F421324

General Info

Members Datasets Scaffolds Average Seq Length
358 232 716 275

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0104571|Ga0501068_0104571_201_1229
Length 334
Sequence MLTPKFTAKKLIGIFSLVAALAAGAGVAFAAAGHPEPWQMGLQQAVTPVMEDIVWFHDFLVYLIVAIAYVCIRFNAKANPVPSRTTHNTLIEVAWTVIPVLILVSIAVPSFRLLFLQLNVPAADLTIKATGKQWFWSYEYPDAKIAFDSVMVQDKDRKPDQPRLLAVDNEIVVPVNKVVRVQTIGADVIHAFAVPSFGIKIDAVPGRLNETWFKAEREGIYYGQCSELCGRDHAFMPIAVRVVNEQAYNAWLADAKKKFATDDSRPTNVASAEAGRQRKRLKVEGRRRWRIPRQLMAQRTMADTITPTLSRRDGAGLCTRRTTRTSERCTWCSP

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
55 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
57 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
193 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
194 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
195 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
196 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
197 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
198 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
199 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
200 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
201 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
202 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
203 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
204 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
205 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
206 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
207 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
208 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
209 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
210 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
211 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
212 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
213 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
214 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
215 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
216 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
217 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
218 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
219 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
220 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
221 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
222 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
223 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
224 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
225 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
226 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
227 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
228 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
229 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
230 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
231 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
232 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.55
Metatranscriptomes 0
Isolates 11.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 8.94
Rhizoplane 1.96
Rhizosphere 73.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0104571 3300049584 Bacteria 1757
2 JGI25406J46586_10003096 3300003203 Bacteria 7826
3 Ga0055539_1002154 3300003752 Bacteria 3159
4 JGI25405J52794_10000695 3300003911 Bacteria 5108
5 Ga0070680_100028238 3300005336 Bacteria 4498
6 Ga0070661_100063389 3300005344 Bacteria 2715
7 Ga0070668_100349062 3300005347 Bacteria 1252
8 Ga0070668_100461524 3300005347 Bacteria 1094
9 Ga0070671_100401826 3300005355 Bacteria 1172
10 Ga0070659_100139855 3300005366 Bacteria 1971
