F421148

General Info

Members Datasets Scaffolds Average Seq Length
358 231 351 406

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10002398|Ga0105244_100023987
Length 428
Sequence MSDKLSHPAGQAPVHAPLEQFPVRDDCLQVGGVPLTRLAAQLGRTPFYAYDRHAITRRVAELRAALPPGVQLHYAMKANPMPAVVQHLAGLVDGIDVASGNELRVALDTGVAPADISFAGPGKXXXXLSCAVAAGVIINVESEAELDRIAAIGLSLDIRPQVALRVNPDFELKSSGMRMGGGARQFGIDAELVPALLQRLAAMPVDWHGLHIFSGSQNLKAAALQEAHQQTLALAMRLAEFAPRPMRLLNIGGGFGIPYFPGEQRLDVAAVGANLALLLPDVRRALPEAQIVIELGRYLVGEAGVYVSRVIERKVSRGQVFLVTDGGLHHHLSASGNFGQVIRKNYPVVIGNRVHGEARETVSVVGPLCTPLDLLADRMELAAAGPGDLVAVLQSGAYGLSASPGGFLSHPAALEVLVGQQDRDGAAS

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
4 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
5 2904424332 Duganella sp. 1411 Isolate Rhizosphere
6 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
223 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 2.51
Rhizosphere 85.47
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001170 3300002987 Bacteria 11190
2 rootL2_10072033 3300003322 Bacteria 16358
3 JGI25160J50197_1000475 3300003354 Bacteria 24419
4 JGI25161J50226_1000284 3300003374 Bacteria 28967
5 Ga0055526_1000510 3300003771 Bacteria 30940
6 Ga0055537_1000420 3300003773 Bacteria 27690
7 Ga0055537_1001560 3300003773 Bacteria 8741
8 Ga0055524_1000699 3300003775 Bacteria 23355
9 Ga0055534_1007007 3300003784 Bacteria 2753
10 Ga0055530_10001082 3300003791 Bacteria 21457
11 Ga0070683_100217173 3300005329 Bacteria 1817
12 Ga0068869_100083956 3300005334 Bacteria 2383
13 Ga0068869_100086569 3300005334 Bacteria 2349
14 Ga0068868_100087241 3300005338 Bacteria 2509
15 Ga0070661_100005057 3300005344 Bacteria 9096
16 Ga0070661_100098954 3300005344 Bacteria 2166
17 Ga0070661_100118042 3300005344 Bacteria 1985
18 Ga0070668_100031714 3300005347 Bacteria 4021
19 Ga0070688_100174514 3300005365 Bacteria 1486
20 Ga0070659_100002775 3300005366 Bacteria 12467
21 Ga0070667_100038424 3300005367 Bacteria 4013
22 Ga0070667_100057412 3300005367 Bacteria 3290
23 Ga0070714_100002905 3300005435 Bacteria 12677
24 Ga0070714_100013274 3300005435 Bacteria 6598
25 Ga0070714_100014706 3300005435 Bacteria 6289
26 Ga0070714_100069898 3300005435 Bacteria 3033
27 Ga0070711_100133285 3300005439 Bacteria 1853
28 Ga0070681_10032708 3300005458 Bacteria 5222
29 Ga0070681_10205614 3300005458 Bacteria 1886
30 Ga0070681_10271426 3300005458 Bacteria 1607
31 Ga0070679_100095267 3300005530 Bacteria 2964
32 Ga0070684_100012201 3300005535 Bacteria 6874
33 Ga0068853_100019385 3300005539 Bacteria 5639
34 Ga0070672_100000870 3300005543 Bacteria 18088
35 Ga0070665_100202953 3300005548 Bacteria 1983
36 Ga0068855_100008614 3300005563 Bacteria 12325
37 Ga0068855_100474873 3300005563 Bacteria 1362
38 Ga0070664_100053195 3300005564 Bacteria 3431
39 Ga0070664_100067634 3300005564 Unclassified 3053
40 Ga0068857_100083549 3300005577 Bacteria 2853
41 Ga0068856_100023154 3300005614 Bacteria 6041
42 Ga0068856_100031419 3300005614 Bacteria 5194
43 Ga0068852_100045642 3300005616 Bacteria 3728
44 Ga0068852_100217221 3300005616 Bacteria 1817
45 Ga0068859_100209344 3300005617 Bacteria 2036
46 Ga0068861_100009861 3300005719 Bacteria 6605
47 Ga0068858_100002433 3300005842 Bacteria 18846
48 Ga0068860_100007636 3300005843 Bacteria 10821
49 Ga0068860_100150606 3300005843 Bacteria 2240
50 Ga0075366_10021802 3300006195 Bacteria 3725
51 Ga0075366_10145942 3300006195 Bacteria 1432
52 Ga0097620_100209344 3300006931 Bacteria 2036
53 Ga0105244_10002398 3300009036 Bacteria 14164
54 Ga0105244_10009578 3300009036 Bacteria 5940
55 Ga0105240_10004096 3300009093 Bacteria 22384
56 Ga0105240_10133670 3300009093 Bacteria 2972
57 Ga0105240_10315769 3300009093 Bacteria 1783
58 Ga0111539_10016278 3300009094 Bacteria 9222
59 Ga0111539_10139249 3300009094 Bacteria 2842
60 Ga0105245_10038208 3300009098 Bacteria 4271
61 Ga0105248_10000352 3300009177 Bacteria 53816
62 Ga0105238_10014627 3300009551 Bacteria 7935
63 Ga0105238_10135991 3300009551 Bacteria 2435
64 Ga0105249_10186516 3300009553 Bacteria 2021
65 Ga0105239_10165383 3300010375 Bacteria 2473
66 Ga0105239_10172299 3300010375 Bacteria 2420
67 Ga0157371_10139713 3300013102 Bacteria 1725
68 Ga0157370_10001007 3300013104 Bacteria 35559
69 Ga0157370_10010749 3300013104 Bacteria 9625
70 Ga0157370_10027739 3300013104 Bacteria 5582
71 Ga0157370_10115672 3300013104 Bacteria 2505
72 Ga0157370_10226831 3300013104 Bacteria 1729
73 Ga0157369_10004725 3300013105 Bacteria 16008
74 Ga0157369_10011537 3300013105 Bacteria 10036
75 Ga0157369_10123349 3300013105 Bacteria 2748
76 Ga0157374_10048953 3300013296 Bacteria 3924
77 Ga0163162_10039803 3300013306 Bacteria 4698
78 Ga0157372_10030949 3300013307 Bacteria 5857
79 Ga0157372_10035568 3300013307 Bacteria 5484
80 Ga0157372_10047447 3300013307 Bacteria 4773
81 Ga0157375_10003790 3300013308 Bacteria 13103
82 Ga0157379_10000816 3300014968 Bacteria 25283
83 Ga0157379_10003029 3300014968 Bacteria 14198
84 Ga0209436_100189 3300025208 Bacteria 28835
85 Ga0209565_1000425 3300025263 Bacteria 34065
86 Ga0209565_1000515 3300025263 Bacteria 27877
87 Ga0209565_1002805 3300025263 Bacteria 6029
88 Ga0209565_1003818 3300025263 Bacteria 4755
89 Ga0209673_1002853 3300025273 Bacteria 11059
90 Ga0209675_1002267 3300025291 Bacteria 10034
