661_10922570 3300025944 Bacteria 804
133 Ga0207661_11078830 3300025944 Bacteria 739
134 Ga0207667_10000929 3300025949 Bacteria 37359
135 Ga0207667_10002474 3300025949 Bacteria 23034
136 Ga0207667_10874829 3300025949 Bacteria 892
137 Ga0207667_11082392 3300025949 Bacteria 785
138 Ga0207668_10171717 3300025972 Bacteria 1701
139 Ga0207668_11292620 3300025972 Bacteria 657
140 Ga0207677_10005200 3300026023 Bacteria 7045
141 Ga0207677_11309724 3300026023 Bacteria 665
142 Ga0207703_10541551 3300026035 Unclassified 1097
143 Ga0207703_10668553 3300026035 Bacteria 986
144 Ga0207703_11997146 3300026035 Bacteria 556
145 Ga0207708_11539070 3300026075 Bacteria 584
146 Ga0207702_10033811 3300026078 Bacteria 4272
147 Ga0207702_10333034 3300026078 Unclassified 1448
148 Ga0207702_10352518 3300026078 Bacteria 1408
149 Ga0207702_10440591 3300026078 Bacteria 1262
150 Ga0207702_12105087 3300026078 Bacteria 554
151 Ga0207641_10558712 3300026088 Unclassified 1117
152 Ga0207641_10857778 3300026088 Bacteria 900
153 Ga0207641_11030460 3300026088 Unclassified 820
154 Ga0207676_11045433 3300026095 Bacteria 806
155 Ga0207675_100797662 3300026118 Bacteria 957
156 Ga0207683_10019043 3300026121 Bacteria 5859
157 Ga0207698_11361773 3300026142 Bacteria 724
158 Ga0207428_10524454 3300027907 Bacteria 858
159 Ga0268266_10910602 3300028379 Bacteria 850
160 Ga0268264_10696553 3300028381 Unclassified 1009
161 Ga0265326_10027071 3300028558 Bacteria 1634
162 Ga0265326_10060380 3300028558 Unclassified 1072
163 Ga0265319_1108887 3300028563 Bacteria 867
164 Ga0265318_10000516 3300028577 Bacteria 27826
165 Ga0265318_10031829 3300028577 Bacteria 2043
166 Ga0307515_10415036 3300028794 Unclassified 968
167 Ga0307515_10477916 3300028794 Bacteria 859
168 Ga0265762_1163814 3300030760 Bacteria 537
169 Ga0265760_10256755 3300031090 Unclassified 607
170 Ga0265760_10327888 3300031090 Unclassified 545
171 Ga0265330_10000482 3300031235 Bacteria 26726
172 Ga0265332_10000571 3300031238 Bacteria 24514
173 Ga0265332_10011931 3300031238 Bacteria 3860
174 Ga0265328_10001246 3300031239 Bacteria 11790
175 Ga0265328_10125234 3300031239 Bacteria 960
176 Ga0265320_10001409 3300031240 Bacteria 17473
177 Ga0265320_10066180 3300031240 Bacteria 1713
178 Ga0265325_10005647 3300031241 Bacteria 7695
179 Ga0265325_10026201 3300031241 Bacteria 3161
180 Ga0265329_10001685 3300031242 Bacteria 10580
181 Ga0265329_10059680 3300031242 Bacteria 1208
182 Ga0265340_10000344 3300031247 Bacteria 24726
183 Ga0265340_10002532 3300031247 Bacteria 10385
184 Ga0265340_10012080 3300031247 Bacteria 4567
185 Ga0265339_10000919 3300031249 Bacteria 22657
186 Ga0265339_10001844 3300031249 Bacteria 15574
187 Ga0265331_10003305 3300031250 Bacteria 10474
188 Ga0265331_10443292 3300031250 Bacteria 583
189 Ga0265316_10000791 3300031344 Bacteria 34881
190 Ga0265316_10002326 3300031344 Bacteria 19875
191 Ga0265316_10002757 3300031344 Bacteria 17999
192 Ga0307513_10198229 3300031456 Bacteria 1851
193 Ga0307513_10306293 3300031456 Bacteria 1353
