F421189

General Info

Members Datasets Scaffolds Average Seq Length
358 211 716 218

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10117324|Ga0163163_101173242
Length 257
Sequence MMLKEPGLCCGVVVGMAVLAIAPFGTVESALAATDMAPAAVAPASGATPLDKYLDNLKTLRTTFLQTLADSDGREIDRATGTLIVVRPGKFSWDIHPQALKTASPGGAGAAADPNANTGSASKGAGQLMVSDGRNLWFFDRDLEQVTVKPIDAALSATPAMLLSGSVDVRKSFTLTPAGQREGLDWVLVEPHGRDADFSSALFGFAGGELKKMILEDKLGQTATVMFDHIERNVPVKAQETSFTPPKGVDVIGTPRK

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.79
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10117324 3300014325 Bacteria 2693
2 rootL2_10282856 3300003322 Unclassified 1246
3 Ga0070676_10156974 3300005328 Bacteria 1461
4 Ga0070676_10290961 3300005328 Bacteria 1104
5 Ga0070683_100105701 3300005329 Bacteria 2654
6 Ga0070690_100118948 3300005330 Bacteria 1771
7 Ga0070670_100382079 3300005331 Bacteria 1241
8 Ga0070677_10016083 3300005333 Bacteria 2659
9 Ga0068869_100021831 3300005334 Bacteria 4405
10 Ga0068869_100142831 3300005334 Bacteria 1850
11 Ga0070680_100013113 3300005336 Bacteria 6450
12 Ga0070680_100057537 3300005336 Bacteria 3179
13 Ga0070680_100740160 3300005336 Unclassified 846
14 Ga0070682_100046074 3300005337 Bacteria 2705
15 Ga0070682_100047605 3300005337 Bacteria 2666
16 Ga0070682_100217779 3300005337 Bacteria 1357
17 Ga0070682_100397515 3300005337 Unclassified 1041
18 Ga0068868_100193584 3300005338 Bacteria 1692
19 Ga0070689_100298474 3300005340 Bacteria 1340
20 Ga0070661_100031465 3300005344 Bacteria 3838
21 Ga0070668_100247406 3300005347 Bacteria 1479
22 Ga0070669_100114715 3300005353 Bacteria 2048
23 Ga0070669_100182003 3300005353 Bacteria 1644
24 Ga0070675_100031875 3300005354 Bacteria 4263
25 Ga0070675_100416351 3300005354 Unclassified 1201
26 Ga0070671_100449870 3300005355 Bacteria 1105
27 Ga0070674_100054158 3300005356 Bacteria 2773
28 Ga0070674_100176438 3300005356 Bacteria 1633
29 Ga0070673_100021345 3300005364 Bacteria 4693
30 Ga0070673_100261276 3300005364 Bacteria 1513
31 Ga0070688_100371573 3300005365 Bacteria 1052
32 Ga0070659_100282525 3300005366 Bacteria 1381
33 Ga0070709_10034065 3300005434 Bacteria 3085
34 Ga0070709_10248161 3300005434 Bacteria 1281
35 Ga0070714_100004315 3300005435 Bacteria 10719
36 Ga0070713_100023866 3300005436 Bacteria 4754
37 Ga0070713_100025532 3300005436 Bacteria 4620
38 Ga0070710_10141701 3300005437 Bacteria 1475
39 Ga0070701_10063867 3300005438 Bacteria 1949
40 Ga0070711_100067985 3300005439 Bacteria 2502
41 Ga0070705_100020816 3300005440 Bacteria 3479
42 Ga0070700_100015690 3300005441 Bacteria 4302
43 Ga0070700_100156394 3300005441 Bacteria 1565
44 Ga0070700_100327267 3300005441 Bacteria 1128
45 Ga0070700_100465641 3300005441 Bacteria 965
46 Ga0070663_100093003 3300005455 Bacteria 2237
47 Ga0070678_100032825 3300005456 Bacteria 3597
48 Ga0070662_100210224 3300005457 Bacteria 1548
49 Ga0070681_10001003 3300005458 Bacteria 23931
50 Ga0070681_10024838 3300005458 Bacteria 6028
51 Ga0070681_10025547 3300005458 Bacteria 5941
52 Ga0070681_10701859 3300005458 Bacteria 927
53 Ga0068867_100120092 3300005459 Bacteria 2030
54 Ga0068867_100185220 3300005459 Bacteria 1658
55 Ga0068867_100216558 3300005459 Bacteria 1541
56 Ga0068867_100247959 3300005459 Bacteria 1447
57 Ga0070685_10056326 3300005466 Bacteria 2285
58 Ga0070685_10163357 3300005466 Bacteria 1421
59 Ga0070685_10247209 3300005466 Bacteria 1180
60 Ga0070679_100003026 3300005530 Bacteria 15351