91 Ga0209564_1000067 3300025295 Bacteria 311242
92 Ga0209050_1000123 3300025298 Bacteria 195061
93 Ga0209256_1000631 3300025299 Bacteria 48392
94 Ga0207655_1035111 3300025728 Bacteria 2244
95 Ga0207680_10067889 3300025903 Bacteria 2198
96 Ga0207707_10030251 3300025912 Bacteria 4737
97 Ga0207695_10041425 3300025913 Bacteria 4929
98 Ga0207657_10001836 3300025919 Bacteria 22933
99 Ga0207652_10221921 3300025921 Bacteria 1703
100 Ga0207681_10144921 3300025923 Bacteria 1773
101 Ga0207694_10118007 3300025924 Bacteria 2116
102 Ga0207694_10218594 3300025924 Bacteria 1553
103 Ga0207664_10011480 3300025929 Bacteria 6301
104 Ga0207664_10038133 3300025929 Bacteria 3725
105 Ga0207664_10049360 3300025929 Bacteria 3313
106 Ga0207644_10236955 3300025931 Bacteria 1452
107 Ga0207706_10085782 3300025933 Bacteria 2768
108 Ga0207691_10001020 3300025940 Bacteria 27731
109 Ga0207711_10031676 3300025941 Bacteria 4465
110 Ga0207679_10027235 3300025945 Bacteria 3951
111 Ga0207679_10116469 3300025945 Bacteria 2119
112 Ga0207667_10000034 3300025949 Bacteria 304569
113 Ga0207667_10020652 3300025949 Bacteria 7319
114 Ga0207667_10036391 3300025949 Bacteria 5276
115 Ga0207667_10081500 3300025949 Bacteria 3352
116 Ga0207667_10146272 3300025949 Bacteria 2433
117 Ga0207651_10010320 3300025960 Bacteria 5170
118 Ga0207668_10062492 3300025972 Bacteria 2622
119 Ga0207658_10046844 3300025986 Bacteria 3160
120 Ga0207677_10071890 3300026023 Bacteria 2443
121 Ga0207703_10018930 3300026035 Bacteria 5379
122 Ga0207639_10288680 3300026041 Bacteria 1445
123 Ga0207702_10079386 3300026078 Bacteria 2844
124 Ga0207641_10233059 3300026088 Bacteria 1712
125 Ga0207674_10003872 3300026116 Bacteria 18241
126 Ga0207683_10038124 3300026121 Bacteria 4186
127 Ga0207698_10269317 3300026142 Bacteria 1569
128 Ga0209974_10004339 3300027876 Bacteria 5042
129 Ga0209974_10028210 3300027876 Bacteria 1858
130 Ga0268264_10121578 3300028381 Bacteria 2302
131 Ga0307408_100000491 3300031548 Bacteria 34515
132 Ga0307408_100000893 3300031548 Bacteria 23439
133 Ga0307408_100005663 3300031548 Bacteria 8324
134 Ga0316576_10019633 3300031727 Bacteria 4633
135 Ga0316578_10034072 3300031728 Bacteria 2922
136 Ga0307413_10002524 3300031824 Bacteria 7466
137 Ga0307410_10000366 3300031852 Bacteria 17633
138 Ga0307406_10020445 3300031901 Bacteria 3898
139 Ga0307407_10000991 3300031903 Bacteria 9735
140 Ga0307409_100002685 3300031995 Bacteria 9374
141 Ga0307416_100017815 3300032002 Bacteria 4983
142 Ga0307411_10011959 3300032005 Bacteria 4711
143 Ga0307415_100015403 3300032126 Bacteria 4527
144 Ga0373956_0029515 3300035119 Bacteria 2392
145 Ga0316574_0002206 3300035398 Bacteria 9677
146 Ga0316574_0125631 3300035398 Bacteria 1649
147 Ga0373937_0001705 3300036401 Bacteria 18461
148 Ga0316582_0181035 3300036647 Bacteria 1434
149 Ga0395898_0187794 3300037466 Bacteria 1975
150 Ga0395905_0001714 3300037471 Bacteria 25744
151 Ga0395905_0006078 3300037471 Bacteria 12208
152 Ga0400484_18113 3300038725 Bacteria 2939
153 Ga0436361_0232519 3300039447 Bacteria 2806
154 Ga0436361_0834907 3300039447 Bacteria 30047
155 Ga0436361_1222461 3300039447 Bacteria 33037
156 Ga0451837_0521702 3300041494 Bacteria 4313
157 Ga0451843_1092302 3300041509 Bacteria 5564
158 Ga0453684_0000625 3300044712 Bacteria 128854
159 Ga0453684_0061101 3300044712 Bacteria 4840
160 Ga0453684_0158721 3300044712 Unclassified 2677
161 Ga0466968_0024403 3300044735 Bacteria 2470
162 Ga0466970_0039009 3300044765 Bacteria 2520
163 Ga0466970_0056740 3300044765 Bacteria 2093
164 Ga0466967_0073689 3300045976 Bacteria 3064
165 Ga0495627_000015 3300046453 Bacteria 320787
166 Ga0495592_0194616 3300046454 Unclassified 1372
167 Ga0495590_0000002 3300046457 Bacteria 485720
168 Ga0495590_0000274 3300046457 Bacteria 27955
169 Ga0495590_0029179 3300046457 Bacteria 1934
170 Ga0495629_0016744 3300046459 Bacteria 5261
171 Ga0495638_0000030 3300046460 Bacteria 318183
172 Ga0495638_0000817 3300046460 Bacteria 32810
173 Ga0495638_0013605 3300046460 Bacteria 5529
174 Ga0495651_0009576 3300046462 Bacteria 7444
175 Ga0495653_0078523 3300046463 Bacteria 2447
176 Ga0495653_0158739 3300046463 Bacteria 1572
177 Ga0495650_0000084 3300046471 Bacteria 235690
178 Ga0495650_0000783 3300046471 Bacteria 39005
179 Ga0495639_0002695 3300046475 Bacteria 7720
180 Ga0495584_0005501 3300046491 Bacteria 6707
181 Ga0495584_0036636 3300046491 Bacteria 2478
182 Ga0495584_0061058 3300046491 Bacteria 1894
183 Ga0495585_0000514 3300046492 Bacteria 36605
184 Ga0495585_0022721 3300046492 Bacteria 3600
185 Ga0495594_0062585 3300046499 Bacteria 2060
186 Ga0495596_0000134 3300046500 Bacteria 51163
187 Ga0495596_0006420 3300046500 Bacteria 5409
188 Ga0495607_0000989 3300046501 Bacteria 26254
189 Ga0495607_0001377 3300046501 Bacteria 21615
190 Ga0495583_0000058 3300046506 Bacteria 200120
191 Ga0495583_0000285 3300046506 Bacteria 80736
192 Ga0495583_0000550 3300046506 Bacteria 52418
193 Ga0495606_0001240 3300046507 Bacteria 35633
194 Ga0495606_0021487 3300046507 Bacteria 4727
195 Ga0495610_0000380 3300046512 Bacteria 45916
196 Ga0495616_0000070 3300046513 Bacteria 89133
197 Ga0495616_0058581 3300046513 Bacteria 1896
198 Ga0495630_0006373 3300046517 Bacteria 8390
199 Ga0495631_0000884 3300046518 Bacteria 18747