194 Ga0307509_10153664 3300031507 Bacteria 2212
195 Ga0307509_10651833 3300031507 Unclassified 722
196 Ga0265313_10001073 3300031595 Bacteria 26444
197 Ga0265313_10008515 3300031595 Bacteria 6800
198 Ga0307508_10001504 3300031616 Bacteria 26047
199 Ga0265314_10000003 3300031711 Bacteria 1653386
200 Ga0265314_10001522 3300031711 Bacteria 25602
201 Ga0265314_10126263 3300031711 Bacteria 1602
202 Ga0265342_10001363 3300031712 Bacteria 22843
203 Ga0265342_10129153 3300031712 Bacteria 1417
204 Ga0316576_10057294 3300031727 Bacteria 2847
205 Ga0316576_10302984 3300031727 Unclassified 1194
206 Ga0316576_10571222 3300031727 Bacteria 827
207 Ga0316578_10116034 3300031728 Bacteria 1609
208 Ga0316578_10180240 3300031728 Bacteria 1273
209 Ga0316578_10220947 3300031728 Unclassified 1139
210 Ga0307516_10002831 3300031730 Bacteria 22848
211 Ga0307406_10676249 3300031901 Bacteria 859
212 Ga0307407_10896211 3300031903 Bacteria 680
213 Ga0307407_11495620 3300031903 Bacteria 534
214 Ga0307412_10009364 3300031911 Bacteria 5618
215 Ga0307409_102221895 3300031995 Bacteria 578
216 Ga0307416_101841042 3300032002 Bacteria 709
217 Ga0307414_12312900 3300032004 Bacteria 502
218 Ga0307411_10971072 3300032005 Bacteria 759
219 Ga0307411_11660517 3300032005 Unclassified 591
220 Ga0307507_10076377 3300033179 Bacteria 2988
221 Ga0373936_0319402 3300035113 Bacteria 703
222 Ga0373957_0186681 3300035120 Bacteria 861
223 Ga0373955_0851394 3300035172 Unclassified 561
224 Ga0373931_0496413 3300035691 Bacteria 787
225 Ga0373935_0114550 3300035692 Bacteria 1794
226 Ga0316582_0026256 3300036647 Bacteria 3505
227 Ga0316584_0364207 3300036712 Bacteria 1036
228 Ga0373925_0036043 3300037068 Bacteria 3652
229 Ga0395905_0086228 3300037471 Bacteria 2943
230 Ga0395905_1839514 3300037471 Bacteria 511
231 Ga0400489_95161 3300039093 Bacteria 1094
232 Ga0436365_1930017 3300039437 Bacteria 1296
233 Ga0436361_1070679 3300039447 Bacteria 911
234 Ga0436363_1167837 3300039450 Bacteria 753
235 Ga0439465_0004838 3300041413 Bacteria 4326
236 Ga0439465_0095362 3300041413 Bacteria 1022
237 Ga0439465_0251983 3300041413 Bacteria 653
238 Ga0451787_182225 3300041441 Bacteria 501
239 Ga0451789_0007498 3300041443 Bacteria 573
240 Ga0451789_0393276 3300041443 Unclassified 1140
241 Ga0451791_0273572 3300041451 Bacteria 1366
242 Ga0451791_1335884 3300041451 Bacteria 950
243 Ga0451793_0832638 3300041452 Unclassified 983
244 Ga0451793_1715409 3300041452 Bacteria 561
245 Ga0451797_0497648 3300041453 Bacteria 1065
246 Ga0451797_1094222 3300041453 Unclassified 4770
247 Ga0451798_0838936 3300041458 Unclassified 648
248 Ga0451800_0323887 3300041459 Bacteria 514
249 Ga0451800_0331094 3300041459 Unclassified 526
250 Ga0451802_0448352 3300041460 Bacteria 723
251 Ga0451802_1471071 3300041460 Unclassified 514
252 Ga0451804_0370820 3300041463 Unclassified 841
253 Ga0451804_0674385 3300041463 Bacteria 509
254 Ga0451804_0981191 3300041463 Unclassified 583
255 Ga0451807_0098605 3300041486 Bacteria 612
256 Ga0451807_0296204 3300041486 Bacteria 5580