61 Ga0070679_100036533 3300005530 Bacteria 4875
62 Ga0070679_100071405 3300005530 Bacteria 3463
63 Ga0070679_100104501 3300005530 Bacteria 2819
64 Ga0070679_100128949 3300005530 Bacteria 2511
65 Ga0070684_100014025 3300005535 Bacteria 6480
66 Ga0070672_100049268 3300005543 Bacteria 3276
67 Ga0070672_100062485 3300005543 Bacteria 2939
68 Ga0070672_100348298 3300005543 Bacteria 1262
69 Ga0070686_100056112 3300005544 Bacteria 2525
70 Ga0070686_100155178 3300005544 Bacteria 1607
71 Ga0070695_100674368 3300005545 Bacteria 818
72 Ga0070665_100058216 3300005548 Bacteria 3874
73 Ga0070665_100107403 3300005548 Bacteria 2793
74 Ga0070665_100881624 3300005548 Bacteria 908
75 Ga0070704_100092500 3300005549 Bacteria 2258
76 Ga0068855_100000869 3300005563 Bacteria 37546
77 Ga0068855_100018851 3300005563 Bacteria 8294
78 Ga0068855_100259154 3300005563 Bacteria 1938
79 Ga0068856_100191530 3300005614 Bacteria 2058
80 Ga0070702_100034467 3300005615 Bacteria 2790
81 Ga0068859_100094212 3300005617 Bacteria 3047
82 Ga0068859_100940512 3300005617 Unclassified 948
83 Ga0068861_100014658 3300005719 Bacteria 5504
84 Ga0068861_100019433 3300005719 Bacteria 4853
85 Ga0068861_100390781 3300005719 Bacteria 1232
86 Ga0068861_100397489 3300005719 Bacteria 1222
87 Ga0068861_100944628 3300005719 Unclassified 819
88 Ga0068870_10054854 3300005840 Bacteria 2121
89 Ga0068863_100009858 3300005841 Bacteria 9307
90 Ga0068863_100075291 3300005841 Bacteria 3194
91 Ga0068863_100186412 3300005841 Bacteria 1993
92 Ga0068858_100229315 3300005842 Bacteria 1760
93 Ga0068858_100286160 3300005842 Bacteria 1570
94 Ga0068860_100002237 3300005843 Bacteria 20366
95 Ga0068860_100032073 3300005843 Bacteria 5051
96 Ga0068860_100063492 3300005843 Bacteria 3508
97 Ga0068862_100039408 3300005844 Bacteria 4012
98 Ga0068862_100126691 3300005844 Bacteria 2255
99 Ga0081455_10047035 3300005937 Bacteria 3739
100 Ga0070717_10002768 3300006028 Bacteria 12402
101 Ga0070716_100046078 3300006173 Bacteria 2452
102 Ga0097621_100204729 3300006237 Bacteria 1714
103 Ga0097621_100310994 3300006237 Bacteria 1394
104 Ga0068871_100027127 3300006358 Bacteria 4476
105 Ga0068871_100100639 3300006358 Bacteria 2421
106 Ga0068871_100251097 3300006358 Bacteria 1541
107 Ga0068871_100286127 3300006358 Bacteria 1443
108 Ga0068865_100399782 3300006881 Bacteria 1125
109 Ga0097620_100094217 3300006931 Bacteria 3047
110 Ga0097620_100940583 3300006931 Unclassified 948
111 Ga0075435_100033964 3300007076 Bacteria 4038
112 Ga0105240_10001826 3300009093 Bacteria 35711
113 Ga0105240_10003206 3300009093 Bacteria 25662
114 Ga0105240_10022180 3300009093 Bacteria 8423
115 Ga0105240_10034970 3300009093 Bacteria 6478
116 Ga0105240_10095462 3300009093 Bacteria 3625
117 Ga0105240_10976370 3300009093 Unclassified 907
118 Ga0111539_10194661 3300009094 Bacteria 2365
119 Ga0111539_10328448 3300009094 Bacteria 1780
120 Ga0105247_10056981 3300009101 Bacteria 2415
121 Ga0105241_10172823 3300009174 Bacteria 1786
122 Ga0105242_10115363 3300009176 Bacteria 2296
123 Ga0105242_10735589 3300009176 Unclassified 969
124 Ga0105237_10239103 3300009545 Bacteria 1817
125 Ga0105237_10367831 3300009545 Bacteria 1443
126 Ga0105237_10377088 3300009545 Bacteria 1423
127 Ga0105237_10607093 3300009545 Bacteria 1101
128 Ga0105237_10698569 3300009545 Bacteria 1021
129 Ga0105238_10016949 3300009551 Bacteria 7393
130 Ga0105238_10109940 3300009551 Bacteria 2738
131 Ga0105238_10196716 3300009551 Bacteria 1992