200 Ga0495631_0000937 3300046518 Bacteria 18203
201 Ga0495632_0000092 3300046519 Bacteria 92510
202 Ga0495632_0033106 3300046519 Bacteria 2656
203 Ga0495643_0000078 3300046522 Bacteria 162974
204 Ga0495644_0005088 3300046523 Bacteria 5145
205 Ga0495644_0007149 3300046523 Bacteria 4313
206 Ga0495644_0018518 3300046523 Bacteria 2661
207 Ga0495648_0000009 3300046524 Bacteria 317193
208 Ga0495648_0002660 3300046524 Bacteria 16173
209 Ga0495648_0041845 3300046524 Bacteria 2889
210 Ga0495666_0040370 3300046526 Bacteria 2263
211 Ga0495666_0059575 3300046526 Bacteria 1826
212 Ga0495642_0004757 3300046528 Bacteria 5251
213 Ga0495652_0006682 3300046529 Bacteria 10707
214 Ga0495652_0022119 3300046529 Bacteria 5647
215 Ga0495654_0004838 3300046530 Bacteria 7926
216 Ga0495665_0014578 3300046531 Bacteria 4237
217 Ga0495586_0006344 3300046535 Bacteria 6319
218 Ga0495609_0000071 3300046538 Bacteria 126994
219 Ga0495609_0000463 3300046538 Bacteria 32922
220 Ga0495609_0000567 3300046538 Bacteria 29027
221 Ga0495609_0000755 3300046538 Bacteria 24396
222 Ga0495609_0003314 3300046538 Bacteria 9288
223 Ga0495597_0000014 3300046542 Bacteria 177043
224 Ga0495597_0005371 3300046542 Bacteria 6793
225 Ga0495597_0038018 3300046542 Bacteria 2159
226 Ga0495622_0000194 3300046557 Bacteria 48429
227 Ga0495633_0000439 3300046558 Bacteria 43047
228 Ga0495633_0010569 3300046558 Bacteria 5029
229 Ga0495633_0034512 3300046558 Bacteria 2433
230 Ga0495633_0085422 3300046558 Bacteria 1467
231 Ga0495668_0000029 3300046616 Bacteria 279128
232 Ga0495668_0000598 3300046616 Bacteria 43902
233 Ga0495668_0033837 3300046616 Bacteria 2870
234 Ga0495634_0004293 3300046642 Bacteria 11235
235 Ga0495625_0000023 3300046660 Bacteria 274067
236 Ga0495625_0002930 3300046660 Bacteria 17810
237 Ga0495635_0000912 3300046663 Bacteria 19394
238 Ga0495635_0152322 3300046663 Bacteria 1574
239 Ga0495659_0000382 3300046664 Bacteria 17044
240 Ga0495659_0003110 3300046664 Bacteria 5328
241 Ga0495659_0007101 3300046664 Bacteria 3543
242 Ga0495661_0000738 3300046665 Bacteria 31873
243 Ga0495661_0008444 3300046665 Bacteria 7123
244 Ga0495588_0009827 3300046674 Bacteria 4435
245 Ga0495588_0021480 3300046674 Bacteria 3180
246 Ga0495599_0059356 3300046678 Bacteria 2393
247 Ga0495623_0002051 3300046679 Bacteria 13514
248 Ga0495669_0001034 3300046684 Bacteria 11596
249 Ga0495613_0061589 3300046689 Bacteria 2747
250 Ga0495670_0000266 3300046691 Bacteria 24408
251 Ga0495671_0043536 3300046692 Bacteria 2253
252 Ga0495589_0018161 3300046794 Bacteria 3608
253 Ga0495600_0059053 3300046809 Bacteria 2505
254 Ga0495660_0000262 3300046810 Bacteria 50018
255 Ga0495660_0001361 3300046810 Bacteria 16826
256 Ga0495660_0002661 3300046810 Bacteria 11313
257 Ga0495660_0010930 3300046810 Bacteria 5275
258 Ga0495604_0020333 3300047317 Bacteria 5304
259 Ga0495604_0025791 3300047317 Bacteria 4681
260 Ga0495636_0025440 3300047318 Bacteria 2404
261 Ga0495672_0000248 3300047320 Bacteria 75549
262 Ga0495672_0000365 3300047320 Bacteria 57793
263 Ga0495680_0008264 3300047322 Bacteria 9479
264 Ga0495680_0154246 3300047322 Bacteria 1672
265 Ga0495683_0002009 3300047323 Bacteria 12644
266 Ga0495683_0012946 3300047323 Bacteria 4372
267 Ga0495687_001440 3300047443 Bacteria 21858
268 Ga0495687_001853 3300047443 Bacteria 18472
269 Ga0495675_0002798 3300047444 Bacteria 10468
270 Ga0495677_0000227 3300047445 Bacteria 25762
271 Ga0495685_001421 3300047447 Bacteria 7309
272 Ga0495685_010299 3300047447 Bacteria 3133
273 Ga0495673_0059057 3300047469 Bacteria 1650
274 Ga0495681_0000281 3300047470 Bacteria 40719
275 Ga0495681_0001325 3300047470 Bacteria 18736
276 Ga0495681_0010966 3300047470 Bacteria 5441
277 Ga0495686_0000333 3300047472 Bacteria 77831
278 Ga0495686_0000580 3300047472 Bacteria 51823
279 Ga0495593_0008288 3300047673 Bacteria 6046
280 Ga0495602_0000683 3300048088 Bacteria 31866
281 Ga0495626_0000190 3300048091 Bacteria 74560
282 Ga0495626_0034571 3300048091 Bacteria 2417
283 Ga0496101_0139204 3300048904 Bacteria 1849
284 Ga0496102_0000024 3300048905 Bacteria 227873
285 Ga0496103_0000863 3300048906 Bacteria 22035
286 Ga0496103_0010642 3300048906 Bacteria 5442
287 Ga0496109_0067191 3300048912 Bacteria 3284
288 Ga0496109_0112570 3300048912 Unclassified 2531
289 Ga0496110_0465394 3300048913 Bacteria 1152
290 Ga0496112_0072262 3300048915 Bacteria 3410
291 Ga0496114_0145457 3300048917 Bacteria 2054
292 Ga0496120_0019054 3300048923 Bacteria 4402
293 Ga0496121_0003447 3300048924 Bacteria 22590
294 Ga0496121_0033204 3300048924 Bacteria 4675
295 Ga0496122_0028731 3300048925 Bacteria 4708
296 Ga0496123_0003209 3300048926 Bacteria 18639
297 Ga0496124_0035297 3300048927 Bacteria 4376
298 Ga0496124_0037315 3300048927 Bacteria 4228
299 Ga0496124_0073626 3300048927 Bacteria 2826
300 Ga0496124_0200629 3300048927 Bacteria 1517
301 Ga0496125_0000718 3300048928 Bacteria 54870
302 Ga0495678_002025 3300049459 Bacteria 14524
303 Ga0495678_008260 3300049459 Bacteria 5275
304 Ga0495678_039757 3300049459 Bacteria 1895
305 Ga0495682_0002370 3300049460 Bacteria 8946
306 Ga0501031_0006084 3300049568 Bacteria 7878
307 Ga0501032_0019908 3300049569 Bacteria 4684
308 Ga0501036_0002218 3300049572 Bacteria 15188