257 Ga0451807_1229572 3300041486 Bacteria 512
258 Ga0451807_1537688 3300041486 Bacteria 1121
259 Ga0451833_0004698 3300041491 Bacteria 609
260 Ga0451833_0724335 3300041491 Bacteria 1121
261 Ga0451833_1271340 3300041491 Bacteria 807
262 Ga0451833_1432599 3300041491 Unclassified 661
263 Ga0451835_0048492 3300041492 Bacteria 1112
264 Ga0451837_0547883 3300041494 Bacteria 1251
265 Ga0451837_1159450 3300041494 Bacteria 849
266 Ga0451837_1302236 3300041494 Unclassified 556
267 Ga0451839_0774756 3300041496 Bacteria 519
268 Ga0451841_0360853 3300041498 Bacteria 2965
269 Ga0451845_0153022 3300041501 Bacteria 1723
270 Ga0451849_1332403 3300041505 Bacteria 4317
271 Ga0451849_1441556 3300041505 Unclassified 575
272 Ga0451851_0808745 3300041507 Bacteria 763
273 Ga0451843_1338469 3300041509 Bacteria 985
274 Ga0451855_1730415 3300041511 Bacteria 542
275 Ga0451853_0242413 3300041512 Bacteria 12803
276 Ga0451853_1798584 3300041512 Unclassified 719
277 Ga0451853_3539394 3300041512 Bacteria 1014
278 Ga0451853_4108434 3300041512 Bacteria 549
279 Ga0439431_0051353 3300041997 Bacteria 1069
280 Ga0439445_0004115 3300042004 Bacteria 3285
281 Ga0439445_0068274 3300042004 Bacteria 980
282 Ga0439449_0113679 3300042007 Bacteria 1003
283 Ga0439454_085466 3300042011 Bacteria 577
284 Ga0439458_0007594 3300042157 Bacteria 2416
285 Ga0439434_0045520 3300042435 Bacteria 1353
286 Ga0451577_0812577 3300042876 Bacteria 844
287 Ga0451577_1623163 3300042876 Bacteria 570
288 Ga0453683_0449794 3300044673 Unclassified 833
289 Ga0453683_0487798 3300044673 Bacteria 799
290 Ga0466965_0913467 3300044683 Bacteria 512
291 Ga0466964_0786550 3300044706 Bacteria 537
292 Ga0466971_0284734 3300044719 Bacteria 791
293 Ga0466957_0865795 3300044842 Bacteria 644
294 Ga0466960_0034072 3300044901 Unclassified 2370
295 Ga0466959_0810016 3300045049 Bacteria 626
296 Ga0451576_0035902 3300045051 Bacteria 5257
297 Ga0451576_0273537 3300045051 Bacteria 1766
298 Ga0451576_0849631 3300045051 Bacteria 958
299 Ga0451576_1097400 3300045051 Bacteria 833
300 Ga0466967_1620226 3300045976 Bacteria 645
301 Ga0495592_0414969 3300046454 Unclassified 850
302 Ga0495625_0821903 3300046660 Bacteria 539
303 Ga0495657_0764336 3300046675 Unclassified 553
304 Ga0495674_1008389 3300047319 Bacteria 638
305 Ga0495680_0061527 3300047322 Bacteria 2888
306 Ga0495675_0698276 3300047444 Bacteria 568
307 Ga0496114_0147138 3300048917 Unclassified 2042
308 Ga0496114_0632654 3300048917 Bacteria 942
309 Ga0501294_025253 3300049517 Bacteria 666
310 Ga0501312_097679 3300049528 Unclassified 548
311 Ga0501314_045630 3300049530 Unclassified 520
312 Ga0501034_0014833 3300049571 Bacteria 8017
313 Ga0501034_0797524 3300049571 Bacteria 837
314 Ga0501039_0827801 3300049575 Bacteria 722
315 Ga0501047_0040559 3300049581 Bacteria 4502
316 Ga0501067_0021077 3300049583 Bacteria 3607
317 Ga0501068_0663250 3300049584 Bacteria 681
318 Ga0501071_0349507 3300049587 Bacteria 1125
319 Ga0501072_0399276 3300049588 Bacteria 1091