132 Ga0105238_10225854 3300009551 Bacteria 1849
133 Ga0105238_10871980 3300009551 Bacteria 918
134 Ga0105249_10131773 3300009553 Bacteria 2388
135 Ga0105249_10885524 3300009553 Unclassified 959
136 Ga0105239_10062865 3300010375 Bacteria 4075
137 Ga0105239_10136799 3300010375 Bacteria 2728
138 Ga0157370_10017048 3300013104 Bacteria 7341
139 Ga0157370_10380912 3300013104 Bacteria 1299
140 Ga0157369_10033452 3300013105 Bacteria 5649
141 Ga0157369_10191615 3300013105 Bacteria 2148
142 Ga0157374_10511915 3300013296 Bacteria 1205
143 Ga0157374_10699967 3300013296 Bacteria 1026
144 Ga0157374_10997773 3300013296 Bacteria 856
145 Ga0163162_10043852 3300013306 Bacteria 4478
146 Ga0163162_10204376 3300013306 Bacteria 2104
147 Ga0157372_10259271 3300013307 Bacteria 2019
148 Ga0157375_10054751 3300013308 Bacteria 3930
149 Ga0157375_10354069 3300013308 Bacteria 1634
150 Ga0157375_10896600 3300013308 Bacteria 1031
151 Ga0163163_10499155 3300014325 Unclassified 1279
152 Ga0157380_10015516 3300014326 Bacteria 5600
153 Ga0157380_10141908 3300014326 Bacteria 2065
154 Ga0157380_10206260 3300014326 Bacteria 1748
155 Ga0157380_11061675 3300014326 Bacteria 847
156 Ga0157379_10121062 3300014968 Bacteria 2354
157 Ga0157379_10550357 3300014968 Bacteria 1073
158 Ga0163161_10193394 3300017792 Bacteria 1565
159 Ga0213874_10002465 3300021377 Bacteria 3989
160 Ga0213876_10056786 3300021384 Bacteria 2067
161 Ga0207682_10003364 3300025893 Bacteria 6965
162 Ga0207682_10008573 3300025893 Bacteria 4042
163 Ga0207642_10099190 3300025899 Bacteria 1458
164 Ga0207680_10368203 3300025903 Bacteria 1011
165 Ga0207699_10094015 3300025906 Bacteria 1888
166 Ga0207699_10206755 3300025906 Bacteria 1333
167 Ga0207645_10112943 3300025907 Bacteria 1760
168 Ga0207643_10008696 3300025908 Bacteria 5445
169 Ga0207707_10007902 3300025912 Bacteria 9251
170 Ga0207707_10039219 3300025912 Bacteria 4141
171 Ga0207707_10051618 3300025912 Bacteria 3582
172 Ga0207695_10007963 3300025913 Bacteria 13367
173 Ga0207695_10031140 3300025913 Bacteria 5857
174 Ga0207695_10037591 3300025913 Bacteria 5223
175 Ga0207695_10043310 3300025913 Bacteria 4798
176 Ga0207695_10165504 3300025913 Bacteria 2140
177 Ga0207671_10117445 3300025914 Bacteria 2030
178 Ga0207671_10236815 3300025914 Bacteria 1433
179 Ga0207671_10281717 3300025914 Bacteria 1311
180 Ga0207671_10521575 3300025914 Bacteria 947
181 Ga0207693_10333162 3300025915 Bacteria 1188
182 Ga0207663_10008908 3300025916 Bacteria 5277
183 Ga0207663_10406719 3300025916 Bacteria 1042
184 Ga0207660_10013992 3300025917 Bacteria 5266
185 Ga0207662_10304785 3300025918 Bacteria 1060
186 Ga0207652_10019654 3300025921 Bacteria 5558
187 Ga0207652_10032325 3300025921 Bacteria 4398
188 Ga0207652_10339278 3300025921 Bacteria 1356
189 Ga0207652_10805295 3300025921 Bacteria 834
190 Ga0207681_10108467 3300025923 Bacteria 2015
191 Ga0207681_10153292 3300025923 Bacteria 1729
192 Ga0207694_10117905 3300025924 Bacteria 2117
193 Ga0207694_10422162 3300025924 Bacteria 1111
194 Ga0207659_10019909 3300025926 Bacteria 4426
195 Ga0207659_10098459 3300025926 Bacteria 2199
196 Ga0207700_10029952 3300025928 Bacteria 3848
197 Ga0207664_10006704 3300025929 Bacteria 7947
198 Ga0207664_10670905 3300025929 Bacteria 932
199 Ga0207706_10198588 3300025933 Bacteria 1759
200 Ga0207706_10240992 3300025933 Bacteria 1581
201 Ga0207670_10010864 3300025936 Bacteria 5255
202 Ga0207669_10047150 3300025937 Bacteria 2550
203 Ga0207669_10240834 3300025937 Bacteria 1341