309 Ga0501036_0109394 3300049572 Bacteria 2335
310 Ga0501037_0001468 3300049573 Bacteria 17290
311 Ga0501038_0011002 3300049574 Bacteria 8261
312 Ga0501038_0112362 3300049574 Bacteria 2255
313 Ga0501039_0000202 3300049575 Bacteria 43179
314 Ga0501040_0000466 3300049576 Bacteria 24065
315 Ga0501041_0004274 3300049577 Bacteria 8266
316 Ga0501043_0075291 3300049579 Bacteria 2652
317 Ga0501046_0012480 3300049580 Bacteria 7230
318 Ga0501046_0027757 3300049580 Bacteria 4615
319 Ga0501048_0002634 3300049582 Bacteria 13725
320 Ga0501069_0010158 3300049585 Bacteria 4980
321 Ga0501070_0006134 3300049586 Bacteria 10246
322 Ga0501071_0000366 3300049587 Bacteria 22123
323 Ga0501071_0100140 3300049587 Bacteria 2136
324 Ga0501072_0000417 3300049588 Bacteria 30399
325 Ga0501072_0238954 3300049588 Bacteria 1447
326 Ga0501074_0022521 3300049590 Bacteria 4578
327 Ga0501075_0000049 3300049591 Bacteria 50033
328 Ga0501075_0018765 3300049591 Bacteria 5012
329 Ga0501075_0139378 3300049591 Bacteria 1848
330 Ga0501076_0000013 3300049592 Bacteria 106369
331 Ga0501076_0019112 3300049592 Bacteria 5231
332 Ga0501077_0002606 3300049593 Bacteria 10808
333 Ga0501079_0001362 3300049741 Bacteria 17190
334 Ga0501080_0002691 3300049742 Bacteria 15568
335 Ga0501081_0000027 3300049743 Bacteria 53208
336 Ga0501083_0017991 3300049744 Bacteria 4929
337 Ga0501269_000060 3300049766 Bacteria 33989
338 Ga0501279_000388 3300049775 Bacteria 5828
339 Ga0501035_0019026 3300049822 Bacteria 6320
340 Ga0501035_0056973 3300049822 Bacteria 3485
341 nmdc:mga0k408_136918_c1 3300050493 Bacteria 1455
342 nmdc:mga0k408_20247_c1 3300050493 Bacteria 3725
343 nmdc:mga09592_107152_c1 3300050508 Bacteria 2397
344 nmdc:mga09592_904_c1 3300050508 Bacteria 23315
345 nmdc:mga0qj67_24858_c1 3300050509 Bacteria 3958
346 nmdc:mga0qj67_28838_c1 3300050509 Bacteria 4309
347 nmdc:mga0qj67_65737_c1 3300050509 Bacteria 2887
348 Ga0500590_002472 3300053148 Bacteria 8219
349 Ga0501082_0002383 3300060353 Bacteria 16466
350 Ga0501082_0351281 3300060353 Bacteria 1285
351 Ga0530510_0000076 3300061734 Bacteria 51053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0465394 Ga0496110_0465394_16_1047 336
2 3300046526 Ga0495666_0040370 Ga0495666_0040370_694_1806 347
3 3300037466 Ga0395898_0187794 Ga0395898_0187794_220_1452 356
4 3300049572 Ga0501036_0109394 Ga0501036_0109394_151_1227 358
5 3300036647 Ga0316582_0181035 Ga0316582_0181035_301_1395 364
6 3300038725 Ga0400484_18113 Ga0400484_18113_1542_2771 372
7 iso_pu_bacteria 2501939600 2501943626 374
8 iso_pu_bacteria 2856858025 2856863544 374
9 iso_pu_bacteria 649633069 649814691 374
10 3300009551 Ga0105238_10014627 Ga0105238_100146276 377
11 3300013102 Ga0157371_10139713 Ga0157371_101397132 377
12 3300013104 Ga0157370_10027739 Ga0157370_100277395 377
13 3300013105 Ga0157369_10004725 Ga0157369_1000472511 377
14 3300037471 Ga0395905_0006078 Ga0395905_0006078_8967_10199 377
15 3300005334 Ga0068869_100086569 Ga0068869_1000865692 386
16 3300005338 Ga0068868_100087241 Ga0068868_1000872412 386
17 3300005435 Ga0070714_100013274 Ga0070714_1000132745 386
18 3300005539 Ga0068853_100019385 Ga0068853_1000193852 386
19 3300005719 Ga0068861_100009861 Ga0068861_1000098615 386
20 3300005843 Ga0068860_100150606 Ga0068860_1001506062 386
21 3300009177 Ga0105248_10000352 Ga0105248_1000035246 386
22 3300009551 Ga0105238_10135991 Ga0105238_101359912 386
23 3300009553 Ga0105249_10186516 Ga0105249_101865162 386
24 3300010375 Ga0105239_10172299 Ga0105239_101722992 386
25 3300013296 Ga0157374_10048953 Ga0157374_100489532 386
26 3300013306 Ga0163162_10039803 Ga0163162_100398033 386
27 3300013307 Ga0157372_10030949 Ga0157372_100309493 386
28 3300013307 Ga0157372_10047447 Ga0157372_100474473 386
29 3300014968 Ga0157379_10003029 Ga0157379_1000302912 386
30 3300025913 Ga0207695_10041425 Ga0207695_100414253 386
31 3300025924 Ga0207694_10118007 Ga0207694_101180072 386
32 3300025929 Ga0207664_10038133 Ga0207664_100381333 386
33 3300025931 Ga0207644_10236955 Ga0207644_102369552 386
34 3300025941 Ga0207711_10031676 Ga0207711_100316762 386
35 3300025949 Ga0207667_10146272 Ga0207667_101462722 386
36 3300026023 Ga0207677_10071890 Ga0207677_100718901 386
37 3300026088 Ga0207641_10233059 Ga0207641_102330591 386
38 3300026121 Ga0207683_10038124 Ga0207683_100381242 386
39 3300028381 Ga0268264_10121578 Ga0268264_101215782 386
40 3300046663 Ga0495635_0152322 Ga0495635_0152322_391_1551 386
41 3300046692 Ga0495671_0043536 Ga0495671_0043536_689_1930 386
42 3300046810 Ga0495660_0002661 Ga0495660_0002661_2011_3252 386
43 3300048912 Ga0496109_0112570 Ga0496109_0112570_886_2115 386
44 3300049568 Ga0501031_0006084 Ga0501031_0006084_4401_5561 386
45 3300005329 Ga0070683_100217173 Ga0070683_1002171731 387
46 3300005344 Ga0070661_100005057 Ga0070661_1000050578 387
47 3300005435 Ga0070714_100069898 Ga0070714_1000698982 387
48 3300005458 Ga0070681_10205614 Ga0070681_102056142 387
49 3300005535 Ga0070684_100012201 Ga0070684_1000122012 387
50 3300005564 Ga0070664_100053195 Ga0070664_1000531952 387
51 3300005577 Ga0068857_100083549 Ga0068857_1000835492 387
52 3300005614 Ga0068856_100023154 Ga0068856_1000231542 387
53 3300005616 Ga0068852_100045642 Ga0068852_1000456422 387
54 3300025924 Ga0207694_10218594 Ga0207694_102185942 387
