metagRoot

F421290

General Info

Members	Datasets	Scaffolds	Average Seq Length
358	269	332	166

Family's Representative Sequence

Representative Sequence	3300046660\|Ga0495625_0044838\|Ga0495625_0044838_1515_2078
Length	187
Sequence	MNLTTDTHMPFQLHQRKVLQWFLMLLAAVMLSACGFHMRGPANLPFKTIYLGFADNSQLGTELKRYIRTSGVEVVSDPTKAEAVLQVIADTREKKILTLNTSGRVREYSLYQRFSFLVKDNKGAILIPPANITLKRDITYDENQELAKQAEEALLYRDMQSDLVQQILRRLSASKTATAGTADAVEE

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
3	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
4	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
5	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
6	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
7	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
8	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
9	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
10	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
11	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
12	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
13	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
14	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
15	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
16	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
17	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
18	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
19	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
20	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
21	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
22	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
23	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
24	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
25	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
26	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
27	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
28	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
29	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
30	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
31	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
32	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
33	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
34	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
35	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
36	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
37	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
38	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
39	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
40	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
41	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
42	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
43	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
44	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
45	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
46	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
47	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
48	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
49	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
50	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
51	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
52	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
53	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
54	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
55	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
56	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
57	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
58	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
59	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
60	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
61	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
62	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
63	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
64	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
65	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
66	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
67	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
68	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
69	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
70	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
74	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
75	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
76	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
77	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
78	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
79	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
82	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
83	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
84	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
85	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
86	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
88	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
90	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
93	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
96	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
97	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
98	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
99	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
100	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
101	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
102	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
103	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
104	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
112	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
113	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
115	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
137	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
148	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
149	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
150	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
151	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
152	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
154	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
155	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
156	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
157	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
158	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
159	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
160	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
161	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
162	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
163	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
164	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
165	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
166	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
167	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
168	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
169	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
170	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
171	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
172	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
173	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
174	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
175	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
176	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
177	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
178	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
179	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
180	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
181	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
182	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
183	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
184	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
185	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
186	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
187	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
188	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
189	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
190	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
191	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
192	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
193	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
194	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
195	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
196	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
197	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
198	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
199	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
200	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
201	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
202	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
203	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
204	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
205	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
206	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
207	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
208	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
209	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
210	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
211	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
212	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
213	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
214	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
215	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
216	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
217	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
218	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
219	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
220	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
221	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
222	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
223	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
224	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
225	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
226	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
227	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
228	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
229	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
230	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
231	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
232	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
233	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
234	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
235	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
236	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
237	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
238	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
239	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
248	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
250	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
254	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
256	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
257	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
258	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
259	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
260	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
261	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
262	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
263	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
264	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
265	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
266	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
267	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
268	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
269	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.74
Metatranscriptomes	0
Isolates	7.26

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.59
Nodule	1.4
Rhizoplane	0
Rhizosphere	80.73
Stem	0
Stem Tuber	0
Unclassified	12.29