11 Ga0070711_100048714 3300005439 Bacteria 2899
12 Ga0070694_100145700 3300005444 Bacteria 1724
13 Ga0070663_100096480 3300005455 Bacteria 2199
14 Ga0070707_100273789 3300005468 Bacteria 1641
15 Ga0068853_100086409 3300005539 Bacteria 2750
16 Ga0070693_100050708 3300005547 Bacteria 2373
17 Ga0068863_100348107 3300005841 Bacteria 1442
18 Ga0081455_10004196 3300005937 Bacteria 16242
19 Ga0081455_10006772 3300005937 Bacteria 12227
20 Ga0081540_1005234 3300005983 Bacteria 9712
21 Ga0081540_1020458 3300005983 Bacteria 3978
22 Ga0081540_1021265 3300005983 Bacteria 3872
23 Ga0081539_10002458 3300005985 Bacteria 26103
24 Ga0075365_10374851 3300006038 Bacteria 1004
25 Ga0075363_100001938 3300006048 Bacteria 8204
26 Ga0070712_100082326 3300006175 Bacteria 2334
27 Ga0075362_10074443 3300006177 Bacteria 1556
28 Ga0075367_10034140 3300006178 Bacteria 2936
29 Ga0075366_10220757 3300006195 Bacteria 1155
30 Ga0075370_10026642 3300006353 Bacteria 3203
31 Ga0068865_100111746 3300006881 Bacteria 2017
32 Ga0068865_100148136 3300006881 Bacteria 1778
33 Ga0075435_100058965 3300007076 Bacteria 3110
34 Ga0105238_10042427 3300009551 Bacteria 4606
35 Ga0105238_10207956 3300009551 Bacteria 1933
36 Ga0157371_10142128 3300013102 Bacteria 1709
37 Ga0157374_10170133 3300013296 Bacteria 2125
38 Ga0157378_10123725 3300013297 Bacteria 2387
39 Ga0213876_10113260 3300021384 Bacteria 1440
40 Ga0209677_101472 3300025253 Bacteria 10154
41 Ga0209233_1028418 3300025261 Bacteria 1342
42 Ga0207699_10254750 3300025906 Bacteria 1211
43 Ga0207693_10004569 3300025915 Bacteria 11683
44 Ga0207693_10044297 3300025915 Bacteria 3498
45 Ga0207693_10107277 3300025915 Bacteria 2191
46 Ga0207663_10012606 3300025916 Bacteria 4577
47 Ga0207649_10143375 3300025920 Bacteria 1637
48 Ga0207694_10168458 3300025924 Bacteria 1772
49 Ga0207694_10224595 3300025924 Bacteria 1532
50 Ga0207665_10063845 3300025939 Bacteria 2502
51 Ga0207668_10230935 3300025972 Bacteria 1492
52 Ga0207678_10107429 3300026067 Bacteria 2381
53 Ga0207428_10000111 3300027907 Bacteria 111333
54 Ga0265338_10432222 3300028800 Bacteria 934
55 Ga0265332_10054588 3300031238 Bacteria 1714
56 Ga0265339_10016372 3300031249 Bacteria 4420
57 Ga0265313_10010448 3300031595 Bacteria 5867
58 Ga0265314_10000483 3300031711 Bacteria 52032
59 Ga0265342_10003627 3300031712 Bacteria 12570
60 Ga0307410_10027772 3300031852 Bacteria 3580
61 Ga0307412_10123559 3300031911 Bacteria 1868
62 Ga0307409_100178594 3300031995 Bacteria 1877
63 Ga0373950_0001695 3300034818 Bacteria 2919
64 Ga0373950_0003688 3300034818 Bacteria 2207
65 Ga0373923_0005858 3300035111 Bacteria 4198
66 Ga0373923_0011026 3300035111 Bacteria 3305
67 Ga0373941_0012712 3300035115 Bacteria 2207
68 Ga0373953_0121583 3300035117 Bacteria 1109
69 Ga0373954_0000513 3300035118 Bacteria 14519
70 Ga0373954_0008982 3300035118 Bacteria 4398
71 Ga0373956_0005132 3300035119 Bacteria 5241
72 Ga0373957_0027896 3300035120 Bacteria 2053
73 Ga0373943_0045765 3300035170 Bacteria 2134
74 Ga0373955_0164140 3300035172 Bacteria 1312
75 Ga0373924_0003192 3300035410 Bacteria 5609
76 Ga0373924_0033354 3300035410 Bacteria 2078
77 Ga0373927_0102601 3300035695 Bacteria 1861
78 Ga0373927_0131006 3300035695 Bacteria 1638
79 Ga0373933_0002620 3300035724 Bacteria 10085
80 Ga0373933_0009595 3300035724 Bacteria 5285
81 Ga0373947_0103134 3300035725 Bacteria 1795
82 Ga0373947_0278624 3300035725 Bacteria 1111
83 Ga0373937_0018635 3300036401 Bacteria 6201
84 Ga0373925_0093545 3300037068 Bacteria 2301
85 Ga0373925_0151332 3300037068 Bacteria 1822
86 Ga0373925_0169793 3300037068 Bacteria 1722
87 Ga0373925_0385810 3300037068 Bacteria 1141
88 Ga0395900_0015073 3300037418 Bacteria 7880