204 Ga0207704_10333724 3300025938 Bacteria 1174
205 Ga0207665_10066454 3300025939 Bacteria 2454
206 Ga0207665_10082547 3300025939 Bacteria 2215
207 Ga0207691_10015054 3300025940 Bacteria 7362
208 Ga0207691_10019364 3300025940 Bacteria 6440
209 Ga0207711_10040202 3300025941 Bacteria 3978
210 Ga0207689_10008144 3300025942 Bacteria 9141
211 Ga0207689_10239002 3300025942 Bacteria 1501
212 Ga0207661_10121939 3300025944 Bacteria 2220
213 Ga0207679_10736638 3300025945 Bacteria 896
214 Ga0207667_10016118 3300025949 Bacteria 8453
215 Ga0207667_10035166 3300025949 Bacteria 5375
216 Ga0207667_10838005 3300025949 Bacteria 914
217 Ga0207651_10225688 3300025960 Bacteria 1517
218 Ga0207658_10075456 3300025986 Bacteria 2565
219 Ga0207703_10273767 3300026035 Bacteria 1531
220 Ga0207639_10773434 3300026041 Bacteria 894
221 Ga0207678_10113724 3300026067 Bacteria 2309
222 Ga0207708_10059201 3300026075 Bacteria 2924
223 Ga0207708_10074170 3300026075 Bacteria 2608
224 Ga0207708_10097718 3300026075 Bacteria 2269
225 Ga0207641_10000247 3300026088 Bacteria 69132
226 Ga0207641_10096216 3300026088 Bacteria 2600
227 Ga0207641_10352848 3300026088 Bacteria 1402
228 Ga0207648_10341083 3300026089 Bacteria 1349
229 Ga0207675_100002808 3300026118 Bacteria 17117
230 Ga0207675_100014088 3300026118 Bacteria 7456
231 Ga0207675_100256278 3300026118 Bacteria 1695
232 Ga0207675_100393258 3300026118 Bacteria 1365
233 Ga0207675_100467375 3300026118 Bacteria 1252
234 Ga0207683_10019771 3300026121 Bacteria 5753
235 Ga0268266_10000392 3300028379 Bacteria 66301
236 Ga0268266_10041736 3300028379 Bacteria 3916
237 Ga0268266_10192943 3300028379 Bacteria 1860
238 Ga0268264_10000057 3300028381 Bacteria 309824
239 Ga0268264_10000165 3300028381 Bacteria 147648
240 Ga0268264_10000348 3300028381 Bacteria 70273
241 Ga0268264_10028467 3300028381 Bacteria 4571
242 Ga0265326_10020091 3300028558 Bacteria 1915
243 Ga0265334_10000123 3300028573 Bacteria 50146
244 Ga0265318_10001505 3300028577 Bacteria 13592
245 Ga0265338_10166127 3300028800 Bacteria 1698
246 Ga0265330_10008236 3300031235 Bacteria 5029
247 Ga0265332_10001382 3300031238 Bacteria 13676
248 Ga0265328_10005954 3300031239 Bacteria 5192
249 Ga0265320_10011833 3300031240 Bacteria 5112
250 Ga0265325_10002595 3300031241 Bacteria 12116
251 Ga0265329_10020080 3300031242 Bacteria 2261
252 Ga0265340_10012263 3300031247 Bacteria 4528
253 Ga0265331_10007437 3300031250 Bacteria 6337
254 Ga0265316_10005931 3300031344 Bacteria 11762
255 Ga0307513_10021047 3300031456 Bacteria 7709
256 Ga0307513_10059942 3300031456 Bacteria 4037
257 Ga0307513_10141171 3300031456 Bacteria 2335
258 Ga0307513_10165239 3300031456 Bacteria 2099
259 Ga0307513_10250232 3300031456 Bacteria 1569
260 Ga0307509_10072934 3300031507 Bacteria 3576
261 Ga0307509_10179597 3300031507 Bacteria 1984
262 Ga0307408_100557977 3300031548 Bacteria 1012
263 Ga0265313_10002136 3300031595 Bacteria 17574
264 Ga0265342_10006567 3300031712 Bacteria 8650
265 Ga0307413_10061120 3300031824 Bacteria 2323
266 Ga0307410_10049321 3300031852 Bacteria 2826
267 Ga0307410_10053588 3300031852 Bacteria 2730
268 Ga0307407_10216051 3300031903 Bacteria 1293
269 Ga0307412_10133340 3300031911 Bacteria 1808
270 Ga0307412_10502353 3300031911 Bacteria 1010
271 Ga0307409_100008675 3300031995 Bacteria 6187
272 Ga0307409_100016041 3300031995 Bacteria 4941
273 Ga0307416_101005224 3300032002 Bacteria 937
274 Ga0307414_10148447 3300032004 Bacteria 1846