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_3843742	2162886007	Bacteria	1309
2	JGI25155J39150_1000088	3300002704	Bacteria	52122
3	JGI25155J39150_1000847	3300002704	Bacteria	4604
4	JGI25156J39149_1000146	3300002705	Bacteria	52120
5	JGI25156J39149_1005109	3300002705	Bacteria	3864
6	JGI25162J39368_1005406	3300002737	Bacteria	2528
7	JGI25154J39366_1000159	3300002738	Bacteria	52120
8	JGI25154J39366_1000301	3300002738	Bacteria	29380
9	JGI25157J39369_1000128	3300002741	Bacteria	64781
10	Ga0055538_1000010	3300003751	Bacteria	376599
11	Ga0055539_1000015	3300003752	Bacteria	376599
12	Ga0055533_1000018	3300003756	Bacteria	376599
13	Ga0055532_1000005	3300003758	Bacteria	458107
14	Ga0055525_1000020	3300003759	Bacteria	376599
15	Ga0055529_1024815	3300003763	Bacteria	741
16	Ga0055541_1000011	3300003841	Bacteria	376599
17	Ga0065704_10072503	3300005289	Bacteria	8415
18	Ga0065707_10499693	3300005295	Bacteria	750
19	Ga0070680_100064305	3300005336	Bacteria	3006
20	Ga0068868_101410030	3300005338	Bacteria	650
21	Ga0070689_100070137	3300005340	Bacteria	2735
22	Ga0070689_100108328	3300005340	Bacteria	2207
23	Ga0070689_100169419	3300005340	Bacteria	1769
24	Ga0070691_10026703	3300005341	Bacteria	2693
25	Ga0070687_101088405	3300005343	Bacteria	584
26	Ga0070692_10203619	3300005345	Bacteria	1161
27	Ga0070705_100266896	3300005440	Bacteria	1210
28	Ga0070705_100300447	3300005440	Bacteria	1150
29	Ga0070700_100115201	3300005441	Bacteria	1793
30	Ga0070694_100068647	3300005444	Bacteria	2436
31	Ga0070694_100146646	3300005444	Bacteria	1719
32	Ga0070694_100369455	3300005444	Bacteria	1116
33	Ga0070681_10000283	3300005458	Bacteria	40794
34	Ga0070681_10421292	3300005458	Bacteria	1247
35	Ga0068867_100506734	3300005459	Unclassified	1038
36	Ga0068867_101234280	3300005459	Bacteria	688
37	Ga0070707_101091568	3300005468	Bacteria	764
38	Ga0070699_100321819	3300005518	Bacteria	1390
39	Ga0070679_100349879	3300005530	Bacteria	1425
40	Ga0070684_100899931	3300005535	Bacteria	829
41	Ga0070686_100135242	3300005544	Bacteria	1709
42	Ga0070695_100047830	3300005545	Bacteria	2733
43	Ga0070695_100149034	3300005545	Bacteria	1631
44	Ga0070696_100117522	3300005546	Bacteria	1921
45	Ga0070696_100152031	3300005546	Bacteria	1700
46	Ga0070696_100163143	3300005546	Bacteria	1643
47	Ga0070693_100022544	3300005547	Bacteria	3350
48	Ga0070693_100319422	3300005547	Bacteria	1053
49	Ga0070693_100805348	3300005547	Unclassified	697
50	Ga0070704_100115849	3300005549	Bacteria	2048
51	Ga0070704_100565966	3300005549	Bacteria	995
52	Ga0070704_100904715	3300005549	Bacteria	794
53	Ga0068855_100000064	3300005563	Bacteria	130807
54	Ga0068855_100510914	3300005563	Bacteria	1305
55	Ga0068857_100272324	3300005577	Bacteria	1556
56	Ga0068857_100737221	3300005577	Bacteria	938
57	Ga0068854_100010525	3300005578	Bacteria	6002
58	Ga0068856_100046229	3300005614	Bacteria	4288
59	Ga0068856_100251390	3300005614	Bacteria	1783
60	Ga0070702_100177466	3300005615	Bacteria	1391
61	Ga0070702_100234711	3300005615	Bacteria	1234
62	Ga0068852_100161669	3300005616	Bacteria	2091
63	Ga0068859_100237680	3300005617	Bacteria	1911
64	Ga0068861_100374945	3300005719	Bacteria	1255
65	Ga0068851_10088341	3300005834	Bacteria	1629
66	Ga0097621_100444510	3300006237	Bacteria	1167
67	Ga0068871_100358175	3300006358	Bacteria	1292
68	Ga0075428_100370712	3300006844	Bacteria	1535
69	Ga0075430_100168325	3300006846	Bacteria	1823
70	Ga0075431_100053665	3300006847	Bacteria	4156
71	Ga0075431_100194942	3300006847	Bacteria	2074
72	Ga0075433_10587632	3300006852	Bacteria	978
73	Ga0075434_100121668	3300006871	Bacteria	2625
74	Ga0075429_100034510	3300006880	Bacteria	4397
75	Ga0075429_100059477	3300006880	Bacteria	3329
76	Ga0075436_100529018	3300006914	Bacteria	864
77	Ga0097620_100237679	3300006931	Bacteria	1911
78	Ga0079104_1005798	3300006946	Bacteria	4834
79	Ga0099794_10037543	3300007265	Bacteria	2294
80	Ga0099794_10091018	3300007265	Bacteria	1514
81	Ga0099794_10095229	3300007265	Bacteria	1481
82	Ga0105251_10058092	3300009011	Bacteria	1827
83	Ga0105244_10033147	3300009036	Bacteria	2726
84	Ga0105240_10003573	3300009093	Bacteria	24123
85	Ga0105240_10038912	3300009093	Bacteria	6096
86	Ga0111539_10663549	3300009094	Bacteria	1214
87	Ga0105245_10105626	3300009098	Bacteria	2612
88	Ga0114129_10062707	3300009147	Bacteria	5192
89	Ga0114129_12624013	3300009147	Bacteria	601
90	Ga0105243_11417418	3300009148	Bacteria	716
91	Ga0105242_10027028	3300009176	Bacteria	4551
92	Ga0105248_10503445	3300009177	Bacteria	1365
93	Ga0105237_10001496	3300009545	Bacteria	30781
94	Ga0105238_10000004	3300009551	Bacteria	390514
95	Ga0105239_10001696	3300010375	Bacteria	29043
96	Ga0105239_10292048	3300010375	Bacteria	1836
97	Ga0105246_10516282	3300011119	Bacteria	1017
98	Ga0157373_10124970	3300013100	Bacteria	1809
99	Ga0157369_10472773	3300013105	Bacteria	1297
100	Ga0157378_10838316	3300013297	Unclassified	947
101	Ga0182008_10220756	3300014497	Bacteria	970
102	Ga0182006_1057004	3300015261	Bacteria	1487
103	Ga0182007_10047404	3300015262	Bacteria	1421
104	Ga0213872_10018384	3300021361	Bacteria	3224
105	Ga0209435_100004	3300025206	Bacteria	633417
106	Ga0209435_100170	3300025206	Bacteria	19958
107	Ga0209784_100025	3300025224	Bacteria	376681
108	Ga0209566_100025	3300025225	Bacteria	376681
109	Ga0209674_100042	3300025226	Bacteria	376681
110	Ga0209147_100011	3300025229	Bacteria	702140
111	Ga0209563_100046	3300025230	Bacteria	376681
112	Ga0209437_100195	3300025233	Bacteria	121761
113	Ga0209258_100337	3300025242	Bacteria	69753
114	Ga0209646_1000032	3300025246	Bacteria	375315
115	Ga0209646_1000136	3300025246	Bacteria	121692
116	Ga0209026_1000128	3300025250	Bacteria	121958
117	Ga0209026_1001182	3300025250	Bacteria	12118
118	Ga0209677_100027	3300025253	Bacteria	376681
119	Ga0209759_1000126	3300025256	Bacteria	134208
120	Ga0209759_1000263	3300025256	Bacteria	75901
121	Ga0209455_1003705	3300025272	Bacteria	5290
122	Ga0207707_10000946	3300025912	Bacteria	27996
123	Ga0207695_10000670	3300025913	Bacteria	67451
124	Ga0207695_10008300	3300025913	Bacteria	13014
125	Ga0207671_10004515	3300025914	Bacteria	13242
126	Ga0207663_10444571	3300025916	Bacteria	999
127	Ga0207660_10060353	3300025917	Bacteria	2726
128	Ga0207652_10305313	3300025921	Bacteria	1436
129	Ga0207646_10055553	3300025922	Bacteria	3540