55 3300025929 Ga0207664_10049360 Ga0207664_100493602 387
56 3300025949 Ga0207667_10081500 Ga0207667_100815003 387
57 3300026041 Ga0207639_10288680 Ga0207639_102886801 387
58 3300026116 Ga0207674_10003872 Ga0207674_1000387215 387
59 3300046558 Ga0495633_0034512 Ga0495633_0034512_187_1428 387
60 3300049775 Ga0501279_000388 Ga0501279_000388_2415_3659 388
61 3300027876 Ga0209974_10004339 Ga0209974_100043392 389
62 3300048906 Ga0496103_0000863 Ga0496103_0000863_9541_10806 394
63 3300005563 Ga0068855_100008614 Ga0068855_1000086144 396
64 3300009093 Ga0105240_10315769 Ga0105240_103157692 396
65 3300013105 Ga0157369_10011537 Ga0157369_100115372 396
66 3300025949 Ga0207667_10036391 Ga0207667_100363912 396
67 3300046513 Ga0495616_0000070 Ga0495616_0000070_43566_44795 396
68 3300046518 Ga0495631_0000937 Ga0495631_0000937_3278_4507 396
69 3300046530 Ga0495654_0004838 Ga0495654_0004838_3814_5043 396
70 3300025263 Ga0209565_1003818 Ga0209565_10038183 398
71 3300046457 Ga0495590_0029179 Ga0495590_0029179_390_1625 398
72 3300046460 Ga0495638_0013605 Ga0495638_0013605_121_1356 398
73 3300046501 Ga0495607_0001377 Ga0495607_0001377_10336_11571 398
74 3300046538 Ga0495609_0000071 Ga0495609_0000071_76319_77554 398
75 3300046664 Ga0495659_0003110 Ga0495659_0003110_2252_3487 398
76 3300046665 Ga0495661_0008444 Ga0495661_0008444_1772_3007 398
77 3300047470 Ga0495681_0010966 Ga0495681_0010966_2174_3409 398
78 3300048925 Ga0496122_0028731 Ga0496122_0028731_3193_4419 399
79 3300048926 Ga0496123_0003209 Ga0496123_0003209_13713_14939 399
80 3300049766 Ga0501269_000060 Ga0501269_000060_18380_19654 399
81 3300013104 Ga0157370_10115672 Ga0157370_101156722 401
82 3300039447 Ga0436361_0834907 Ga0436361_0834907_15772_16977 401
83 3300039447 Ga0436361_1222461 Ga0436361_1222461_14557_15762 401
84 3300044712 Ga0453684_0158721 Ga0453684_0158721_607_1812 401
85 3300046454 Ga0495592_0194616 Ga0495592_0194616_64_1269 401
86 3300046529 Ga0495652_0022119 Ga0495652_0022119_2109_3314 401
87 3300046678 Ga0495599_0059356 Ga0495599_0059356_546_1751 401
88 3300047318 Ga0495636_0025440 Ga0495636_0025440_162_1367 401
89 3300049569 Ga0501032_0019908 Ga0501032_0019908_2873_4078 401
90 3300049574 Ga0501038_0011002 Ga0501038_0011002_6319_7524 401
91 3300049822 Ga0501035_0056973 Ga0501035_0056973_946_2151 401
92 3300050508 nmdc:mga09592_107152_c1 nmdc:mga09592_107152_c1_1181_2386 401
93 3300050509 nmdc:mga0qj67_28838_c1 nmdc:mga0qj67_28838_c1_727_1932 401
94 3300053148 Ga0500590_002472 Ga0500590_002472_6554_7759 401
95 3300060353 Ga0501082_0351281 Ga0501082_0351281_60_1268 401
96 3300025945 Ga0207679_10116469 Ga0207679_101164692 402
97 3300027876 Ga0209974_10028210 Ga0209974_100282102 402
98 3300031548 Ga0307408_100000893 Ga0307408_10000089314 402
99 3300031824 Ga0307413_10002524 Ga0307413_100025243 402
100 3300031852 Ga0307410_10000366 Ga0307410_1000036614 402
101 3300031901 Ga0307406_10020445 Ga0307406_100204453 402
102 3300031903 Ga0307407_10000991 Ga0307407_100009913 402
103 3300031995 Ga0307409_100002685 Ga0307409_1000026859 402
104 3300032002 Ga0307416_100017815 Ga0307416_1000178153 402
105 3300032005 Ga0307411_10011959 Ga0307411_100119593 402
106 3300032126 Ga0307415_100015403 Ga0307415_1000154032 402
107 3300013105 Ga0157369_10123349 Ga0157369_101233492 403
108 3300013307 Ga0157372_10035568 Ga0157372_100355682 403
109 3300025949 Ga0207667_10020652 Ga0207667_100206524 403
110 3300009094 Ga0111539_10016278 Ga0111539_100162784 404
111 3300010375 Ga0105239_10165383 Ga0105239_101653831 404
112 3300025933 Ga0207706_10085782 Ga0207706_100857822 404
113 3300048912 Ga0496109_0067191 Ga0496109_0067191_555_1790 404
114 3300048917 Ga0496114_0145457 Ga0496114_0145457_52_1287 404
115 3300005458 Ga0070681_10032708 Ga0070681_100327081 405
116 3300005530 Ga0070679_100095267 Ga0070679_1000952672 405
117 3300005563 Ga0068855_100474873 Ga0068855_1004748731 405
118 3300005614 Ga0068856_100031419 Ga0068856_1000314195 405
119 3300013104 Ga0157370_10226831 Ga0157370_102268312 405
120 3300025912 Ga0207707_10030251 Ga0207707_100302514 405
121 3300025921 Ga0207652_10221921 Ga0207652_102219212 405
122 3300026078 Ga0207702_10079386 Ga0207702_100793862 405
123 3300005344 Ga0070661_100098954 Ga0070661_1000989542 406
124 3300005366 Ga0070659_100002775 Ga0070659_1000027754 406
125 3300025919 Ga0207657_10001836 Ga0207657_1000183613 406
126 3300025945 Ga0207679_10027235 Ga0207679_100272352 406
127 3300044765 Ga0466970_0039009 Ga0466970_0039009_1148_2380 406
128 3300047469 Ga0495673_0059057 Ga0495673_0059057_246_1532 406
129 3300003322 rootL2_10072033 rootL2_1007203312 407
130 3300041494 Ga0451837_0521702 Ga0451837_0521702_1773_3002 407
131 3300041509 Ga0451843_1092302 Ga0451843_1092302_1186_2415 407
132 iso_pu_bacteria 2904424332 2904424599 407
133 3300025263 Ga0209565_1002805 Ga0209565_10028053 408
134 3300025923 Ga0207681_10144921 Ga0207681_101449212 408
135 3300048923 Ga0496120_0019054 Ga0496120_0019054_1638_2864 408
136 3300048924 Ga0496121_0033204 Ga0496121_0033204_2216_3442 408
137 3300048927 Ga0496124_0073626 Ga0496124_0073626_952_2181 408
138 3300049744 Ga0501083_0017991 Ga0501083_0017991_2819_4048 408
139 3300005344 Ga0070661_100118042 Ga0070661_1001180422 409
140 3300005365 Ga0070688_100174514 Ga0070688_1001745142 409