275 Ga0307411_10015429 3300032005 Bacteria 4290
276 Ga0307411_10034825 3300032005 Bacteria 3137
277 Ga0307411_10445462 3300032005 Bacteria 1082
278 Ga0307415_100628988 3300032126 Bacteria 959
279 Ga0307415_100636844 3300032126 Bacteria 954
280 Ga0307415_100659056 3300032126 Bacteria 939
281 Ga0307507_10190467 3300033179 Bacteria 1443
282 Ga0373923_0203558 3300035111 Bacteria 916
283 Ga0373931_0372205 3300035691 Bacteria 899
284 Ga0373947_0485325 3300035725 Bacteria 839
285 Ga0436365_1093700 3300039437 Bacteria 15149
286 Ga0436360_0096801 3300039438 Bacteria 5865
287 Ga0436360_0267653 3300039438 Bacteria 2362
288 Ga0436361_0575987 3300039447 Bacteria 1096
289 Ga0436363_1136908 3300039450 Bacteria 5012
290 Ga0451802_1845750 3300041460 Bacteria 1570
291 Ga0451804_0504125 3300041463 Bacteria 1354
292 Ga0451807_1311307 3300041486 Bacteria 1845
293 Ga0451807_2199412 3300041486 Bacteria 1595
294 Ga0451843_0801414 3300041509 Bacteria 959
295 Ga0451853_1109972 3300041512 Bacteria 1039
296 Ga0466969_0000848 3300044656 Bacteria 16567
297 Ga0466969_0002149 3300044656 Bacteria 10515
298 Ga0466966_0002077 3300044684 Bacteria 12990
299 Ga0466966_0006213 3300044684 Bacteria 7896
300 Ga0466961_0004818 3300044693 Bacteria 8489
301 Ga0466961_0317743 3300044693 Unclassified 950
302 Ga0466964_0000149 3300044706 Bacteria 18838
303 Ga0466971_0000098 3300044719 Bacteria 31871
304 Ga0466968_0069242 3300044735 Bacteria 1533
305 Ga0466970_0015595 3300044765 Bacteria 3911
306 Ga0466959_0007469 3300045049 Bacteria 7671
307 Ga0466959_0138786 3300045049 Bacteria 1719
308 Ga0466958_0058284 3300045836 Bacteria 2348
309 Ga0495590_0115618 3300046457 Unclassified 959
310 Ga0495638_0009860 3300046460 Bacteria 6665
311 Ga0495596_0149328 3300046500 Bacteria 908
312 Ga0495616_0005205 3300046513 Bacteria 8044
313 Ga0495632_0196343 3300046519 Bacteria 920
314 Ga0495632_0208849 3300046519 Bacteria 886
315 Ga0495621_0164207 3300046539 Unclassified 880
316 Ga0495668_0240220 3300046616 Bacteria 992
317 Ga0495668_0267772 3300046616 Bacteria 936
318 Ga0495625_0155429 3300046660 Bacteria 1535
319 Ga0495613_0159429 3300046689 Bacteria 1606
320 Ga0495649_0004842 3300046694 Bacteria 8707
321 Ga0495687_095006 3300047443 Bacteria 1132
322 Ga0495686_0064559 3300047472 Bacteria 2266
323 Ga0495686_0164438 3300047472 Bacteria 1294
324 Ga0496102_0165603 3300048905 Bacteria 2080
325 Ga0496104_0085092 3300048907 Bacteria 3018
326 Ga0496106_0286341 3300048909 Bacteria 1321
327 Ga0496112_0312994 3300048915 Bacteria 1515
328 Ga0496114_0235986 3300048917 Bacteria 1607
329 Ga0496114_0706066 3300048917 Bacteria 884
330 Ga0496119_0003238 3300048922 Bacteria 17043
331 Ga0496119_0171934 3300048922 Bacteria 1144
332 Ga0496120_0002153 3300048923 Bacteria 20987
333 Ga0496126_0003836 3300048929 Bacteria 18600
334 Ga0496126_0122192 3300048929 Bacteria 2257
335 Ga0501031_0127595 3300049568 Bacteria 1662
336 Ga0501042_0196984 3300049578 Bacteria 1453
337 Ga0501068_0015785 3300049584 Bacteria 4345
338 Ga0501068_0319193 3300049584 Unclassified 996
339 Ga0501069_0119901 3300049585 Bacteria 1502
340 Ga0501070_0035893 3300049586 Bacteria 4140
341 Ga0501072_0088797 3300049588 Bacteria 2453
342 Ga0501073_0003704 3300049589 Bacteria 11485
343 Ga0501073_0173201 3300049589 Bacteria 1494
344 Ga0501074_0000684 3300049590 Bacteria 21169
345 Ga0501076_0036570 3300049592 Bacteria 3848
346 Ga0501077_0001942 3300049593 Bacteria 12519
347 Ga0501077_0449080 3300049593 Bacteria 826