130	Ga0207694_10000021	3300025924	Bacteria	300246
131	Ga0207694_10194033	3300025924	Bacteria	1651
132	Ga0207687_10470740	3300025927	Bacteria	1045
133	Ga0207686_10150802	3300025934	Bacteria	1618
134	Ga0207670_10091679	3300025936	Bacteria	2149
135	Ga0207670_10596953	3300025936	Bacteria	906
136	Ga0207711_10422511	3300025941	Bacteria	1240
137	Ga0207667_10000019	3300025949	Bacteria	386233
138	Ga0207667_10167589	3300025949	Bacteria	2258
139	Ga0207667_10255425	3300025949	Bacteria	1793
140	Ga0207667_10324519	3300025949	Bacteria	1572
141	Ga0207640_10013213	3300025981	Bacteria	4727
142	Ga0207640_10233845	3300025981	Bacteria	1416
143	Ga0207708_10134855	3300026075	Bacteria	1933
144	Ga0207708_10518044	3300026075	Bacteria	1002
145	Ga0207702_10038133	3300026078	Bacteria	4025
146	Ga0207702_10244748	3300026078	Bacteria	1682
147	Ga0207641_10414651	3300026088	Bacteria	1296
148	Ga0207648_10556788	3300026089	Unclassified	1054
149	Ga0207648_10596196	3300026089	Bacteria	1018
150	Ga0207674_10152226	3300026116	Bacteria	2270
151	Ga0207674_10303166	3300026116	Bacteria	1546
152	Ga0207698_10006365	3300026142	Bacteria	7358
153	Ga0209281_1003939	3300027111	Bacteria	4616
154	Ga0209969_1001303	3300027360	Bacteria	3430
155	Ga0209967_1009838	3300027364	Bacteria	1328
156	Ga0209981_1004132	3300027378	Bacteria	1894
157	Ga0209996_1007750	3300027395	Bacteria	1401
158	Ga0209995_1019812	3300027471	Bacteria	1112
159	Ga0209970_1003034	3300027614	Bacteria	2831
160	Ga0209588_1059637	3300027671	Bacteria	1234
161	Ga0209588_1071665	3300027671	Bacteria	1119
162	Ga0209588_1085509	3300027671	Bacteria	1018
163	Ga0209971_1014392	3300027682	Bacteria	1875
164	Ga0209966_1001025	3300027695	Bacteria	5192
165	Ga0209998_10044580	3300027717	Bacteria	1014
166	Ga0265330_10210549	3300031235	Bacteria	821
167	Ga0265328_10276485	3300031239	Bacteria	646
168	Ga0307408_100154936	3300031548	Bacteria	1813
169	Ga0307408_100386205	3300031548	Bacteria	1198
170	Ga0265314_10328657	3300031711	Bacteria	848
171	Ga0307405_11512483	3300031731	Unclassified	590
172	Ga0307412_10293481	3300031911	Bacteria	1282
173	Ga0307409_100371766	3300031995	Bacteria	1356
174	Ga0307416_100060031	3300032002	Bacteria	3094
175	Ga0307416_100222561	3300032002	Bacteria	1811
176	Ga0307416_101021355	3300032002	Bacteria	930
177	Ga0307416_101063527	3300032002	Bacteria	913
178	Ga0307416_102178170	3300032002	Bacteria	656
179	Ga0307411_10299113	3300032005	Bacteria	1290
180	Ga0307411_11493024	3300032005	Bacteria	621
181	Ga0307415_100392081	3300032126	Bacteria	1183
182	Ga0373929_0069320	3300035085	Bacteria	841
183	Ga0373929_0115575	3300035085	Bacteria	690
184	Ga0373932_0105900	3300035112	Bacteria	921
185	Ga0373939_0017265	3300035114	Bacteria	1915
186	Ga0373939_0026692	3300035114	Bacteria	1630
187	Ga0373941_0006009	3300035115	Bacteria	2899
188	Ga0373953_0073459	3300035117	Bacteria	1414
189	Ga0373953_0513767	3300035117	Bacteria	531
190	Ga0373954_0000082	3300035118	Bacteria	33880
191	Ga0373960_0088321	3300035121	Bacteria	987
192	Ga0373960_0096213	3300035121	Bacteria	954
193	Ga0373955_0290695	3300035172	Bacteria	984
194	Ga0373961_0019402	3300035241	Bacteria	1786
195	Ga0373931_0018480	3300035691	Bacteria	3468
196	Ga0373933_0009744	3300035724	Bacteria	5257
197	Ga0373937_0000775	3300036401	Bacteria	27575
198	Ga0373937_0004931	3300036401	Bacteria	11342
199	Ga0373937_0104993	3300036401	Bacteria	2625
200	Ga0395905_0832243	3300037471	Bacteria	826
201	Ga0436361_0168473	3300039447	Bacteria	40970
202	Ga0439438_120556	3300041405	Bacteria	631
203	Ga0439439_0029787	3300041406	Bacteria	1386
204	Ga0439453_0000359	3300041408	Bacteria	4819
205	Ga0451839_0304072	3300041496	Bacteria	687
206	Ga0439431_0019293	3300041997	Bacteria	1620
207	Ga0439441_000461	3300042001	Bacteria	4370
208	Ga0439441_002779	3300042001	Bacteria	2501
209	Ga0439443_000357	3300042003	Bacteria	3854
210	Ga0439443_026287	3300042003	Bacteria	941
211	Ga0439450_051476	3300042008	Bacteria	979
212	Ga0439462_0005466	3300042015	Bacteria	3133
213	Ga0439446_0008053	3300042156	Bacteria	2787
214	Ga0439434_0026090	3300042435	Bacteria	1764
215	Ga0439435_0000035	3300042436	Bacteria	14825
216	Ga0439435_0000052	3300042436	Bacteria	13303
217	Ga0439435_0206580	3300042436	Bacteria	649
218	Ga0439444_0001257	3300042437	Bacteria	3227
219	Ga0439444_0002651	3300042437	Bacteria	2466
220	Ga0439460_0000009	3300042461	Bacteria	28778
221	Ga0439460_0006828	3300042461	Bacteria	2841
222	Ga0450916_025295	3300042530	Unclassified	838
223	Ga0453683_0041914	3300044673	Bacteria	2875
224	Ga0466965_0067748	3300044683	Bacteria	1792
225	Ga0466964_0144270	3300044706	Bacteria	1097
226	Ga0453684_0192697	3300044712	Bacteria	2383
227	Ga0451576_0110092	3300045051	Bacteria	2866
228	Ga0466967_0055778	3300045976	Bacteria	3481
229	Ga0495592_0005295	3300046454	Bacteria	9508
230	Ga0495629_0146829	3300046459	Bacteria	1640
231	Ga0495641_0112876	3300046461	Bacteria	1212
232	Ga0495653_0102677	3300046463	Bacteria	2069
233	Ga0495639_0084810	3300046475	Bacteria	1480
234	Ga0495662_0021336	3300046476	Bacteria	3131
235	Ga0495608_0003204	3300046511	Bacteria	11712
236	Ga0495618_0009802	3300046514	Bacteria	5792
237	Ga0495628_0007192	3300046516	Bacteria	9638
238	Ga0495630_0031592	3300046517	Bacteria	3943
239	Ga0495666_0070769	3300046526	Bacteria	1658
240	Ga0495642_0036485	3300046528	Bacteria	1987
241	Ga0495652_0067319	3300046529	Bacteria	3003
242	Ga0495640_0004188	3300046533	Bacteria	11530
243	Ga0495640_0018725	3300046533	Bacteria	5124
244	Ga0495586_0000095	3300046535	Bacteria	53876
245	Ga0495586_0038828	3300046535	Bacteria	2559
246	Ga0495587_0006538	3300046536	Bacteria	7593
247	Ga0495598_0163370	3300046537	Bacteria	785
248	Ga0495598_0180528	3300046537	Bacteria	753
249	Ga0495645_0037130	3300046543	Bacteria	3550
250	Ga0495667_0008455	3300046559	Bacteria	6986
251	Ga0495634_0012612	3300046642	Bacteria	6118
252	Ga0495625_0044838	3300046660	Bacteria	3199
253	Ga0495635_0020841	3300046663	Bacteria	4566
254	Ga0495599_0013749	3300046678	Bacteria	5006
255	Ga0495647_0211987	3300046681	Bacteria	852
256	Ga0495658_0018189	3300046683	Bacteria	3648
257	Ga0495669_0039912	3300046684	Bacteria	2080
258	Ga0495613_0001809	3300046689	Bacteria	16244
259	Ga0495624_0007096	3300046690	Bacteria	7887
260	Ga0495600_0006194	3300046809	Bacteria	7254
261	Ga0495581_0052186	3300047315	Bacteria	2362