89 Ga0395905_0381903 3300037471 Bacteria 1302
90 Ga0436365_0078100 3300039437 Bacteria 1762
91 Ga0436365_0195611 3300039437 Bacteria 2831
92 Ga0436365_0965579 3300039437 Bacteria 2092
93 Ga0466969_0006302 3300044656 Bacteria 6311
94 Ga0466966_0001503 3300044684 Bacteria 14969
95 Ga0466961_0000042 3300044693 Bacteria 78589
96 Ga0466964_0023599 3300044706 Bacteria 2392
97 Ga0466957_0056143 3300044842 Bacteria 2407
98 Ga0466957_0077363 3300044842 Bacteria 2067
99 Ga0466959_0005150 3300045049 Bacteria 8908
100 Ga0466958_0063354 3300045836 Bacteria 2255
101 Ga0466967_0150644 3300045976 Bacteria 2174
102 Ga0466967_0263813 3300045976 Bacteria 1648
103 Ga0495592_0007898 3300046454 Bacteria 7978
104 Ga0495592_0016033 3300046454 Bacteria 5686
105 Ga0495592_0041192 3300046454 Bacteria 3461
106 Ga0495603_0034360 3300046455 Bacteria 3048
107 Ga0495629_0000388 3300046459 Bacteria 36900
108 Ga0495629_0267317 3300046459 Bacteria 1175
109 Ga0495638_0044267 3300046460 Bacteria 2804
110 Ga0495651_0020584 3300046462 Bacteria 5122
111 Ga0495651_0028908 3300046462 Bacteria 4322
112 Ga0495651_0043877 3300046462 Bacteria 3468
113 Ga0495653_0001549 3300046463 Bacteria 17954
114 Ga0495653_0032074 3300046463 Bacteria 4175
115 Ga0495582_0047026 3300046473 Bacteria 2376
116 Ga0495664_0012879 3300046477 Bacteria 4739
117 Ga0495664_0025440 3300046477 Bacteria 3446
118 Ga0495664_0035105 3300046477 Bacteria 2951
119 Ga0495664_0213799 3300046477 Bacteria 1168
120 Ga0495596_0079642 3300046500 Bacteria 1272
121 Ga0495606_0038954 3300046507 Bacteria 3210
122 Ga0495608_0022854 3300046511 Bacteria 4290
123 Ga0495608_0031845 3300046511 Bacteria 3564
124 Ga0495618_0009276 3300046514 Bacteria 5938
125 Ga0495628_0007516 3300046516 Bacteria 9428
126 Ga0495630_0120761 3300046517 Bacteria 1988
127 Ga0495652_0031655 3300046529 Bacteria 4630
128 Ga0495652_0033344 3300046529 Bacteria 4495
129 Ga0495652_0046435 3300046529 Bacteria 3729
130 Ga0495652_0179439 3300046529 Bacteria 1627
131 Ga0495652_0225574 3300046529 Bacteria 1405
132 Ga0495665_0208535 3300046531 Bacteria 1012
133 Ga0495640_0013361 3300046533 Bacteria 6238
134 Ga0495640_0026811 3300046533 Bacteria 4159
135 Ga0495640_0071602 3300046533 Bacteria 2326
136 Ga0495640_0091294 3300046533 Bacteria 2009
137 Ga0495640_0102397 3300046533 Bacteria 1879
138 Ga0495587_0088040 3300046536 Bacteria 1797
139 Ga0495587_0184664 3300046536 Bacteria 1181
140 Ga0495645_0035271 3300046543 Bacteria 3647
141 Ga0495645_0052348 3300046543 Bacteria 2970
142 Ga0495645_0087304 3300046543 Bacteria 2231
143 Ga0495645_0109804 3300046543 Bacteria 1952
144 Ga0495667_0009910 3300046559 Bacteria 6453
145 Ga0495667_0017339 3300046559 Bacteria 4865
146 Ga0495667_0189154 3300046559 Bacteria 1320
147 Ga0495634_0025847 3300046642 Bacteria 4101
148 Ga0495634_0274850 3300046642 Bacteria 1024
149 Ga0495625_0072594 3300046660 Bacteria 2413
150 Ga0495635_0001852 3300046663 Bacteria 14329
151 Ga0495635_0002268 3300046663 Bacteria 13069
152 Ga0495657_0006938 3300046675 Bacteria 8796
153 Ga0495657_0008970 3300046675 Bacteria 7609
154 Ga0495657_0036151 3300046675 Bacteria 3416
155 Ga0495657_0045802 3300046675 Bacteria 2965
156 Ga0495599_0008716 3300046678 Bacteria 6175
157 Ga0495599_0013915 3300046678 Bacteria 4979
158 Ga0495599_0028800 3300046678 Bacteria 3480
159 Ga0495623_0002666 3300046679 Bacteria 11783
160 Ga0495623_0003326 3300046679 Bacteria 10626
161 Ga0495623_0011181 3300046679 Bacteria 5807
162 Ga0495646_0011999 3300046680 Bacteria 5512
163 Ga0495646_0161612 3300046680 Bacteria 1239
164 Ga0495658_0150963 3300046683 Bacteria 1427
165 Ga0495613_0081815 3300046689 Bacteria 2346
166 Ga0495624_0232565 3300046690 Bacteria 1116