320 Ga0501073_0508971 3300049589 Bacteria 832
321 Ga0501073_0664690 3300049589 Unclassified 719
322 Ga0501074_0268872 3300049590 Bacteria 1212
323 Ga0501075_0067823 3300049591 Bacteria 2694
324 Ga0501076_0931506 3300049592 Bacteria 716
325 Ga0501077_0197353 3300049593 Unclassified 1278
326 Ga0501249_113182 3300049679 Bacteria 657
327 Ga0501255_066916 3300049684 Bacteria 581
328 Ga0501261_068410 3300049690 Bacteria 618
329 Ga0501225_0109182 3300049705 Bacteria 814
330 Ga0501225_0227019 3300049705 Bacteria 604
331 Ga0501080_0335810 3300049742 Bacteria 1366
332 Ga0501081_1052131 3300049743 Unclassified 615
333 Ga0501083_0803619 3300049744 Unclassified 612
334 Ga0501265_060866 3300049762 Bacteria 616
335 Ga0501035_0070834 3300049822 Bacteria 3088
336 Ga0501204_076797 3300049850 Bacteria 560
337 nmdc:mga03683_115269_c1 3300050489 Bacteria 714
338 nmdc:mga03683_499062_c1 3300050489 Bacteria 589
339 nmdc:mga0k408_718536_c1 3300050493 Bacteria 585
340 nmdc:mga0k408_8828_c1 3300050493 Bacteria 5424
341 nmdc:mga05p37_852700_c1 3300050507 Bacteria 989
342 nmdc:mga0qj67_909572_c1 3300050509 Unclassified 693
343 nmdc:mga06r32_536837_c1 3300050510 Bacteria 1144
344 nmdc:mga06r32_750398_c1 3300050510 Bacteria 939
345 nmdc:mga08y16_1673898_c1 3300050511 Unclassified 592
346 nmdc:mga08y16_460087_c1 3300050511 Bacteria 1297
347 nmdc:mga08y16_708839_c1 3300050511 Bacteria 1005
348 Ga0500635_0088994 3300053080 Bacteria 1120
349 Ga0500588_0226520 3300053146 Bacteria 698
350 Ga0500616_0410620 3300053153 Bacteria 539
351 Ga0501084_0251436 3300054114 Unclassified 1492
352 Ga0501084_0415036 3300054114 Unclassified 1138
353 Ga0501084_0492445 3300054114 Unclassified 1036
354 Ga0590071_015254 3300059421 Bacteria 1803
355 Ga0590075_048181 3300059424 Bacteria 1092
356 Ga0587071_219230 3300060344 Unclassified 505
357 Ga0501082_0021968 3300060353 Bacteria 5502
358 Ga0501082_1446544 3300060353 Bacteria 600
359 Ga0466962_0059223 3300061719 Bacteria 1828
360 Ga0058859_11821800
361 rootH2_10039465
362 rootH1_10056238
363 Ga0070683_100230625
364 Ga0070683_100238138
365 Ga0068869_102158209
366 Ga0070682_100000215
367 Ga0070682_100029534
368 Ga0070682_100066449
369 Ga0070682_100147422
370 Ga0070682_100190731
371 Ga0070682_100504480
372 Ga0068868_100008433
373 Ga0070689_100079690
374 Ga0070689_100985647
375 Ga0070689_101004377
376 Ga0070689_101027296
377 Ga0070689_101375316
378 Ga0070691_10258546
379 Ga0070687_100893578
380 Ga0070692_10479336
381 Ga0070668_101040451
382 Ga0070675_100769952
383 Ga0070688_100626143
384 Ga0070667_100826015
385 Ga0070714_100148351
386 Ga0070701_11082437
387 Ga0070711_100325487
388 Ga0070708_102261837
389 Ga0070663_100837755
390 Ga0070678_100015185
391 Ga0068867_100197233
392 Ga0070685_10336523
393 Ga0070685_10882474
394 Ga0070679_101511937
395 Ga0068853_101087561
396 Ga0070672_100087392
397 Ga0070672_101504091
398 Ga0070672_101775737
399 Ga0070693_100067620
400 Ga0070693_100495253
401 Ga0070665_100588335
402 Ga0070704_100305204
403 Ga0070704_101466475
404 Ga0068855_100000008