262	Ga0495604_0006750	3300047317	Bacteria	9103
263	Ga0495604_0548937	3300047317	Bacteria	745
264	Ga0495636_0011601	3300047318	Bacteria	3489
265	Ga0495674_0089800	3300047319	Bacteria	2626
266	Ga0495674_0163159	3300047319	Bacteria	1863
267	Ga0495680_0015316	3300047322	Bacteria	6616
268	Ga0495680_0520204	3300047322	Bacteria	805
269	Ga0495675_0103474	3300047444	Bacteria	1780
270	Ga0495684_0013539	3300047471	Bacteria	6278
271	Ga0495593_0112304	3300047673	Bacteria	1391
272	Ga0495593_0197899	3300047673	Bacteria	1010
273	Ga0496116_0094869	3300048919	Bacteria	1802
274	Ga0496116_0249604	3300048919	Bacteria	884
275	Ga0496117_0240034	3300048920	Bacteria	996
276	Ga0496118_0186265	3300048921	Bacteria	1247
277	Ga0496121_0226983	3300048924	Bacteria	1310
278	Ga0496121_0356111	3300048924	Bacteria	973
279	Ga0496122_0000121	3300048925	Bacteria	181589
280	Ga0496122_0013733	3300048925	Bacteria	7897
281	Ga0496123_0001760	3300048926	Bacteria	28581
282	Ga0496123_0010922	3300048926	Bacteria	7947
283	Ga0496124_0290878	3300048927	Bacteria	1186
284	Ga0496125_0001066	3300048928	Bacteria	42369
285	Ga0496125_0005380	3300048928	Bacteria	14274
286	Ga0496125_0190552	3300048928	Bacteria	1354
287	Ga0496126_0319929	3300048929	Bacteria	1275
288	Ga0501298_008445	3300049521	Bacteria	1731
289	Ga0501298_016113	3300049521	Bacteria	1352
290	Ga0501031_0060082	3300049568	Bacteria	2477
291	Ga0501033_0203085	3300049570	Unclassified	1415
292	Ga0501040_0046728	3300049576	Bacteria	2955
293	Ga0501040_0641506	3300049576	Bacteria	767
294	Ga0501041_0143925	3300049577	Bacteria	1487
295	Ga0501041_0232289	3300049577	Bacteria	1158
296	Ga0501042_0030647	3300049578	Bacteria	3801
297	Ga0501068_0199991	3300049584	Bacteria	1267
298	Ga0501071_0976607	3300049587	Bacteria	654
299	Ga0501074_0731605	3300049590	Bacteria	698
300	Ga0501075_0700566	3300049591	Bacteria	772
301	Ga0501076_0293523	3300049592	Bacteria	1332
302	Ga0501225_0188367	3300049705	Bacteria	649
303	Ga0501079_0804799	3300049741	Bacteria	740
304	Ga0501080_0106257	3300049742	Bacteria	2602
305	Ga0501080_0921604	3300049742	Bacteria	761
306	Ga0501081_0164821	3300049743	Bacteria	1598
307	Ga0501081_0214679	3300049743	Bacteria	1398
308	Ga0501283_009860	3300049779	Bacteria	1399
309	Ga0501045_0655232	3300049824	Bacteria	776
310	nmdc:mga05p37_80424_c1	3300050507	Bacteria	4014
311	nmdc:mga09592_153172_c1	3300050508	Bacteria	1989
312	nmdc:mga09592_3356_c1	3300050508	Bacteria	12947
313	nmdc:mga0qj67_119557_c1	3300050509	Bacteria	2131
314	nmdc:mga0qj67_248526_c1	3300050509	Bacteria	1443
315	nmdc:mga0qj67_95564_c1	3300050509	Bacteria	2392
316	nmdc:mga06r32_14966_c1	3300050510	Bacteria	7042
317	nmdc:mga06r32_26957_c1	3300050510	Bacteria	5362
318	nmdc:mga08y16_124107_c1	3300050511	Bacteria	2686
319	nmdc:mga08y16_88633_c1	3300050511	Bacteria	3224
320	nmdc:mga0n895_163599_c1	3300050512	Bacteria	2257
321	nmdc:mga0rr50_317741_c1	3300050513	Bacteria	1305
322	nmdc:mga0rr50_364140_c1	3300050513	Bacteria	1217
323	Ga0495601_0006649	3300053077	Bacteria	6766
324	Ga0495601_0200194	3300053077	Bacteria	1305
325	Ga0500618_006501	3300053125	Bacteria	3423
326	Ga0500618_009560	3300053125	Bacteria	2641
327	Ga0500634_0004719	3300053161	Bacteria	6362
328	Ga0501084_0406493	3300054114	Bacteria	1151
329	Ga0590071_086567	3300059421	Bacteria	782
330	Ga0590077_090509	3300059426	Bacteria	710
331	Ga0501082_0156171	3300060353	Bacteria	1982
332	Ga0530510_0665730	3300061734	Bacteria	793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050511	nmdc:mga08y16_124107_c1	nmdc:mga08y16_124107_c1_37_462	137
2	3300005518	Ga0070699_100321819	Ga0070699_1003218192	143
3	3300005530	Ga0070679_100349879	Ga0070679_1003498792	143
4	3300025921	Ga0207652_10305313	Ga0207652_103053132	143
5	3300037471	Ga0395905_0832243	Ga0395905_0832243_280_717	143
6	3300049576	Ga0501040_0046728	Ga0501040_0046728_1946_2395	147
7	3300031995	Ga0307409_100371766	Ga0307409_1003717661	150
8	3300032002	Ga0307416_101063527	Ga0307416_1010635272	150
9	3300032005	Ga0307411_11493024	Ga0307411_114930241	150
10	3300005577	Ga0068857_100737221	Ga0068857_1007372211	151
11	3300041406	Ga0439439_0029787	Ga0439439_0029787_105_566	151
12	3300041997	Ga0439431_0019293	Ga0439431_0019293_828_1289	151
13	3300042015	Ga0439462_0005466	Ga0439462_0005466_1825_2286	151
14	3300042156	Ga0439446_0008053	Ga0439446_0008053_1743_2204	151
15	3300042435	Ga0439434_0026090	Ga0439434_0026090_806_1267	151
16	3300042436	Ga0439435_0000035	Ga0439435_0000035_9502_9963	151
17	3300005341	Ga0070691_10026703	Ga0070691_100267033	152
18	3300005444	Ga0070694_100146646	Ga0070694_1001466463	152
19	3300005444	Ga0070694_100369455	Ga0070694_1003694552	152
20	3300005459	Ga0068867_101234280	Ga0068867_1012342801	152
21	3300005544	Ga0070686_100135242	Ga0070686_1001352422	152
22	3300005549	Ga0070704_100904715	Ga0070704_1009047152	152
23	3300006844	Ga0075428_100370712	Ga0075428_1003707122	152
24	3300006847	Ga0075431_100194942	Ga0075431_1001949423	152
25	3300006880	Ga0075429_100034510	Ga0075429_1000345104	152
26	3300006880	Ga0075429_100059477	Ga0075429_1000594773	152
27	3300009147	Ga0114129_10062707	Ga0114129_100627077	152
28	3300026088	Ga0207641_10414651	Ga0207641_104146512	152
29	3300027360	Ga0209969_1001303	Ga0209969_10013033	152
30	3300027364	Ga0209967_1009838	Ga0209967_10098382	152
31	3300027395	Ga0209996_1007750	Ga0209996_10077502	152
32	3300027471	Ga0209995_1019812	Ga0209995_10198122	152
33	3300027614	Ga0209970_1003034	Ga0209970_10030343	152
34	3300027682	Ga0209971_1014392	Ga0209971_10143922	152
35	3300027695	Ga0209966_1001025	Ga0209966_10010252	152
36	3300027717	Ga0209998_10044580	Ga0209998_100445802	152
37	3300041405	Ga0439438_120556	Ga0439438_120556_67_531	152
38	3300041408	Ga0439453_0000359	Ga0439453_0000359_3966_4430	152
39	3300042001	Ga0439441_000461	Ga0439441_000461_641_1105	152
40	3300042003	Ga0439443_026287	Ga0439443_026287_228_692	152
41	3300042008	Ga0439450_051476	Ga0439450_051476_503_967	152
42	3300042437	Ga0439444_0002651	Ga0439444_0002651_980_1444	152
43	3300042461	Ga0439460_0006828	Ga0439460_0006828_1475_1939	152
44	3300042530	Ga0450916_025295	Ga0450916_025295_118_582	152
45	3300045051	Ga0451576_0110092	Ga0451576_0110092_2340_2804	152
46	3300050507	nmdc:mga05p37_80424_c1	nmdc:mga05p37_80424_c1_495_959	152
47	3300050508	nmdc:mga09592_3356_c1	nmdc:mga09592_3356_c1_11144_11608	152