141 3300005367 Ga0070667_100038424 Ga0070667_1000384242 409
142 3300005439 Ga0070711_100133285 Ga0070711_1001332851 409
143 3300005543 Ga0070672_100000870 Ga0070672_1000008708 409
144 3300005564 Ga0070664_100067634 Ga0070664_1000676342 409
145 3300005842 Ga0068858_100002433 Ga0068858_1000024339 409
146 3300005843 Ga0068860_100007636 Ga0068860_1000076369 409
147 3300006195 Ga0075366_10145942 Ga0075366_101459421 409
148 3300009036 Ga0105244_10009578 Ga0105244_100095782 409
149 3300013308 Ga0157375_10003790 Ga0157375_100037903 409
150 3300014968 Ga0157379_10000816 Ga0157379_1000081618 409
151 3300025728 Ga0207655_1035111 Ga0207655_10351112 409
152 3300025903 Ga0207680_10067889 Ga0207680_100678892 409
153 3300025940 Ga0207691_10001020 Ga0207691_1000102018 409
154 3300026035 Ga0207703_10018930 Ga0207703_100189303 409
155 3300046459 Ga0495629_0016744 Ga0495629_0016744_1506_2735 409
156 3300046463 Ga0495653_0078523 Ga0495653_0078523_992_2221 409
157 3300046491 Ga0495584_0005501 Ga0495584_0005501_5115_6344 409
158 3300046492 Ga0495585_0000514 Ga0495585_0000514_9652_10881 409
159 3300046500 Ga0495596_0006420 Ga0495596_0006420_2804_4033 409
160 3300046518 Ga0495631_0000884 Ga0495631_0000884_7825_9054 409
161 3300046519 Ga0495632_0000092 Ga0495632_0000092_41037_42266 409
162 3300046535 Ga0495586_0006344 Ga0495586_0006344_4606_5835 409
163 3300046542 Ga0495597_0005371 Ga0495597_0005371_3511_4740 409
164 3300046542 Ga0495597_0038018 Ga0495597_0038018_25_1254 409
165 3300046558 Ga0495633_0010569 Ga0495633_0010569_1547_2776 409
166 3300046616 Ga0495668_0033837 Ga0495668_0033837_585_1814 409
167 3300046663 Ga0495635_0000912 Ga0495635_0000912_15413_16642 409
168 3300046665 Ga0495661_0000738 Ga0495661_0000738_9680_10909 409
169 3300046689 Ga0495613_0061589 Ga0495613_0061589_125_1354 409
170 3300046691 Ga0495670_0000266 Ga0495670_0000266_1499_2728 409
171 3300046810 Ga0495660_0001361 Ga0495660_0001361_496_1725 409
172 3300047317 Ga0495604_0020333 Ga0495604_0020333_1358_2587 409
173 3300047320 Ga0495672_0000365 Ga0495672_0000365_13223_14452 409
174 3300047322 Ga0495680_0008264 Ga0495680_0008264_1341_2570 409
175 3300047445 Ga0495677_0000227 Ga0495677_0000227_21635_22864 409
176 3300047470 Ga0495681_0000281 Ga0495681_0000281_35639_36868 409
177 3300047470 Ga0495681_0001325 Ga0495681_0001325_7825_9054 409
178 3300047673 Ga0495593_0008288 Ga0495593_0008288_1341_2570 409
179 3300048091 Ga0495626_0000190 Ga0495626_0000190_22517_23746 409
180 3300048904 Ga0496101_0139204 Ga0496101_0139204_54_1283 409
181 3300048927 Ga0496124_0035297 Ga0496124_0035297_775_2004 409
182 3300048927 Ga0496124_0037315 Ga0496124_0037315_1246_2475 409
183 3300048927 Ga0496124_0200629 Ga0496124_0200629_149_1378 409
184 3300049459 Ga0495678_002025 Ga0495678_002025_11795_13024 409
185 3300050493 nmdc:mga0k408_136918_c1 nmdc:mga0k408_136918_c1_38_1267 409
186 3300050508 nmdc:mga09592_904_c1 nmdc:mga09592_904_c1_12976_14220 409
187 3300050509 nmdc:mga0qj67_24858_c1 nmdc:mga0qj67_24858_c1_1569_2813 409
188 iso_pu_bacteria 2928130867 2928131962 409
189 3300031728 Ga0316578_10034072 Ga0316578_100340723 410
190 3300035398 Ga0316574_0125631 Ga0316574_0125631_270_1502 410
191 3300045976 Ga0466967_0073689 Ga0466967_0073689_1294_2541 410
192 3300046460 Ga0495638_0000817 Ga0495638_0000817_15497_16729 410
193 3300046463 Ga0495653_0158739 Ga0495653_0158739_165_1397 410
194 3300046499 Ga0495594_0062585 Ga0495594_0062585_665_1897 410
195 3300046506 Ga0495583_0000550 Ga0495583_0000550_15448_16680 410
196 3300046517 Ga0495630_0006373 Ga0495630_0006373_3736_4968 410
197 3300046529 Ga0495652_0006682 Ga0495652_0006682_2443_3675 410
198 3300046531 Ga0495665_0014578 Ga0495665_0014578_2943_4175 410
199 3300046642 Ga0495634_0004293 Ga0495634_0004293_1770_3002 410
200 3300046674 Ga0495588_0009827 Ga0495588_0009827_711_1943 410
201 3300046674 Ga0495588_0021480 Ga0495588_0021480_805_2037 410
202 3300046679 Ga0495623_0002051 Ga0495623_0002051_5722_6954 410
203 3300046809 Ga0495600_0059053 Ga0495600_0059053_613_1845 410
204 3300047317 Ga0495604_0025791 Ga0495604_0025791_1278_2510 410
205 3300047322 Ga0495680_0154246 Ga0495680_0154246_35_1267 410
206 3300047444 Ga0495675_0002798 Ga0495675_0002798_4625_5857 410
207 3300048091 Ga0495626_0034571 Ga0495626_0034571_460_1692 410
208 3300049573 Ga0501037_0001468 Ga0501037_0001468_6238_7470 410
209 3300049580 Ga0501046_0012480 Ga0501046_0012480_5917_7149 410
210 3300049585 Ga0501069_0010158 Ga0501069_0010158_1526_2758 410
211 3300049586 Ga0501070_0006134 Ga0501070_0006134_3321_4553 410
212 3300049591 Ga0501075_0018765 Ga0501075_0018765_2662_3894 410
213 iso_pu_bacteria 2643221638 2644212448 410
214 3300005435 Ga0070714_100002905 Ga0070714_1000029052 411
215 3300005435 Ga0070714_100014706 Ga0070714_1000147062 411
216 3300005458 Ga0070681_10271426 Ga0070681_102714261 411
217 3300006195 Ga0075366_10021802 Ga0075366_100218022 411
218 3300009093 Ga0105240_10133670 Ga0105240_101336702 411
219 3300013104 Ga0157370_10010749 Ga0157370_100107494 411
220 3300025929 Ga0207664_10011480 Ga0207664_100114804 411
221 3300035119 Ga0373956_0029515 Ga0373956_0029515_943_2178 411
222 3300036401 Ga0373937_0001705 Ga0373937_0001705_5374_6609 411