167 Ga0495649_0058219 3300046694 Bacteria 2082
168 Ga0495600_0004752 3300046809 Bacteria 8151
169 Ga0495600_0010639 3300046809 Bacteria 5716
170 Ga0495600_0132744 3300046809 Bacteria 1618
171 Ga0495604_0003538 3300047317 Bacteria 12454
172 Ga0495604_0025541 3300047317 Bacteria 4706
173 Ga0495604_0138493 3300047317 Bacteria 1741
174 Ga0495604_0206350 3300047317 Bacteria 1360
175 Ga0495674_0004199 3300047319 Bacteria 13881
176 Ga0495674_0025155 3300047319 Bacteria 5463
177 Ga0495674_0052417 3300047319 Bacteria 3590
178 Ga0495676_0004095 3300047321 Bacteria 13287
179 Ga0495680_0003892 3300047322 Bacteria 14446
180 Ga0495680_0010424 3300047322 Bacteria 8291
181 Ga0495680_0020224 3300047322 Bacteria 5606
182 Ga0495675_0006126 3300047444 Bacteria 7362
183 Ga0495675_0029450 3300047444 Bacteria 3502
184 Ga0495675_0047977 3300047444 Bacteria 2716
185 Ga0495684_0000161 3300047471 Bacteria 50269
186 Ga0495684_0152272 3300047471 Bacteria 1728
187 Ga0495593_0003583 3300047673 Bacteria 9277
188 Ga0495593_0167823 3300047673 Bacteria 1107
189 Ga0495602_0136102 3300048088 Bacteria 1951
190 Ga0495602_0258742 3300048088 Bacteria 1292
191 Ga0496101_0068982 3300048904 Bacteria 2586
192 Ga0496104_0036011 3300048907 Bacteria 4623
193 Ga0496105_0001348 3300048908 Bacteria 17233
194 Ga0496112_0146574 3300048915 Bacteria 2329
195 Ga0496113_0049035 3300048916 Bacteria 3144
196 Ga0496115_0055326 3300048918 Bacteria 3187
197 Ga0496115_0365834 3300048918 Bacteria 1174
198 Ga0496118_0103263 3300048921 Bacteria 1918
199 Ga0496119_0010848 3300048922 Bacteria 7619
200 Ga0496120_0045512 3300048923 Bacteria 2541
201 Ga0496121_0001462 3300048924 Bacteria 39875
202 Ga0496124_0066939 3300048927 Bacteria 2990
203 Ga0496124_0141492 3300048927 Bacteria 1898
204 Ga0496126_0011914 3300048929 Bacteria 8943
205 Ga0496126_0039326 3300048929 Bacteria 4389
206 Ga0496126_0043354 3300048929 Bacteria 4150
207 Ga0496126_0182903 3300048929 Bacteria 1779
208 Ga0496126_0185105 3300048929 Bacteria 1766
209 Ga0501031_0044496 3300049568 Bacteria 2897
210 Ga0501031_0056337 3300049568 Bacteria 2561
211 Ga0501032_0032971 3300049569 Bacteria 3549
212 Ga0501032_0122249 3300049569 Bacteria 1720
213 Ga0501032_0130171 3300049569 Bacteria 1660
214 Ga0501032_0142297 3300049569 Bacteria 1579
215 Ga0501033_0059323 3300049570 Bacteria 2825
216 Ga0501034_0000319 3300049571 Bacteria 84488
217 Ga0501034_0006473 3300049571 Bacteria 12613
218 Ga0501034_0009882 3300049571 Bacteria 9974
219 Ga0501034_0136448 3300049571 Bacteria 2434
220 Ga0501034_0502170 3300049571 Bacteria 1126
221 Ga0501034_0516601 3300049571 Bacteria 1106
222 Ga0501036_0000873 3300049572 Bacteria 22452
223 Ga0501036_0418292 3300049572 Bacteria 1117
224 Ga0501037_0029234 3300049573 Bacteria 4071
225 Ga0501037_0084823 3300049573 Bacteria 2293
226 Ga0501038_0023638 3300049574 Bacteria 5491
227 Ga0501038_0090662 3300049574 Bacteria 2561
228 Ga0501039_0021544 3300049575 Bacteria 4943
229 Ga0501040_0047152 3300049576 Bacteria 2942
230 Ga0501043_0004819 3300049579 Bacteria 10917
231 Ga0501046_0037546 3300049580 Bacteria 3892
232 Ga0501046_0139883 3300049580 Bacteria 1832
233 Ga0501046_0147429 3300049580 Bacteria 1776
234 Ga0501047_0000079 3300049581 Bacteria 122998
235 Ga0501047_0131098 3300049581 Bacteria 2387
236 Ga0501047_0145918 3300049581 Bacteria 2243
237 Ga0501047_0161500 3300049581 Bacteria 2112
238 Ga0501048_0002563 3300049582 Bacteria 13919
239 Ga0501048_0021133 3300049582 Bacteria 4766
240 Ga0501067_0041943 3300049583 Bacteria 2541
241 Ga0501067_0055397 3300049583 Bacteria 2197
242 Ga0501068_0017921 3300049584 Bacteria 4099
243 Ga0501069_0025934 3300049585 Bacteria 3207
244 Ga0501070_0038383 3300049586 Bacteria 3995