48	3300050509	nmdc:mga0qj67_119557_c1	nmdc:mga0qj67_119557_c1_271_735	152
49	3300050510	nmdc:mga06r32_14966_c1	nmdc:mga06r32_14966_c1_4915_5379	152
50	3300005547	Ga0070693_100805348	Ga0070693_1008053482	153
51	3300042436	Ga0439435_0206580	Ga0439435_0206580_165_632	153
52	3300005546	Ga0070696_100117522	Ga0070696_1001175221	154
53	3300035117	Ga0373953_0513767	Ga0373953_0513767_16_486	154
54	3300036401	Ga0373937_0004931	Ga0373937_0004931_8226_8696	154
55	3300041496	Ga0451839_0304072	Ga0451839_0304072_42_512	154
56	3300042001	Ga0439441_002779	Ga0439441_002779_498_971	154
57	3300042003	Ga0439443_000357	Ga0439443_000357_1246_1719	154
58	3300042436	Ga0439435_0000052	Ga0439435_0000052_11928_12401	154
59	3300042437	Ga0439444_0001257	Ga0439444_0001257_2561_3034	154
60	3300042461	Ga0439460_0000009	Ga0439460_0000009_18105_18578	154
61	3300046454	Ga0495592_0005295	Ga0495592_0005295_2234_2704	154
62	3300046459	Ga0495629_0146829	Ga0495629_0146829_56_526	154
63	3300046461	Ga0495641_0112876	Ga0495641_0112876_22_492	154
64	3300046463	Ga0495653_0102677	Ga0495653_0102677_747_1217	154
65	3300046475	Ga0495639_0084810	Ga0495639_0084810_829_1299	154
66	3300046476	Ga0495662_0021336	Ga0495662_0021336_616_1086	154
67	3300046511	Ga0495608_0003204	Ga0495608_0003204_7180_7650	154
68	3300046514	Ga0495618_0009802	Ga0495618_0009802_3464_3934	154
69	3300046516	Ga0495628_0007192	Ga0495628_0007192_5059_5529	154
70	3300046517	Ga0495630_0031592	Ga0495630_0031592_1848_2318	154
71	3300046526	Ga0495666_0070769	Ga0495666_0070769_776_1246	154
72	3300046529	Ga0495652_0067319	Ga0495652_0067319_1578_2048	154
73	3300046533	Ga0495640_0004188	Ga0495640_0004188_2519_2989	154
74	3300046533	Ga0495640_0018725	Ga0495640_0018725_2237_2707	154
75	3300046535	Ga0495586_0000095	Ga0495586_0000095_4705_5175	154
76	3300046535	Ga0495586_0038828	Ga0495586_0038828_530_1000	154
77	3300046536	Ga0495587_0006538	Ga0495587_0006538_4803_5273	154
78	3300046543	Ga0495645_0037130	Ga0495645_0037130_727_1197	154
79	3300046559	Ga0495667_0008455	Ga0495667_0008455_3784_4254	154
80	3300046642	Ga0495634_0012612	Ga0495634_0012612_2559_3029	154
81	3300046663	Ga0495635_0020841	Ga0495635_0020841_2642_3112	154
82	3300046678	Ga0495599_0013749	Ga0495599_0013749_2215_2685	154
83	3300046681	Ga0495647_0211987	Ga0495647_0211987_105_575	154
84	3300046683	Ga0495658_0018189	Ga0495658_0018189_2067_2537	154
85	3300046689	Ga0495613_0001809	Ga0495613_0001809_7833_8303	154
86	3300046690	Ga0495624_0007096	Ga0495624_0007096_588_1058	154
87	3300046809	Ga0495600_0006194	Ga0495600_0006194_4424_4894	154
88	3300047315	Ga0495581_0052186	Ga0495581_0052186_214_684	154
89	3300047317	Ga0495604_0006750	Ga0495604_0006750_6295_6765	154
90	3300047318	Ga0495636_0011601	Ga0495636_0011601_929_1399	154
91	3300047319	Ga0495674_0089800	Ga0495674_0089800_279_749	154
92	3300047319	Ga0495674_0163159	Ga0495674_0163159_17_487	154
93	3300047322	Ga0495680_0015316	Ga0495680_0015316_3519_3989	154
94	3300047322	Ga0495680_0520204	Ga0495680_0520204_109_579	154
95	3300047444	Ga0495675_0103474	Ga0495675_0103474_664_1134	154
96	3300047471	Ga0495684_0013539	Ga0495684_0013539_3313_3783	154
97	3300047673	Ga0495593_0112304	Ga0495593_0112304_342_812	154
98	3300047673	Ga0495593_0197899	Ga0495593_0197899_335_805	154
99	3300049576	Ga0501040_0641506	Ga0501040_0641506_143_616	154
100	3300050508	nmdc:mga09592_153172_c1	nmdc:mga09592_153172_c1_1024_1494	154
101	3300050513	nmdc:mga0rr50_364140_c1	nmdc:mga0rr50_364140_c1_93_563	154
102	3300053077	Ga0495601_0006649	Ga0495601_0006649_5805_6275	154
103	3300053077	Ga0495601_0200194	Ga0495601_0200194_747_1217	154
104	3300061734	Ga0530510_0665730	Ga0530510_0665730_22_495	154
105	3300035085	Ga0373929_0115575	Ga0373929_0115575_166_639	155
106	3300035241	Ga0373961_0019402	Ga0373961_0019402_523_996	155
107	3300027378	Ga0209981_1004132	Ga0209981_10041321	156
108	3300059421	Ga0590071_086567	Ga0590071_086567_158_637	156
109	3300059426	Ga0590077_090509	Ga0590077_090509_58_537	156
110	3300002704	JGI25155J39150_1000088	JGI25155J39150_10000882	157
111	3300002705	JGI25156J39149_1000146	JGI25156J39149_100014649	157
112	3300002738	JGI25154J39366_1000159	JGI25154J39366_10001592	157
113	3300002741	JGI25157J39369_1000128	JGI25157J39369_100012849	157
114	3300003758	Ga0055532_1000005	Ga0055532_100000548	157
115	3300006847	Ga0075431_100053665	Ga0075431_1000536652	157
116	3300049521	Ga0501298_016113	Ga0501298_016113_66_545	157
117	3300049587	Ga0501071_0976607	Ga0501071_0976607_62_541	157
118	3300049591	Ga0501075_0700566	Ga0501075_0700566_180_659	157
119	3300049705	Ga0501225_0188367	Ga0501225_0188367_24_503	157
120	3300049741	Ga0501079_0804799	Ga0501079_0804799_197_685	157
121	3300049742	Ga0501080_0921604	Ga0501080_0921604_199_681	157
122	3300049743	Ga0501081_0164821	Ga0501081_0164821_1046_1543	157
123	3300050509	nmdc:mga0qj67_95564_c1	nmdc:mga0qj67_95564_c1_1316_1819	157
124	3300050510	nmdc:mga06r32_26957_c1	nmdc:mga06r32_26957_c1_4107_4610	157
125	3300005547	Ga0070693_100022544	Ga0070693_1000225442	158
126	3300007265	Ga0099794_10037543	Ga0099794_100375432	158
127	3300027671	Ga0209588_1071665	Ga0209588_10716652	158
128	3300049568	Ga0501031_0060082	Ga0501031_0060082_1700_2206	158
129	3300049570	Ga0501033_0203085	Ga0501033_0203085_770_1252	158
130	3300049577	Ga0501041_0143925	Ga0501041_0143925_981_1463	158
131	3300049578	Ga0501042_0030647	Ga0501042_0030647_3155_3637	158
132	3300005340	Ga0070689_100169419	Ga0070689_1001694192	159
133	3300005545	Ga0070695_100149034	Ga0070695_1001490342	159
134	3300006846	Ga0075430_100168325	Ga0075430_1001683252	159
135	3300026075	Ga0207708_10518044	Ga0207708_105180442	159
136	3300032002	Ga0307416_102178170	Ga0307416_1021781701	159
137	3300035117	Ga0373953_0073459	Ga0373953_0073459_45_530	159
138	3300035118	Ga0373954_0000082	Ga0373954_0000082_30055_30540	159
139	3300035172	Ga0373955_0290695	Ga0373955_0290695_87_572	159
140	3300035724	Ga0373933_0009744	Ga0373933_0009744_2244_2729	159
141	3300036401	Ga0373937_0000775	Ga0373937_0000775_921_1406	159
142	3300046537	Ga0495598_0163370	Ga0495598_0163370_172_666	159
143	3300046684	Ga0495669_0039912	Ga0495669_0039912_1176_1670	159
144	3300047317	Ga0495604_0548937	Ga0495604_0548937_175_660	159
145	3300050509	nmdc:mga0qj67_248526_c1	nmdc:mga0qj67_248526_c1_395_880	159