348 Ga0501079_0002114 3300049741 Bacteria 14276
349 Ga0501080_0012210 3300049742 Bacteria 7871
350 Ga0501080_0445600 3300049742 Bacteria 1161
351 Ga0501083_0009617 3300049744 Bacteria 6830
352 nmdc:mga08y16_469040_c1 3300050511 Bacteria 1282
353 nmdc:mga0rr50_319673_c1 3300050513 Bacteria 1301
354 nmdc:mga08x19_615560_c1 3300050514 Bacteria 770
355 Ga0500639_143199 3300053163 Bacteria 1114
356 Ga0500637_0154585 3300053178 Bacteria 1324
357 Ga0501084_0002232 3300054114 Bacteria 15556
358 Ga0501082_0064481 3300060353 Bacteria 3155
359 Ga0163163_10117324
360 rootL2_10282856
361 Ga0070676_10156974
362 Ga0070676_10290961
363 Ga0070683_100105701
364 Ga0070690_100118948
365 Ga0070670_100382079
366 Ga0070677_10016083
367 Ga0068869_100021831
368 Ga0068869_100142831
369 Ga0070680_100013113
370 Ga0070680_100057537
371 Ga0070680_100740160
372 Ga0070682_100046074
373 Ga0070682_100047605
374 Ga0070682_100217779
375 Ga0070682_100397515
376 Ga0068868_100193584
377 Ga0070689_100298474
378 Ga0070661_100031465
379 Ga0070668_100247406
380 Ga0070669_100114715
381 Ga0070669_100182003
382 Ga0070675_100031875
383 Ga0070675_100416351
384 Ga0070671_100449870
385 Ga0070674_100054158
386 Ga0070674_100176438
387 Ga0070673_100021345
388 Ga0070673_100261276
389 Ga0070688_100371573
390 Ga0070659_100282525
391 Ga0070709_10034065
392 Ga0070709_10248161
393 Ga0070714_100004315
394 Ga0070713_100023866
395 Ga0070713_100025532
396 Ga0070710_10141701
397 Ga0070701_10063867
398 Ga0070711_100067985
399 Ga0070705_100020816
400 Ga0070700_100015690
401 Ga0070700_100156394
402 Ga0070700_100327267
403 Ga0070700_100465641
404 Ga0070663_100093003
405 Ga0070678_100032825
406 Ga0070662_100210224
407 Ga0070681_10001003
408 Ga0070681_10024838
409 Ga0070681_10025547
410 Ga0070681_10701859
411 Ga0068867_100120092
412 Ga0068867_100185220
413 Ga0068867_100216558
414 Ga0068867_100247959
415 Ga0070685_10056326
416 Ga0070685_10163357
417 Ga0070685_10247209
418 Ga0070679_100003026
419 Ga0070679_100036533
420 Ga0070679_100071405
421 Ga0070679_100104501
422 Ga0070679_100128949
423 Ga0070684_100014025
424 Ga0070672_100049268
425 Ga0070672_100062485
426 Ga0070672_100348298
427 Ga0070686_100056112
428 Ga0070686_100155178
429 Ga0070695_100674368
430 Ga0070665_100058216
431 Ga0070665_100107403
432 Ga0070665_100881624
433 Ga0070704_100092500
434 Ga0068855_100000869
435 Ga0068855_100018851
436 Ga0068855_100259154
437 Ga0068856_100191530
438 Ga0070702_100034467
439 Ga0068859_100094212
440 Ga0068859_100940512
441 Ga0068861_100014658
442 Ga0068861_100019433
443 Ga0068861_100390781
444 Ga0068861_100397489
445 Ga0068861_100944628
446 Ga0068870_10054854
447 Ga0068863_100009858
448 Ga0068863_100075291
449 Ga0068863_100186412
450 Ga0068858_100229315
451 Ga0068858_100286160
452 Ga0068860_100002237
453 Ga0068860_100032073
454 Ga0068860_100063492
455 Ga0068862_100039408
456 Ga0068862_100126691
457 Ga0081455_10047035
458 Ga0070717_10002768
459 Ga0070716_100046078
460 Ga0097621_100204729
461 Ga0097621_100310994
462 Ga0068871_100027127
463 Ga0068871_100100639
464 Ga0068871_100251097
465 Ga0068871_100286127
466 Ga0068865_100399782
467 Ga0097620_100094217
468 Ga0097620_100940583
469 Ga0075435_100033964
470 Ga0105240_10001826
471 Ga0105240_10003206
472 Ga0105240_10022180
473 Ga0105240_10034970
474 Ga0105240_10095462
475 Ga0105240_10976370
476 Ga0111539_10194661
477 Ga0111539_10328448
478 Ga0105247_10056981
479 Ga0105241_10172823