245 Ga0501070_0100764 3300049586 Bacteria 2389
246 Ga0501072_0041089 3300049588 Bacteria 3631
247 Ga0501072_0168774 3300049588 Bacteria 1746
248 Ga0501073_0012418 3300049589 Bacteria 6216
249 Ga0501073_0029471 3300049589 Bacteria 3921
250 Ga0501073_0229874 3300049589 Bacteria 1281
251 Ga0501074_0027093 3300049590 Bacteria 4153
252 Ga0501074_0075602 3300049590 Bacteria 2418
253 Ga0501079_0025402 3300049741 Bacteria 4544
254 Ga0501079_0064958 3300049741 Bacteria 2815
255 Ga0501080_0000069 3300049742 Bacteria 68222
256 Ga0501080_0124841 3300049742 Bacteria 2384
257 Ga0501080_0140342 3300049742 Bacteria 2234
258 Ga0501080_0161849 3300049742 Bacteria 2067
259 Ga0501081_0172409 3300049743 Bacteria 1562
260 Ga0501083_0003654 3300049744 Bacteria 10794
261 Ga0501083_0084493 3300049744 Bacteria 2101
262 Ga0501035_0172848 3300049822 Bacteria 1865
263 Ga0501035_0184617 3300049822 Bacteria 1795
264 Ga0501035_0221462 3300049822 Bacteria 1615
265 Ga0501035_0239157 3300049822 Bacteria 1545
266 Ga0501044_0021145 3300049823 Bacteria 6946
267 Ga0501044_0091299 3300049823 Bacteria 3072
268 Ga0501044_0187007 3300049823 Bacteria 2035
269 Ga0501045_0088785 3300049824 Bacteria 2283
270 nmdc:mga03683_61982_c1 3300050489 Bacteria 1583
271 nmdc:mga03n38_216799_c1 3300050490 Bacteria 997
272 nmdc:mga0yw44_305592_c1 3300050492 Bacteria 1066
273 nmdc:mga0k408_96065_c1 3300050493 Bacteria 1744
274 nmdc:mga06z11_100860_c1 3300050494 Bacteria 1584
275 nmdc:mga06z11_65605_c1 3300050494 Bacteria 1906
276 nmdc:mga07m45_137310_c1 3300050496 Bacteria 1416
277 nmdc:mga07m45_331046_c1 3300050496 Bacteria 885
278 nmdc:mga07m45_81693_c1 3300050496 Bacteria 1845
279 nmdc:mga05p37_59_c1 3300050507 Bacteria 95449
280 nmdc:mga09592_774_c1 3300050508 Bacteria 24689
281 nmdc:mga0qj67_339_c1 3300050509 Bacteria 32351
282 nmdc:mga06r32_252_c1 3300050510 Bacteria 44145
283 nmdc:mga08y16_95_c1 3300050511 Bacteria 74728
284 nmdc:mga0n895_16017_c1 3300050512 Bacteria 6866
285 nmdc:mga0n895_289264_c1 3300050512 Bacteria 1661
286 nmdc:mga0n895_56_c1 3300050512 Bacteria 65877
287 nmdc:mga0rr50_3376_c1 3300050513 Bacteria 9173
288 nmdc:mga0a205_23_c1 3300050515 Bacteria 88424
289 Ga0495601_0164085 3300053077 Bacteria 1452
290 Ga0495612_0007347 3300053078 Bacteria 4505
291 Ga0495655_0010656 3300053083 Bacteria 1821
292 Ga0495595_0012114 3300053084 Bacteria 3618
293 Ga0495595_0036839 3300053084 Bacteria 2221
294 Ga0495595_0107803 3300053084 Bacteria 1349
295 Ga0495619_0002220 3300053085 Bacteria 12845
296 Ga0495619_0171496 3300053085 Bacteria 1500
297 Ga0495619_0270686 3300053085 Bacteria 1177
298 Ga0500578_0115299 3300053086 Bacteria 1692
299 Ga0500644_0000501 3300053088 Bacteria 16934
300 Ga0500641_0047814 3300053096 Bacteria 1751
301 Ga0500641_0106340 3300053096 Bacteria 1206
302 Ga0500595_000001 3300053119 Bacteria 1088438
303 Ga0500595_043864 3300053119 Bacteria 1421
304 Ga0500597_047555 3300053120 Bacteria 1820
305 Ga0500614_069139 3300053123 Bacteria 966
306 Ga0500658_0053053 3300053134 Bacteria 1662
307 Ga0500604_0017315 3300053151 Bacteria 1993
308 Ga0500616_0000001 3300053153 Bacteria 1986011
309 Ga0500637_0039043 3300053178 Bacteria 2676
310 Ga0500645_000050 3300053730 Bacteria 99596
311 Ga0500552_012297 3300053733 Bacteria 1091
312 Ga0501084_0198004 3300054114 Bacteria 1695
313 Ga0501084_0208920 3300054114 Bacteria 1647
314 Ga0501082_0021918 3300060353 Bacteria 5507
315 Ga0501082_0023544 3300060353 Bacteria 5313
316 Ga0501082_0068616 3300060353 Bacteria 3052
317 Ga0466962_0044019 3300061719 Bacteria 2136
318 2507505755 2507262055 Bacteria 8048963
319 2508539949 2508501009 Bacteria 7784016
320 2508696015 2508501042 Bacteria 8719808