146	3300050513	nmdc:mga0rr50_317741_c1	nmdc:mga0rr50_317741_c1_22_507	159
147	3300005546	Ga0070696_100163143	Ga0070696_1001631432	160
148	3300031235	Ga0265330_10210549	Ga0265330_102105492	160
149	3300031239	Ga0265328_10276485	Ga0265328_102764851	160
150	3300005336	Ga0070680_100064305	Ga0070680_1000643052	161
151	3300005340	Ga0070689_100070137	Ga0070689_1000701372	161
152	3300005343	Ga0070687_101088405	Ga0070687_1010884051	161
153	3300005345	Ga0070692_10203619	Ga0070692_102036191	161
154	3300005441	Ga0070700_100115201	Ga0070700_1001152011	161
155	3300005444	Ga0070694_100068647	Ga0070694_1000686472	161
156	3300005458	Ga0070681_10000283	Ga0070681_1000028337	161
157	3300005458	Ga0070681_10421292	Ga0070681_104212922	161
158	3300005535	Ga0070684_100899931	Ga0070684_1008999311	161
159	3300005545	Ga0070695_100047830	Ga0070695_1000478302	161
160	3300005547	Ga0070693_100319422	Ga0070693_1003194222	161
161	3300005549	Ga0070704_100115849	Ga0070704_1001158492	161
162	3300005549	Ga0070704_100565966	Ga0070704_1005659662	161
163	3300005615	Ga0070702_100234711	Ga0070702_1002347111	161
164	3300005617	Ga0068859_100237680	Ga0068859_1002376802	161
165	3300006852	Ga0075433_10587632	Ga0075433_105876322	161
166	3300006871	Ga0075434_100121668	Ga0075434_1001216683	161
167	3300006914	Ga0075436_100529018	Ga0075436_1005290182	161
168	3300006931	Ga0097620_100237679	Ga0097620_1002376792	161
169	3300007265	Ga0099794_10091018	Ga0099794_100910182	161
170	3300007265	Ga0099794_10095229	Ga0099794_100952292	161
171	3300009094	Ga0111539_10663549	Ga0111539_106635492	161
172	3300009148	Ga0105243_11417418	Ga0105243_114174182	161
173	3300013105	Ga0157369_10472773	Ga0157369_104727732	161
174	3300025912	Ga0207707_10000946	Ga0207707_1000094625	161
175	3300025917	Ga0207660_10060353	Ga0207660_100603532	161
176	3300025936	Ga0207670_10091679	Ga0207670_100916792	161
177	3300025936	Ga0207670_10596953	Ga0207670_105969531	161
178	3300026075	Ga0207708_10134855	Ga0207708_101348553	161
179	3300026089	Ga0207648_10596196	Ga0207648_105961962	161
180	3300027671	Ga0209588_1059637	Ga0209588_10596372	161
181	3300027671	Ga0209588_1085509	Ga0209588_10855092	161
182	3300031548	Ga0307408_100154936	Ga0307408_1001549361	161
183	3300031548	Ga0307408_100386205	Ga0307408_1003862052	161
184	3300031731	Ga0307405_11512483	Ga0307405_115124831	161
185	3300031911	Ga0307412_10293481	Ga0307412_102934812	161
186	3300032002	Ga0307416_100060031	Ga0307416_1000600313	161
187	3300032002	Ga0307416_100222561	Ga0307416_1002225613	161
188	3300032002	Ga0307416_101021355	Ga0307416_1010213552	161
189	3300032005	Ga0307411_10299113	Ga0307411_102991132	161
190	3300032126	Ga0307415_100392081	Ga0307415_1003920812	161
191	3300035112	Ga0373932_0105900	Ga0373932_0105900_67_564	161
192	3300035114	Ga0373939_0017265	Ga0373939_0017265_483_980	161
193	3300035115	Ga0373941_0006009	Ga0373941_0006009_1351_1848	161
194	3300035121	Ga0373960_0088321	Ga0373960_0088321_37_534	161
195	3300035691	Ga0373931_0018480	Ga0373931_0018480_981_1478	161
196	3300036401	Ga0373937_0104993	Ga0373937_0104993_442_933	161
197	3300044683	Ga0466965_0067748	Ga0466965_0067748_1062_1559	161
198	3300046528	Ga0495642_0036485	Ga0495642_0036485_851_1351	161
199	3300046537	Ga0495598_0180528	Ga0495598_0180528_67_564	161
200	3300049521	Ga0501298_008445	Ga0501298_008445_1073_1573	161
201	3300049577	Ga0501041_0232289	Ga0501041_0232289_244_744	161
202	3300049592	Ga0501076_0293523	Ga0501076_0293523_56_556	161
203	3300049742	Ga0501080_0106257	Ga0501080_0106257_1302_1802	161
204	3300049743	Ga0501081_0214679	Ga0501081_0214679_94_594	161
205	3300049779	Ga0501283_009860	Ga0501283_009860_558_1058	161
206	3300049824	Ga0501045_0655232	Ga0501045_0655232_101_601	161
207	3300050511	nmdc:mga08y16_88633_c1	nmdc:mga08y16_88633_c1_2096_2593	161
208	3300050512	nmdc:mga0n895_163599_c1	nmdc:mga0n895_163599_c1_1077_1574	161
209	3300053161	Ga0500634_0004719	Ga0500634_0004719_1760_2305	161
210	3300054114	Ga0501084_0406493	Ga0501084_0406493_488_988	161
211	3300060353	Ga0501082_0156171	Ga0501082_0156171_1430_1930	161
212	3300002737	JGI25162J39368_1005406	JGI25162J39368_10054062	162
213	3300005340	Ga0070689_100108328	Ga0070689_1001083282	162
214	3300009011	Ga0105251_10058092	Ga0105251_100580922	162
215	3300009147	Ga0114129_12624013	Ga0114129_126240131	162
216	3300025233	Ga0209437_100195	Ga0209437_100195110	162
217	3300031711	Ga0265314_10328657	Ga0265314_103286572	162
218	3300035085	Ga0373929_0069320	Ga0373929_0069320_108_602	162
219	3300035114	Ga0373939_0026692	Ga0373939_0026692_919_1413	162
220	3300035121	Ga0373960_0096213	Ga0373960_0096213_342_836	162
221	3300048928	Ga0496125_0001066	Ga0496125_0001066_34300_34809	162
222	3300005295	Ga0065707_10499693	Ga0065707_104996932	163
223	3300005440	Ga0070705_100266896	Ga0070705_1002668962	163
224	3300005459	Ga0068867_100506734	Ga0068867_1005067342	163
225	3300005546	Ga0070696_100152031	Ga0070696_1001520311	163
226	3300005719	Ga0068861_100374945	Ga0068861_1003749452	163
227	3300006237	Ga0097621_100444510	Ga0097621_1004445102	163
228	3300006358	Ga0068871_100358175	Ga0068871_1003581752	163
229	3300009177	Ga0105248_10503445	Ga0105248_105034452	163
230	3300025916	Ga0207663_10444571	Ga0207663_104445712	163
231	3300025941	Ga0207711_10422511	Ga0207711_104225112	163
232	3300026089	Ga0207648_10556788	Ga0207648_105567882	163
233	3300049584	Ga0501068_0199991	Ga0501068_0199991_584_1087	163
234	3300049590	Ga0501074_0731605	Ga0501074_0731605_77_583	163
235	3300005338	Ga0068868_101410030	Ga0068868_1014100301	164
236	3300044706	Ga0466964_0144270	Ga0466964_0144270_40_546	164
237	3300045976	Ga0466967_0055778	Ga0466967_0055778_800_1306	164
238	3300002704	JGI25155J39150_1000847	JGI25155J39150_10008473	165
239	3300002705	JGI25156J39149_1005109	JGI25156J39149_10051093	165
240	3300002738	JGI25154J39366_1000301	JGI25154J39366_10003012	165
241	3300003751	Ga0055538_1000010	Ga0055538_1000010311	165
242	3300003752	Ga0055539_1000015	Ga0055539_1000015311	165
243	3300003756	Ga0055533_1000018	Ga0055533_1000018311	165
244	3300003759	Ga0055525_1000020	Ga0055525_1000020311	165
245	3300003763	Ga0055529_1024815	Ga0055529_10248151	165
246	3300003841	Ga0055541_1000011	Ga0055541_1000011311	165
247	3300005440	Ga0070705_100300447	Ga0070705_1003004472	165
248	3300005468	Ga0070707_101091568	Ga0070707_1010915681	165