405 Ga0068855_100098842
406 Ga0068855_100790067
407 Ga0068855_101960981
408 Ga0068856_100009406
409 Ga0068856_100016760
410 Ga0068856_100168010
411 Ga0068856_102371442
412 Ga0068866_10631195
413 Ga0068861_101453553
414 Ga0068870_10199501
415 Ga0068870_10977176
416 Ga0068863_100550913
417 Ga0068863_100698640
418 Ga0068863_101002583
419 Ga0068863_102002572
420 Ga0068858_100583400
421 Ga0070716_100504117
422 Ga0075362_10439995
423 Ga0075366_10054820
424 Ga0075366_10119468
425 Ga0097621_100032864
426 Ga0097621_100249096
427 Ga0068871_100074339
428 Ga0068871_100236228
429 Ga0068871_100991596
430 Ga0068871_102213543
431 Ga0068871_102253692
432 Ga0075428_100496921
433 Ga0075431_100205599
434 Ga0075434_100709786
435 Ga0075435_101069537
436 Ga0105240_10794200
437 Ga0105240_11365175
438 Ga0105240_11468411
439 Ga0111539_10139361
440 Ga0111539_10282225
441 Ga0111539_11944845
442 Ga0105245_10001431
443 Ga0105247_10003509
444 Ga0114129_11074495
445 Ga0105241_10005509
446 Ga0105242_10024429
447 Ga0105242_10702058
448 Ga0105238_11391532
449 Ga0105238_12218519
450 Ga0157327_1050127
451 Ga0157370_10170377
452 Ga0157370_11067558
453 Ga0157374_10949569
454 Ga0157374_11387235
455 Ga0157378_11527139
456 Ga0163162_10540071
457 Ga0157375_13130588
458 Ga0163163_11253742
459 Ga0157380_10400217
460 Ga0157377_11415240
461 Ga0157379_11643998
462 Ga0157376_10150573
463 Ga0157376_10176785
464 Ga0157376_10400708
465 Ga0157376_11313346
466 Ga0157376_11485163
467 Ga0157376_12058977
468 Ga0163161_10347956
469 Ga0207682_10034522
470 Ga0207710_10001687
471 Ga0207645_11102574
472 Ga0207705_10351261
473 Ga0207654_10521436
474 Ga0207695_10361000
475 Ga0207695_10780761
476 Ga0207662_10437530
477 Ga0207652_11805389
478 Ga0207646_10328648
479 Ga0207694_11297570
480 Ga0207687_10006319
481 Ga0207687_10322335
482 Ga0207686_10080823
483 Ga0207686_10251869
484 Ga0207670_10061241
485 Ga0207670_11106174
486 Ga0207704_11331337
487 Ga0207665_10787013
488 Ga0207691_10058299
489 Ga0207691_11483890
490 Ga0207661_10307981
491 Ga0207661_10922570
492 Ga0207661_11078830
493 Ga0207667_10000929
494 Ga0207667_10002474
495 Ga0207667_10874829
496 Ga0207667_11082392
497 Ga0207668_10171717
498 Ga0207668_11292620
499 Ga0207677_10005200
500 Ga0207677_11309724
501 Ga0207703_10541551
502 Ga0207703_10668553
503 Ga0207703_11997146
504 Ga0207708_11539070
505 Ga0207702_10033811
506 Ga0207702_10333034
507 Ga0207702_10352518
508 Ga0207702_10440591
509 Ga0207702_12105087
510 Ga0207641_10558712
511 Ga0207641_10857778
512 Ga0207641_11030460
513 Ga0207676_11045433
514 Ga0207675_100797662
515 Ga0207683_10019043
516 Ga0207698_11361773
517 Ga0207428_10524454
518 Ga0268266_10910602
519 Ga0268264_10696553
520 Ga0265326_10027071
521 Ga0265326_10060380
522 Ga0265319_1108887
523 Ga0265318_10000516
524 Ga0265318_10031829
525 Ga0307515_10415036
526 Ga0307515_10477916
527 Ga0265762_1163814
528 Ga0265760_10256755
529 Ga0265760_10327888
530 Ga0265330_10000482
531 Ga0265332_10000571
532 Ga0265332_10011931
533 Ga0265328_10001246