321 2515627722 2515154112 Bacteria 8294334
322 2524435578 2524023205 Bacteria 8918781
323 2643758547 2643221547 Bacteria 4740017
324 2745079833 2744054633 Bacteria 8678936
325 2824603587 2824600985 Bacteria 8488197
326 2824610978 2824609381 Bacteria 8672835
327 2824654030 2824653114 Bacteria 8493680
328 2842041571 2842038055 Bacteria 8002051
329 2842049613 2842045827 Bacteria 8006841
330 2857513176 2857509624 Bacteria 7472071
331 2874593789 2874590934 Bacteria 8299676
332 2874648028 2874645413 Bacteria 8214782
333 2876762357 2876761206 Bacteria 10111113
334 2876772014 2876771140 Bacteria 8287509
335 2876826391 2876818435 Bacteria 8274608
336 2879077576 2879074833 Bacteria 8279565
337 2879134343 2879127579 Bacteria 8294491
338 2879147300 2879142872 Bacteria 8267021
339 2888390116 2888388044 Bacteria 7304136
340 2888420937 2888419890 Bacteria 7857137
341 2935649204 2935648319 Bacteria 8801166
342 2935658024 2935656913 Bacteria 8965014
343 2935978387 2935975950 Bacteria 8347125
344 2935985482 2935984226 Bacteria 8302647
345 2936012243 2936011229 Bacteria 8801034
346 2936020676 2936019824 Bacteria 8804134
347 2936029536 2936028420 Bacteria 8965941
348 2936048140 2936046547 Bacteria 8903709
349 2936056749 2936055302 Bacteria 8785755
350 3005490946 3005483717 Bacteria 7877331
351 8016635079 8016630954 Bacteria 9217207
352 8019622145 8019619141 Bacteria 9218857
353 8019631167 8019629233 Bacteria 8687553
354 8019639453 8019638758 Bacteria 9062356
355 8019667975 8019659431 Bacteria 8577854
356 8019677395 8019668869 Bacteria 8791617
357 8019687557 8019678201 Bacteria 8863603
358 8056975519 8056967851 Bacteria 9038162
359 Ga0501068_0104571
360 JGI25406J46586_10003096
361 Ga0055539_1002154
362 JGI25405J52794_10000695
363 Ga0070680_100028238
364 Ga0070661_100063389
365 Ga0070668_100349062
366 Ga0070668_100461524
367 Ga0070671_100401826
368 Ga0070659_100139855
369 Ga0070711_100048714
370 Ga0070694_100145700
371 Ga0070663_100096480
372 Ga0070707_100273789
373 Ga0068853_100086409
374 Ga0070693_100050708
375 Ga0068863_100348107
376 Ga0081455_10004196
377 Ga0081455_10006772
378 Ga0081540_1005234
379 Ga0081540_1020458
380 Ga0081540_1021265
381 Ga0081539_10002458
382 Ga0075365_10374851
383 Ga0075363_100001938
384 Ga0070712_100082326
385 Ga0075362_10074443
386 Ga0075367_10034140
387 Ga0075366_10220757
388 Ga0075370_10026642
389 Ga0068865_100111746
390 Ga0068865_100148136
391 Ga0075435_100058965
392 Ga0105238_10042427
393 Ga0105238_10207956
394 Ga0157371_10142128
395 Ga0157374_10170133
396 Ga0157378_10123725
397 Ga0213876_10113260
398 Ga0209677_101472
399 Ga0209233_1028418
400 Ga0207699_10254750
401 Ga0207693_10004569
402 Ga0207693_10044297
403 Ga0207693_10107277
404 Ga0207663_10012606
405 Ga0207649_10143375
406 Ga0207694_10168458
407 Ga0207694_10224595
408 Ga0207665_10063845
409 Ga0207668_10230935
410 Ga0207678_10107429
411 Ga0207428_10000111
412 Ga0265338_10432222
413 Ga0265332_10054588
414 Ga0265339_10016372
415 Ga0265313_10010448
416 Ga0265314_10000483
417 Ga0265342_10003627
418 Ga0307410_10027772
419 Ga0307412_10123559
420 Ga0307409_100178594
421 Ga0373950_0001695
422 Ga0373950_0003688
423 Ga0373923_0005858
424 Ga0373923_0011026
425 Ga0373941_0012712
426 Ga0373953_0121583
427 Ga0373954_0000513
428 Ga0373954_0008982
429 Ga0373956_0005132
430 Ga0373957_0027896
431 Ga0373943_0045765
432 Ga0373955_0164140
433 Ga0373924_0003192
434 Ga0373924_0033354
435 Ga0373927_0102601
436 Ga0373927_0131006
437 Ga0373933_0002620
438 Ga0373933_0009595
439 Ga0373947_0103134
440 Ga0373947_0278624
441 Ga0373937_0018635
442 Ga0373925_0093545
443 Ga0373925_0151332
444 Ga0373925_0169793
445 Ga0373925_0385810
446 Ga0395900_0015073
447 Ga0395905_0381903