249	3300005563	Ga0068855_100000064	Ga0068855_10000006417	165
250	3300005563	Ga0068855_100510914	Ga0068855_1005109142	165
251	3300005577	Ga0068857_100272324	Ga0068857_1002723242	165
252	3300005578	Ga0068854_100010525	Ga0068854_1000105253	165
253	3300005614	Ga0068856_100046229	Ga0068856_1000462293	165
254	3300005614	Ga0068856_100251390	Ga0068856_1002513902	165
255	3300005615	Ga0070702_100177466	Ga0070702_1001774662	165
256	3300005616	Ga0068852_100161669	Ga0068852_1001616692	165
257	3300005834	Ga0068851_10088341	Ga0068851_100883412	165
258	3300006946	Ga0079104_1005798	Ga0079104_10057982	165
259	3300009036	Ga0105244_10033147	Ga0105244_100331473	165
260	3300009093	Ga0105240_10003573	Ga0105240_1000357313	165
261	3300009093	Ga0105240_10038912	Ga0105240_100389122	165
262	3300009098	Ga0105245_10105626	Ga0105245_101056262	165
263	3300009176	Ga0105242_10027028	Ga0105242_100270282	165
264	3300009545	Ga0105237_10001496	Ga0105237_1000149612	165
265	3300009551	Ga0105238_10000004	Ga0105238_10000004342	165
266	3300010375	Ga0105239_10001696	Ga0105239_100016968	165
267	3300010375	Ga0105239_10292048	Ga0105239_102920482	165
268	3300011119	Ga0105246_10516282	Ga0105246_105162822	165
269	3300013100	Ga0157373_10124970	Ga0157373_101249702	165
270	3300013297	Ga0157378_10838316	Ga0157378_108383162	165
271	3300014497	Ga0182008_10220756	Ga0182008_102207562	165
272	3300015261	Ga0182006_1057004	Ga0182006_10570042	165
273	3300015262	Ga0182007_10047404	Ga0182007_100474042	165
274	3300021361	Ga0213872_10018384	Ga0213872_100183842	165
275	3300025206	Ga0209435_100004	Ga0209435_100004288	165
276	3300025206	Ga0209435_100170	Ga0209435_1001706	165
277	3300025224	Ga0209784_100025	Ga0209784_100025308	165
278	3300025225	Ga0209566_100025	Ga0209566_100025308	165
279	3300025226	Ga0209674_100042	Ga0209674_100042308	165
280	3300025229	Ga0209147_100011	Ga0209147_100011385	165
281	3300025230	Ga0209563_100046	Ga0209563_100046308	165
282	3300025242	Ga0209258_100337	Ga0209258_10033753	165
283	3300025246	Ga0209646_1000032	Ga0209646_100003275	165
284	3300025246	Ga0209646_1000136	Ga0209646_100013662	165
285	3300025250	Ga0209026_1000128	Ga0209026_100012848	165
286	3300025250	Ga0209026_1001182	Ga0209026_100118213	165
287	3300025253	Ga0209677_100027	Ga0209677_100027308	165
288	3300025256	Ga0209759_1000126	Ga0209759_100012683	165
289	3300025256	Ga0209759_1000263	Ga0209759_100026362	165
290	3300025272	Ga0209455_1003705	Ga0209455_10037053	165
291	3300025913	Ga0207695_10000670	Ga0207695_1000067059	165
292	3300025913	Ga0207695_10008300	Ga0207695_100083008	165
293	3300025914	Ga0207671_10004515	Ga0207671_1000451514	165
294	3300025922	Ga0207646_10055553	Ga0207646_100555532	165
295	3300025924	Ga0207694_10000021	Ga0207694_10000021259	165
296	3300025924	Ga0207694_10194033	Ga0207694_101940332	165
297	3300025927	Ga0207687_10470740	Ga0207687_104707402	165
298	3300025934	Ga0207686_10150802	Ga0207686_101508022	165
299	3300025949	Ga0207667_10000019	Ga0207667_10000019270	165
300	3300025949	Ga0207667_10167589	Ga0207667_101675892	165
301	3300025949	Ga0207667_10255425	Ga0207667_102554252	165
302	3300025949	Ga0207667_10324519	Ga0207667_103245192	165
303	3300025981	Ga0207640_10013213	Ga0207640_100132132	165
304	3300025981	Ga0207640_10233845	Ga0207640_102338452	165
305	3300026078	Ga0207702_10038133	Ga0207702_100381332	165
306	3300026078	Ga0207702_10244748	Ga0207702_102447482	165
307	3300026116	Ga0207674_10152226	Ga0207674_101522263	165
308	3300026116	Ga0207674_10303166	Ga0207674_103031662	165
309	3300026142	Ga0207698_10006365	Ga0207698_100063652	165
310	3300027111	Ga0209281_1003939	Ga0209281_10039394	165
311	3300039447	Ga0436361_0168473	Ga0436361_0168473_5227_5766	165
312	3300044673	Ga0453683_0041914	Ga0453683_0041914_1940_2449	165
313	3300046660	Ga0495625_0044838	Ga0495625_0044838_1515_2078	165
314	3300048919	Ga0496116_0094869	Ga0496116_0094869_488_1027	165
315	3300048919	Ga0496116_0249604	Ga0496116_0249604_245_790	165
316	3300048920	Ga0496117_0240034	Ga0496117_0240034_24_563	165
317	3300048921	Ga0496118_0186265	Ga0496118_0186265_408_947	165
318	3300048924	Ga0496121_0226983	Ga0496121_0226983_654_1193	165
319	3300048924	Ga0496121_0356111	Ga0496121_0356111_258_797	165
320	3300048925	Ga0496122_0000121	Ga0496122_0000121_178659_179198	165
321	3300048926	Ga0496123_0001760	Ga0496123_0001760_2248_2787	165
322	3300048928	Ga0496125_0190552	Ga0496125_0190552_703_1242	165
323	3300053125	Ga0500618_006501	Ga0500618_006501_1521_2060	165
324	3300053125	Ga0500618_009560	Ga0500618_009560_688_1227	165
325	iso_pu_bacteria	2511231003	2511250473	165
326	iso_pu_bacteria	2511231026	2511384740	165
327	iso_pu_bacteria	2521172590	2521556611	165
328	iso_pu_bacteria	2548876994	2550692305	165
329	iso_pu_bacteria	2551306416	2553006792	165
330	iso_pu_bacteria	2765235838	2765567789	165
331	iso_pu_bacteria	2808606386	2808982830	165
332	iso_pu_bacteria	2808606415	2809130342	165
333	iso_pu_bacteria	2808606419	2809150181	165
334	iso_pu_bacteria	2818991445	2819592653	165
335	iso_pu_bacteria	2818991449	2819617979	165
336	iso_pu_bacteria	2839094727	2839099748	165
337	iso_pu_bacteria	2852618963	2852621598	165
338	iso_pu_bacteria	2884811622	2884815460	165
339	iso_pu_bacteria	2884836552	2884838853	165
340	iso_pu_bacteria	2884852848	2884855145	165
341	iso_pu_bacteria	2896154374	2896156186	165
342	iso_pu_bacteria	2904439833	2904442004	165
343	iso_pu_bacteria	2904530477	2904533301	165
344	iso_pu_bacteria	2904584206	2904586249	165
345	iso_pu_bacteria	2904589729	2904591938	165
346	iso_pu_bacteria	2904601388	2904601900	165
347	iso_pu_bacteria	2919046199	2919049385	165
348	iso_pu_bacteria	2919079590	2919083773	165
349	iso_pu_bacteria	2923510766	2923515208	165
350	iso_pu_bacteria	2928130867	2928132165	165
351	3300044712	Ga0453684_0192697	Ga0453684_0192697_207_716	166
352	2162886007	SwRhRL2b_contig_3843742	SwRhRL2b_0591.00000960	170
353	3300005289	Ga0065704_10072503	Ga0065704_100725033	170
354	3300048925	Ga0496122_0013733	Ga0496122_0013733_1162_1674	170
355	3300048926	Ga0496123_0010922	Ga0496123_0010922_754_1266	170
356	3300048927	Ga0496124_0290878	Ga0496124_0290878_435_947	170
357	3300048928	Ga0496125_0005380	Ga0496125_0005380_12079_12591	170
358	3300048929	Ga0496126_0319929	Ga0496126_0319929_401_913	170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