534 Ga0265328_10125234
535 Ga0265320_10001409
536 Ga0265320_10066180
537 Ga0265325_10005647
538 Ga0265325_10026201
539 Ga0265329_10001685
540 Ga0265329_10059680
541 Ga0265340_10000344
542 Ga0265340_10002532
543 Ga0265340_10012080
544 Ga0265339_10000919
545 Ga0265339_10001844
546 Ga0265331_10003305
547 Ga0265331_10443292
548 Ga0265316_10000791
549 Ga0265316_10002326
550 Ga0265316_10002757
551 Ga0307513_10198229
552 Ga0307513_10306293
553 Ga0307509_10153664
554 Ga0307509_10651833
555 Ga0265313_10001073
556 Ga0265313_10008515
557 Ga0307508_10001504
558 Ga0265314_10000003
559 Ga0265314_10001522
560 Ga0265314_10126263
561 Ga0265342_10001363
562 Ga0265342_10129153
563 Ga0316576_10057294
564 Ga0316576_10302984
565 Ga0316576_10571222
566 Ga0316578_10116034
567 Ga0316578_10180240
568 Ga0316578_10220947
569 Ga0307516_10002831
570 Ga0307406_10676249
571 Ga0307407_10896211
572 Ga0307407_11495620
573 Ga0307412_10009364
574 Ga0307409_102221895
575 Ga0307416_101841042
576 Ga0307414_12312900
577 Ga0307411_10971072
578 Ga0307411_11660517
579 Ga0307507_10076377
580 Ga0373936_0319402
581 Ga0373957_0186681
582 Ga0373955_0851394
583 Ga0373931_0496413
584 Ga0373935_0114550
585 Ga0316582_0026256
586 Ga0316584_0364207
587 Ga0373925_0036043
588 Ga0395905_0086228
589 Ga0395905_1839514
590 Ga0400489_95161
591 Ga0436365_1930017
592 Ga0436361_1070679
593 Ga0436363_1167837
594 Ga0439465_0004838
595 Ga0439465_0095362
596 Ga0439465_0251983
597 Ga0451787_182225
598 Ga0451789_0007498
599 Ga0451789_0393276
600 Ga0451791_0273572
601 Ga0451791_1335884
602 Ga0451793_0832638
603 Ga0451793_1715409
604 Ga0451797_0497648
605 Ga0451797_1094222
606 Ga0451798_0838936
607 Ga0451800_0323887
608 Ga0451800_0331094
609 Ga0451802_0448352
610 Ga0451802_1471071
611 Ga0451804_0370820
612 Ga0451804_0674385
613 Ga0451804_0981191
614 Ga0451807_0098605
615 Ga0451807_0296204
616 Ga0451807_1229572
617 Ga0451807_1537688
618 Ga0451833_0004698
619 Ga0451833_0724335
620 Ga0451833_1271340
621 Ga0451833_1432599
622 Ga0451835_0048492
623 Ga0451837_0547883
624 Ga0451837_1159450
625 Ga0451837_1302236
626 Ga0451839_0774756
627 Ga0451841_0360853
628 Ga0451845_0153022
629 Ga0451849_1332403
630 Ga0451849_1441556
631 Ga0451851_0808745
632 Ga0451843_1338469
633 Ga0451855_1730415
634 Ga0451853_0242413
635 Ga0451853_1798584
636 Ga0451853_3539394
637 Ga0451853_4108434
638 Ga0439431_0051353
639 Ga0439445_0004115
640 Ga0439445_0068274
641 Ga0439449_0113679
642 Ga0439454_085466
643 Ga0439458_0007594
644 Ga0439434_0045520
645 Ga0451577_0812577
646 Ga0451577_1623163
647 Ga0453683_0449794
648 Ga0453683_0487798
649 Ga0466965_0913467
650 Ga0466964_0786550
651 Ga0466971_0284734
652 Ga0466957_0865795
653 Ga0466960_0034072
654 Ga0466959_0810016
655 Ga0451576_0035902
656 Ga0451576_0273537
657 Ga0451576_0849631
658 Ga0451576_1097400
659 Ga0466967_1620226
660 Ga0495592_0414969
661 Ga0495625_0821903
662 Ga0495657_0764336
663 Ga0495674_1008389
664 Ga0495680_0061527
665 Ga0495675_0698276
666 Ga0496114_0147138
667 Ga0496114_0632654