448 Ga0436365_0078100
449 Ga0436365_0195611
450 Ga0436365_0965579
451 Ga0466969_0006302
452 Ga0466966_0001503
453 Ga0466961_0000042
454 Ga0466964_0023599
455 Ga0466957_0056143
456 Ga0466957_0077363
457 Ga0466959_0005150
458 Ga0466958_0063354
459 Ga0466967_0150644
460 Ga0466967_0263813
461 Ga0495592_0007898
462 Ga0495592_0016033
463 Ga0495592_0041192
464 Ga0495603_0034360
465 Ga0495629_0000388
466 Ga0495629_0267317
467 Ga0495638_0044267
468 Ga0495651_0020584
469 Ga0495651_0028908
470 Ga0495651_0043877
471 Ga0495653_0001549
472 Ga0495653_0032074
473 Ga0495582_0047026
474 Ga0495664_0012879
475 Ga0495664_0025440
476 Ga0495664_0035105
477 Ga0495664_0213799
478 Ga0495596_0079642
479 Ga0495606_0038954
480 Ga0495608_0022854
481 Ga0495608_0031845
482 Ga0495618_0009276
483 Ga0495628_0007516
484 Ga0495630_0120761
485 Ga0495652_0031655
486 Ga0495652_0033344
487 Ga0495652_0046435
488 Ga0495652_0179439
489 Ga0495652_0225574
490 Ga0495665_0208535
491 Ga0495640_0013361
492 Ga0495640_0026811
493 Ga0495640_0071602
494 Ga0495640_0091294
495 Ga0495640_0102397
496 Ga0495587_0088040
497 Ga0495587_0184664
498 Ga0495645_0035271
499 Ga0495645_0052348
500 Ga0495645_0087304
501 Ga0495645_0109804
502 Ga0495667_0009910
503 Ga0495667_0017339
504 Ga0495667_0189154
505 Ga0495634_0025847
506 Ga0495634_0274850
507 Ga0495625_0072594
508 Ga0495635_0001852
509 Ga0495635_0002268
510 Ga0495657_0006938
511 Ga0495657_0008970
512 Ga0495657_0036151
513 Ga0495657_0045802
514 Ga0495599_0008716
515 Ga0495599_0013915
516 Ga0495599_0028800
517 Ga0495623_0002666
518 Ga0495623_0003326
519 Ga0495623_0011181
520 Ga0495646_0011999
521 Ga0495646_0161612
522 Ga0495658_0150963
523 Ga0495613_0081815
524 Ga0495624_0232565
525 Ga0495649_0058219
526 Ga0495600_0004752
527 Ga0495600_0010639
528 Ga0495600_0132744
529 Ga0495604_0003538
530 Ga0495604_0025541
531 Ga0495604_0138493
532 Ga0495604_0206350
533 Ga0495674_0004199
534 Ga0495674_0025155
535 Ga0495674_0052417
536 Ga0495676_0004095
537 Ga0495680_0003892
538 Ga0495680_0010424
539 Ga0495680_0020224
540 Ga0495675_0006126
541 Ga0495675_0029450
542 Ga0495675_0047977
543 Ga0495684_0000161
544 Ga0495684_0152272
545 Ga0495593_0003583
546 Ga0495593_0167823
547 Ga0495602_0136102
548 Ga0495602_0258742
549 Ga0496101_0068982
550 Ga0496104_0036011
551 Ga0496105_0001348
552 Ga0496112_0146574
553 Ga0496113_0049035
554 Ga0496115_0055326
555 Ga0496115_0365834
556 Ga0496118_0103263
557 Ga0496119_0010848
558 Ga0496120_0045512
559 Ga0496121_0001462
560 Ga0496124_0066939
561 Ga0496124_0141492
562 Ga0496126_0011914
563 Ga0496126_0039326
564 Ga0496126_0043354
565 Ga0496126_0182903
566 Ga0496126_0185105
567 Ga0501031_0044496
568 Ga0501031_0056337
569 Ga0501032_0032971
570 Ga0501032_0122249
571 Ga0501032_0130171
572 Ga0501032_0142297
573 Ga0501033_0059323
574 Ga0501034_0000319
575 Ga0501034_0006473
576 Ga0501034_0009882
577 Ga0501034_0136448
578 Ga0501034_0502170
579 Ga0501034_0516601
580 Ga0501036_0000873
581 Ga0501036_0418292
582 Ga0501037_0029234
583 Ga0501037_0084823
584 Ga0501038_0023638
585 Ga0501038_0090662
586 Ga0501039_0021544
587 Ga0501040_0047152
588 Ga0501043_0004819
589 Ga0501046_0037546
590 Ga0501046_0139883
591 Ga0501046_0147429
592 Ga0501047_0000079
593 Ga0501047_0131098
594 Ga0501047_0145918
595 Ga0501047_0161500
596 Ga0501048_0002563
597 Ga0501048_0021133
598 Ga0501067_0041943
599 Ga0501067_0055397
600 Ga0501068_0017921
601 Ga0501069_0025934
602 Ga0501070_0038383
603 Ga0501070_0100764
604 Ga0501072_0041089
605 Ga0501072_0168774
606 Ga0501073_0012418
607 Ga0501073_0029471
608 Ga0501073_0229874
609 Ga0501074_0027093
610 Ga0501074_0075602
611 Ga0501079_0025402
612 Ga0501079_0064958
613 Ga0501080_0000069
614 Ga0501080_0124841