46

171

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2r76-assembly1.cif.gz_A	crystal structure of the rare lipoprotein b (so_1173) from shewanella oneidensis, northeast structural genomics consortium target sor91a	0.8672	33	163
2jxp-assembly1.cif.gz_A	solution nmr structure of uncharacterized lipoprotein b from nitrosomonas europaea. northeast structural genomics target ner45a	0.8661	24	163
5ixm-assembly3.cif.gz_F	the lps transporter lptde from yersinia pestis, core complex	0.8574	28	161
5iv8-assembly1.cif.gz_B	the lps transporter lptde from klebsiella pneumoniae, core complex	0.8482	31	163
4rhb-assembly2.cif.gz_D	crystal structure of the lipopolysaccharide assembly complex lptd-lpte from the escherichia coli outer membrane	0.8436	31	163

ID	Description	Score	Start	End	Superfamily
2jxpA01	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain	0.8678	33	163	3.30.160.150
3bf2A00	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain	0.8174	30	162	3.30.160.150
5tseB00	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain	0.8029	29	167	3.30.160.150
2jxpA01	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain	0.7839	33	163	3.30.160.150
4rh8C00	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain	0.7824	31	163	3.30.160.150

ID	Description	Score	Start	End	GO Terms
AF-A0A257AUR2-F1-model_v4	LPS-assembly lipoprotein LptE	0.9645	77	170	GO:0001530 GO:0009279 GO:0015920 GO:0043165 GO:1990351
AF-A0A2M8DU82-F1-model_v4	Uncharacterized protein	0.9595	78	167	GO:0001530 GO:0009279 GO:0015920 GO:0043165 GO:1990351
AF-A0A540WHI9-F1-model_v4	LPS-assembly lipoprotein LptE	0.9522	35	167	GO:0001530 GO:0009279 GO:0015920 GO:0043165 GO:1990351
AF-A0A540WHI9-F1-model_v4	LPS-assembly lipoprotein LptE	0.9385	35	167	GO:0001530 GO:0009279 GO:0015920 GO:0043165 GO:1990351
AF-C5TCR4-F1-model_v4	Rare lipoprotein B	0.9344	56	162	GO:0001530 GO:0009279 GO:0015920 GO:0043165 GO:1990351

Feature Viewer

pLDDT	pTM	Quality
86.03	0.77	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F421290

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04390

LptE

Lipopolysaccharide-assembly

46

171

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map