223 3300037471 Ga0395905_0001714 Ga0395905_0001714_2088_3323 411
224 3300044712 Ga0453684_0000625 Ga0453684_0000625_74117_75352 411
225 3300044712 Ga0453684_0061101 Ga0453684_0061101_82_1317 411
226 3300046453 Ga0495627_000015 Ga0495627_000015_103958_105217 411
227 3300046457 Ga0495590_0000274 Ga0495590_0000274_7325_8560 411
228 3300046462 Ga0495651_0009576 Ga0495651_0009576_5828_7063 411
229 3300046506 Ga0495583_0000285 Ga0495583_0000285_41694_42983 411
230 3300046507 Ga0495606_0021487 Ga0495606_0021487_216_1451 411
231 3300046513 Ga0495616_0058581 Ga0495616_0058581_10_1299 411
232 3300046523 Ga0495644_0005088 Ga0495644_0005088_3578_4867 411
233 3300046523 Ga0495644_0007149 Ga0495644_0007149_1683_2942 411
234 3300046524 Ga0495648_0002660 Ga0495648_0002660_2786_4075 411
235 3300046524 Ga0495648_0041845 Ga0495648_0041845_152_1387 411
236 3300046526 Ga0495666_0059575 Ga0495666_0059575_380_1615 411
237 3300046538 Ga0495609_0000567 Ga0495609_0000567_14093_15352 411
238 3300046558 Ga0495633_0085422 Ga0495633_0085422_87_1376 411
239 3300046616 Ga0495668_0000029 Ga0495668_0000029_186375_187610 411
240 3300046664 Ga0495659_0000382 Ga0495659_0000382_8778_10067 411
241 3300046664 Ga0495659_0007101 Ga0495659_0007101_2250_3485 411
242 3300046810 Ga0495660_0000262 Ga0495660_0000262_14897_16156 411
243 3300047323 Ga0495683_0002009 Ga0495683_0002009_2140_3390 411
244 3300047447 Ga0495685_001421 Ga0495685_001421_3578_4867 411
245 3300047472 Ga0495686_0000580 Ga0495686_0000580_49619_50854 411
246 3300048088 Ga0495602_0000683 Ga0495602_0000683_10482_11717 411
247 3300048905 Ga0496102_0000024 Ga0496102_0000024_144225_145460 411
248 3300048906 Ga0496103_0010642 Ga0496103_0010642_2322_3557 411
249 3300049459 Ga0495678_039757 Ga0495678_039757_288_1523 411
250 3300049460 Ga0495682_0002370 Ga0495682_0002370_3844_5133 411
251 3300049587 Ga0501071_0100140 Ga0501071_0100140_539_1786 411
252 3300049588 Ga0501072_0238954 Ga0501072_0238954_118_1359 411
253 3300049591 Ga0501075_0139378 Ga0501075_0139378_216_1457 411
254 3300049592 Ga0501076_0019112 Ga0501076_0019112_1989_3224 411
255 3300050493 nmdc:mga0k408_20247_c1 nmdc:mga0k408_20247_c1_259_1512 411
256 3300005334 Ga0068869_100083956 Ga0068869_1000839563 412
257 3300009098 Ga0105245_10038208 Ga0105245_100382083 412
258 3300025295 Ga0209564_1000067 Ga0209564_1000067167 412
259 3300025298 Ga0209050_1000123 Ga0209050_100012375 412
260 3300031548 Ga0307408_100000491 Ga0307408_1000004912 412
261 3300031727 Ga0316576_10019633 Ga0316576_100196332 412
262 3300035398 Ga0316574_0002206 Ga0316574_0002206_1515_2753 412
263 3300039447 Ga0436361_0232519 Ga0436361_0232519_614_1855 412
264 3300044735 Ga0466968_0024403 Ga0466968_0024403_725_1975 412
265 3300046457 Ga0495590_0000002 Ga0495590_0000002_467106_468347 412
266 3300046460 Ga0495638_0000030 Ga0495638_0000030_299669_300910 412
267 3300046471 Ga0495650_0000783 Ga0495650_0000783_3502_4743 412
268 3300046475 Ga0495639_0002695 Ga0495639_0002695_2554_3795 412
269 3300046491 Ga0495584_0036636 Ga0495584_0036636_146_1384 412
270 3300046491 Ga0495584_0061058 Ga0495584_0061058_510_1748 412
271 3300046492 Ga0495585_0022721 Ga0495585_0022721_1564_2802 412
272 3300046500 Ga0495596_0000134 Ga0495596_0000134_49895_51133 412
273 3300046501 Ga0495607_0000989 Ga0495607_0000989_11579_12820 412
274 3300046506 Ga0495583_0000058 Ga0495583_0000058_181644_182885 412
275 3300046507 Ga0495606_0001240 Ga0495606_0001240_12568_13809 412
276 3300046512 Ga0495610_0000380 Ga0495610_0000380_7117_8361 412
277 3300046519 Ga0495632_0033106 Ga0495632_0033106_652_1890 412
278 3300046522 Ga0495643_0000078 Ga0495643_0000078_144326_145567 412
279 3300046523 Ga0495644_0018518 Ga0495644_0018518_385_1623 412
280 3300046524 Ga0495648_0000009 Ga0495648_0000009_298449_299690 412
281 3300046528 Ga0495642_0004757 Ga0495642_0004757_2126_3364 412
282 3300046538 Ga0495609_0000755 Ga0495609_0000755_10584_11825 412
283 3300046538 Ga0495609_0003314 Ga0495609_0003314_3305_4543 412
284 3300046542 Ga0495597_0000014 Ga0495597_0000014_160339_161580 412
285 3300046557 Ga0495622_0000194 Ga0495622_0000194_12731_13972 412
286 3300046558 Ga0495633_0000439 Ga0495633_0000439_17135_18376 412
287 3300046616 Ga0495668_0000598 Ga0495668_0000598_16609_17850 412
288 3300046660 Ga0495625_0000023 Ga0495625_0000023_166028_167269 412
289 3300046684 Ga0495669_0001034 Ga0495669_0001034_3644_4882 412
290 3300046794 Ga0495589_0018161 Ga0495589_0018161_546_1784 412
291 3300046810 Ga0495660_0010930 Ga0495660_0010930_1326_2567 412
292 3300047323 Ga0495683_0012946 Ga0495683_0012946_426_1664 412
293 3300047443 Ga0495687_001440 Ga0495687_001440_5704_6945 412
294 3300047443 Ga0495687_001853 Ga0495687_001853_5705_6946 412
295 3300047447 Ga0495685_010299 Ga0495685_010299_1121_2359 412
296 3300048915 Ga0496112_0072262 Ga0496112_0072262_2121_3365 412
297 3300048924 Ga0496121_0003447 Ga0496121_0003447_15853_17094 412
298 3300048928 Ga0496125_0000718 Ga0496125_0000718_11581_12822 412
299 3300049459 Ga0495678_008260 Ga0495678_008260_2028_3269 412
300 3300049572 Ga0501036_0002218 Ga0501036_0002218_5505_6752 412
301 3300049574 Ga0501038_0112362 Ga0501038_0112362_828_2075 412
302 3300049575 Ga0501039_0000202 Ga0501039_0000202_11970_13217 412