615 Ga0501080_0140342
616 Ga0501080_0161849
617 Ga0501081_0172409
618 Ga0501083_0003654
619 Ga0501083_0084493
620 Ga0501035_0172848
621 Ga0501035_0184617
622 Ga0501035_0221462
623 Ga0501035_0239157
624 Ga0501044_0021145
625 Ga0501044_0091299
626 Ga0501044_0187007
627 Ga0501045_0088785
628 nmdc:mga03683_61982_c1
629 nmdc:mga03n38_216799_c1
630 nmdc:mga0yw44_305592_c1
631 nmdc:mga0k408_96065_c1
632 nmdc:mga06z11_100860_c1
633 nmdc:mga06z11_65605_c1
634 nmdc:mga07m45_137310_c1
635 nmdc:mga07m45_331046_c1
636 nmdc:mga07m45_81693_c1
637 nmdc:mga05p37_59_c1
638 nmdc:mga09592_774_c1
639 nmdc:mga0qj67_339_c1
640 nmdc:mga06r32_252_c1
641 nmdc:mga08y16_95_c1
642 nmdc:mga0n895_16017_c1
643 nmdc:mga0n895_289264_c1
644 nmdc:mga0n895_56_c1
645 nmdc:mga0rr50_3376_c1
646 nmdc:mga0a205_23_c1
647 Ga0495601_0164085
648 Ga0495612_0007347
649 Ga0495655_0010656
650 Ga0495595_0012114
651 Ga0495595_0036839
652 Ga0495595_0107803
653 Ga0495619_0002220
654 Ga0495619_0171496
655 Ga0495619_0270686
656 Ga0500578_0115299
657 Ga0500644_0000501
658 Ga0500641_0047814
659 Ga0500641_0106340
660 Ga0500595_000001
661 Ga0500595_043864
662 Ga0500597_047555
663 Ga0500614_069139
664 Ga0500658_0053053
665 Ga0500604_0017315
666 Ga0500616_0000001
667 Ga0500637_0039043
668 Ga0500645_000050
669 Ga0500552_012297
670 Ga0501084_0198004
671 Ga0501084_0208920
672 Ga0501082_0021918
673 Ga0501082_0023544
674 Ga0501082_0068616
675 Ga0466962_0044019
676 2507505755
677 2508539949
678 2508696015
679 2515627722
680 2524435578
681 2643758547
682 2745079833
683 2824603587
684 2824610978
685 2824654030
686 2842041571
687 2842049613
688 2857513176
689 2874593789
690 2874648028
691 2876762357
692 2876772014
693 2876826391
694 2879077576
695 2879134343
696 2879147300
697 2888390116
698 2888420937
699 2935649204
700 2935658024
701 2935978387
702 2935985482
703 2936012243
704 2936020676
705 2936029536
706 2936048140
707 2936056749
708 3005490946
709 8016635079
710 8019622145
711 8019631167
712 8019639453
713 8019667975
714 8019677395
715 8019687557
716 8056975519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

125

243

0.98

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

35

113

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4txv-assembly2.cif.gz_D crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) 0.9244 108 245
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9124 109 244
4txv-assembly2.cif.gz_D crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) 0.9046 108 245
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.8998 114 242
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.8969 114 242
ID Description Score Start End Superfamily
4txvD00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9244 108 245 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9075 109 242 2.60.40.420
4txvD00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9046 108 245 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9006 110 242 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8997 111 238 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A3D2M1U8-F1-model_v4 Cytochrome c oxidase subunit II 0.9277 110 240 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A538HQW4-F1-model_v4 Cytochrome aa3 subunit 2 0.9194 117 238 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A3D5Q8C6-F1-model_v4 Cytochrome c oxidase subunit II 0.9099 111 243 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A3D0PCB5-F1-model_v4 Cytochrome C oxidase subunit II 0.9095 114 240 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A6P0LXD7-F1-model_v4 Cytochrome c oxidase subunit II 0.909 114 246 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map