480 Ga0105242_10115363
481 Ga0105242_10735589
482 Ga0105237_10239103
483 Ga0105237_10367831
484 Ga0105237_10377088
485 Ga0105237_10607093
486 Ga0105237_10698569
487 Ga0105238_10016949
488 Ga0105238_10109940
489 Ga0105238_10196716
490 Ga0105238_10225854
491 Ga0105238_10871980
492 Ga0105249_10131773
493 Ga0105249_10885524
494 Ga0105239_10062865
495 Ga0105239_10136799
496 Ga0157370_10017048
497 Ga0157370_10380912
498 Ga0157369_10033452
499 Ga0157369_10191615
500 Ga0157374_10511915
501 Ga0157374_10699967
502 Ga0157374_10997773
503 Ga0163162_10043852
504 Ga0163162_10204376
505 Ga0157372_10259271
506 Ga0157375_10054751
507 Ga0157375_10354069
508 Ga0157375_10896600
509 Ga0163163_10499155
510 Ga0157380_10015516
511 Ga0157380_10141908
512 Ga0157380_10206260
513 Ga0157380_11061675
514 Ga0157379_10121062
515 Ga0157379_10550357
516 Ga0163161_10193394
517 Ga0213874_10002465
518 Ga0213876_10056786
519 Ga0207682_10003364
520 Ga0207682_10008573
521 Ga0207642_10099190
522 Ga0207680_10368203
523 Ga0207699_10094015
524 Ga0207699_10206755
525 Ga0207645_10112943
526 Ga0207643_10008696
527 Ga0207707_10007902
528 Ga0207707_10039219
529 Ga0207707_10051618
530 Ga0207695_10007963
531 Ga0207695_10031140
532 Ga0207695_10037591
533 Ga0207695_10043310
534 Ga0207695_10165504
535 Ga0207671_10117445
536 Ga0207671_10236815
537 Ga0207671_10281717
538 Ga0207671_10521575
539 Ga0207693_10333162
540 Ga0207663_10008908
541 Ga0207663_10406719
542 Ga0207660_10013992
543 Ga0207662_10304785
544 Ga0207652_10019654
545 Ga0207652_10032325
546 Ga0207652_10339278
547 Ga0207652_10805295
548 Ga0207681_10108467
549 Ga0207681_10153292
550 Ga0207694_10117905
551 Ga0207694_10422162
552 Ga0207659_10019909
553 Ga0207659_10098459
554 Ga0207700_10029952
555 Ga0207664_10006704
556 Ga0207664_10670905
557 Ga0207706_10198588
558 Ga0207706_10240992
559 Ga0207670_10010864
560 Ga0207669_10047150
561 Ga0207669_10240834
562 Ga0207704_10333724
563 Ga0207665_10066454
564 Ga0207665_10082547
565 Ga0207691_10015054
566 Ga0207691_10019364
567 Ga0207711_10040202
568 Ga0207689_10008144
569 Ga0207689_10239002
570 Ga0207661_10121939
571 Ga0207679_10736638
572 Ga0207667_10016118
573 Ga0207667_10035166
574 Ga0207667_10838005
575 Ga0207651_10225688
576 Ga0207658_10075456
577 Ga0207703_10273767
578 Ga0207639_10773434
579 Ga0207678_10113724
580 Ga0207708_10059201
581 Ga0207708_10074170
582 Ga0207708_10097718
583 Ga0207641_10000247
584 Ga0207641_10096216
585 Ga0207641_10352848
586 Ga0207648_10341083
587 Ga0207675_100002808
588 Ga0207675_100014088
589 Ga0207675_100256278
590 Ga0207675_100393258
591 Ga0207675_100467375
592 Ga0207683_10019771
593 Ga0268266_10000392
594 Ga0268266_10041736
595 Ga0268266_10192943
596 Ga0268264_10000057
597 Ga0268264_10000165
598 Ga0268264_10000348
599 Ga0268264_10028467
600 Ga0265326_10020091
601 Ga0265334_10000123
602 Ga0265318_10001505
603 Ga0265338_10166127
604 Ga0265330_10008236
605 Ga0265332_10001382
606 Ga0265328_10005954
607 Ga0265320_10011833
608 Ga0265325_10002595
609 Ga0265329_10020080
610 Ga0265340_10012263
611 Ga0265331_10007437
612 Ga0265316_10005931
613 Ga0307513_10021047
614 Ga0307513_10059942
615 Ga0307513_10141171
616 Ga0307513_10165239
617 Ga0307513_10250232
618 Ga0307509_10072934
619 Ga0307509_10179597
620 Ga0307408_100557977
621 Ga0265313_10002136
622 Ga0265342_10006567
623 Ga0307413_10061120
624 Ga0307410_10049321
625 Ga0307410_10053588
626 Ga0307407_10216051
627 Ga0307412_10133340
628 Ga0307412_10502353