303 3300049576 Ga0501040_0000466 Ga0501040_0000466_16768_18015 412
304 3300049577 Ga0501041_0004274 Ga0501041_0004274_3075_4322 412
305 3300049579 Ga0501043_0075291 Ga0501043_0075291_1262_2509 412
306 3300049580 Ga0501046_0027757 Ga0501046_0027757_2942_4189 412
307 3300049582 Ga0501048_0002634 Ga0501048_0002634_8271_9518 412
308 3300049587 Ga0501071_0000366 Ga0501071_0000366_6620_7867 412
309 3300049588 Ga0501072_0000417 Ga0501072_0000417_3040_4287 412
310 3300049590 Ga0501074_0022521 Ga0501074_0022521_100_1347 412
311 3300049591 Ga0501075_0000049 Ga0501075_0000049_8398_9645 412
312 3300049592 Ga0501076_0000013 Ga0501076_0000013_51920_53167 412
313 3300049593 Ga0501077_0002606 Ga0501077_0002606_3555_4802 412
314 3300049741 Ga0501079_0001362 Ga0501079_0001362_9921_11168 412
315 3300049742 Ga0501080_0002691 Ga0501080_0002691_573_1820 412
316 3300049743 Ga0501081_0000027 Ga0501081_0000027_5995_7242 412
317 3300049822 Ga0501035_0019026 Ga0501035_0019026_1062_2309 412
318 3300060353 Ga0501082_0002383 Ga0501082_0002383_6025_7272 412
319 3300061734 Ga0530510_0000076 Ga0530510_0000076_5338_6585 412
320 iso_pu_bacteria 2891633521 2891635361 412
321 3300005347 Ga0070668_100031714 Ga0070668_1000317142 413
322 3300005367 Ga0070667_100057412 Ga0070667_1000574122 413
323 3300005548 Ga0070665_100202953 Ga0070665_1002029532 413
324 3300005616 Ga0068852_100217221 Ga0068852_1002172212 413
325 3300005617 Ga0068859_100209344 Ga0068859_1002093442 413
326 3300006931 Ga0097620_100209344 Ga0097620_1002093442 413
327 3300009093 Ga0105240_10004096 Ga0105240_1000409614 413
328 3300009094 Ga0111539_10139249 Ga0111539_101392492 413
329 3300013104 Ga0157370_10001007 Ga0157370_1000100718 413
330 3300025949 Ga0207667_10000034 Ga0207667_10000034182 413
331 3300025960 Ga0207651_10010320 Ga0207651_100103203 413
332 3300025972 Ga0207668_10062492 Ga0207668_100624922 413
333 3300025986 Ga0207658_10046844 Ga0207658_100468442 413
334 3300026142 Ga0207698_10269317 Ga0207698_102693172 413
335 3300044765 Ga0466970_0056740 Ga0466970_0056740_292_1536 413
336 3300047472 Ga0495686_0000333 Ga0495686_0000333_25340_26584 413
337 3300050509 nmdc:mga0qj67_65737_c1 nmdc:mga0qj67_65737_c1_1470_2714 413
338 3300002987 JGI25159J45721_1001170 JGI25159J45721_10011702 414
339 3300003354 JGI25160J50197_1000475 JGI25160J50197_100047515 414
340 3300003374 JGI25161J50226_1000284 JGI25161J50226_100028419 414
341 3300003771 Ga0055526_1000510 Ga0055526_10005108 414
342 3300003773 Ga0055537_1000420 Ga0055537_100042014 414
343 3300003773 Ga0055537_1001560 Ga0055537_10015605 414
344 3300003775 Ga0055524_1000699 Ga0055524_100069918 414
345 3300003784 Ga0055534_1007007 Ga0055534_10070072 414
346 3300003791 Ga0055530_10001082 Ga0055530_100010824 414
347 3300009036 Ga0105244_10002398 Ga0105244_100023987 414
348 3300025208 Ga0209436_100189 Ga0209436_10018918 414
349 3300025263 Ga0209565_1000425 Ga0209565_100042510 414
350 3300025263 Ga0209565_1000515 Ga0209565_10005156 414
351 3300025273 Ga0209673_1002853 Ga0209673_10028533 414
352 3300025291 Ga0209675_1002267 Ga0209675_10022679 414
353 3300025299 Ga0209256_1000631 Ga0209256_100063126 414
354 3300031548 Ga0307408_100005663 Ga0307408_1000056632 414
355 3300046471 Ga0495650_0000084 Ga0495650_0000084_72764_74026 414
356 3300046538 Ga0495609_0000463 Ga0495609_0000463_30315_31580 414
357 3300046660 Ga0495625_0002930 Ga0495625_0002930_8553_9839 414
358 3300047320 Ga0495672_0000248 Ga0495672_0000248_50821_52086 414

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

52

301

0.97

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

47

396

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j66-assembly1.cif.gz_A-2 structural characterisation of btrk decarboxylase from butirosin biosynthesis 0.9116 33 414
7ru7-assembly1.cif.gz_A-2 crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis 0.8982 31 414
2p3e-assembly1.cif.gz_B crystal structure of aq1208 from aquifex aeolicus 0.8935 16 414
1twi-assembly1.cif.gz_A crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine 0.8851 16 414
4xg1-assembly1.cif.gz_A psychromonas ingrahamii diaminopimelate decarboxylase with llp 0.881 16 414
ID Description Score Start End Superfamily
2j66A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9284 51 295 3.20.20.10
af_Q2G1M6_27_256_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9168 51 277 3.20.20.10
af_Q2G1M6_27_256_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9017 51 277 3.20.20.10
2j66A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9 51 295 3.20.20.10
2p3eA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8783 51 290 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A7Y2EMM8-F1-model_v4 Pyridoxal-dependent decarboxylase, exosortase A system-associated 0.9804 15 138 GO:0006596
GO:0008836
GO:0009089
AF-A0A837X1U8-F1-model_v4 deleted 0.9733 9 313
AF-A0A522X3Z3-F1-model_v4 Pyridoxal-dependent decarboxylase, exosortase A system-associated 0.9697 29 188 GO:0006596
GO:0008836
GO:0009089
AF-A0A358JMT7-F1-model_v4 deleted 0.9689 8 160
AF-A0A3B9PIV2-F1-model_v4 Pyridoxal-dependent decarboxylase, exosortase A system-associated 0.9668 15 120 GO:0008836
GO:0009089

Feature Viewer

pLDDT pTM Quality
88.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map