668 Ga0501294_025253
669 Ga0501312_097679
670 Ga0501314_045630
671 Ga0501034_0014833
672 Ga0501034_0797524
673 Ga0501039_0827801
674 Ga0501047_0040559
675 Ga0501067_0021077
676 Ga0501068_0663250
677 Ga0501071_0349507
678 Ga0501072_0399276
679 Ga0501073_0508971
680 Ga0501073_0664690
681 Ga0501074_0268872
682 Ga0501075_0067823
683 Ga0501076_0931506
684 Ga0501077_0197353
685 Ga0501249_113182
686 Ga0501255_066916
687 Ga0501261_068410
688 Ga0501225_0109182
689 Ga0501225_0227019
690 Ga0501080_0335810
691 Ga0501081_1052131
692 Ga0501083_0803619
693 Ga0501265_060866
694 Ga0501035_0070834
695 Ga0501204_076797
696 nmdc:mga03683_115269_c1
697 nmdc:mga03683_499062_c1
698 nmdc:mga0k408_718536_c1
699 nmdc:mga0k408_8828_c1
700 nmdc:mga05p37_852700_c1
701 nmdc:mga0qj67_909572_c1
702 nmdc:mga06r32_536837_c1
703 nmdc:mga06r32_750398_c1
704 nmdc:mga08y16_1673898_c1
705 nmdc:mga08y16_460087_c1
706 nmdc:mga08y16_708839_c1
707 Ga0500635_0088994
708 Ga0500588_0226520
709 Ga0500616_0410620
710 Ga0501084_0251436
711 Ga0501084_0415036
712 Ga0501084_0492445
713 Ga0590071_015254
714 Ga0590075_048181
715 Ga0587071_219230
716 Ga0501082_0021968
717 Ga0501082_1446544
718 Ga0466962_0059223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

8

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oqy-assembly1.cif.gz_K cryo-em structure of the cellular negative regulator tfs4 bound to the archaeal rna polymerase 0.9159 17 51
7dti-assembly1.cif.gz_A solution structure of the complex between rna polymerase subunit rpb6 and tfiih p62 ph domain 0.9027 19 57
6tut-assembly1.cif.gz_F cryo-em structure of the rna polymerase iii-maf1 complex 0.9023 20 59
7nvt-assembly1.cif.gz_F rna polymerase ii core pre-initiation complex with closed promoter dna in distal position 0.9009 20 59
7egc-assembly1.cif.gz_t p53-bound tfiid-based holo pic on hdm2 promoter 0.8995 20 59
ID Description Score Start End Superfamily
af_Q54FA8_8_133_3.90.940.10 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.9319 20 57 3.90.940.10
5flmF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8934 20 59 3.90.940.10
1sfoF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8871 16 59 3.90.940.10
1r9tF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8866 16 59 3.90.940.10
2nvsF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8846 20 59 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A257GTP1-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9961 16 57 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A1G0YMI4-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9928 18 58 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A661ISD9-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9925 17 58 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A534S2R1-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9881 16 61 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2N2AY77-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9757 16 57 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677

Map