629 Ga0307409_100008675
630 Ga0307409_100016041
631 Ga0307416_101005224
632 Ga0307414_10148447
633 Ga0307411_10015429
634 Ga0307411_10034825
635 Ga0307411_10445462
636 Ga0307415_100628988
637 Ga0307415_100636844
638 Ga0307415_100659056
639 Ga0307507_10190467
640 Ga0373923_0203558
641 Ga0373931_0372205
642 Ga0373947_0485325
643 Ga0436365_1093700
644 Ga0436360_0096801
645 Ga0436360_0267653
646 Ga0436361_0575987
647 Ga0436363_1136908
648 Ga0451802_1845750
649 Ga0451804_0504125
650 Ga0451807_1311307
651 Ga0451807_2199412
652 Ga0451843_0801414
653 Ga0451853_1109972
654 Ga0466969_0000848
655 Ga0466969_0002149
656 Ga0466966_0002077
657 Ga0466966_0006213
658 Ga0466961_0004818
659 Ga0466961_0317743
660 Ga0466964_0000149
661 Ga0466971_0000098
662 Ga0466968_0069242
663 Ga0466970_0015595
664 Ga0466959_0007469
665 Ga0466959_0138786
666 Ga0466958_0058284
667 Ga0495590_0115618
668 Ga0495638_0009860
669 Ga0495596_0149328
670 Ga0495616_0005205
671 Ga0495632_0196343
672 Ga0495632_0208849
673 Ga0495621_0164207
674 Ga0495668_0240220
675 Ga0495668_0267772
676 Ga0495625_0155429
677 Ga0495613_0159429
678 Ga0495649_0004842
679 Ga0495687_095006
680 Ga0495686_0064559
681 Ga0495686_0164438
682 Ga0496102_0165603
683 Ga0496104_0085092
684 Ga0496106_0286341
685 Ga0496112_0312994
686 Ga0496114_0235986
687 Ga0496114_0706066
688 Ga0496119_0003238
689 Ga0496119_0171934
690 Ga0496120_0002153
691 Ga0496126_0003836
692 Ga0496126_0122192
693 Ga0501031_0127595
694 Ga0501042_0196984
695 Ga0501068_0015785
696 Ga0501068_0319193
697 Ga0501069_0119901
698 Ga0501070_0035893
699 Ga0501072_0088797
700 Ga0501073_0003704
701 Ga0501073_0173201
702 Ga0501074_0000684
703 Ga0501076_0036570
704 Ga0501077_0001942
705 Ga0501077_0449080
706 Ga0501079_0002114
707 Ga0501080_0012210
708 Ga0501080_0445600
709 Ga0501083_0009617
710 nmdc:mga08y16_469040_c1
711 nmdc:mga0rr50_319673_c1
712 nmdc:mga08x19_615560_c1
713 Ga0500639_143199
714 Ga0500637_0154585
715 Ga0501084_0002232
716 Ga0501082_0064481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

120

244

0.95

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

55

118

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.8825 25 210
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.8692 25 210
4ki3-assembly4.cif.gz_L 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.869 29 207
4ki3-assembly4.cif.gz_J 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8668 29 208
3ksn-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.8651 29 208
ID Description Score Start End Superfamily
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8522 29 207 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8326 30 208 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.813 29 207 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7948 30 208 2.50.20.10
2yzyA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7227 29 208 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A534BZD5-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9642 94 213 GO:0015031
AF-A0A3B1ASP8-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9458 29 210 GO:0042597
GO:0042953
AF-A0A1G0G4T5-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9434 27 208 GO:0042597
GO:0042953
GO:0044874
AF-A0A381S344-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9403 29 208 GO:0042597
GO:0042953
AF-A0A1Q6WCL3-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9383 18 213 GO:0030288
GO:0042953
GO:0044874

Map