F420944

General Info

Members Datasets Scaffolds Average Seq Length
357 259 714 352

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0004714|Ga0495603_0004714_5008_6246
Length 393
Sequence VRVAHTGEHRTAYLERTDFARRPGSPTGGSWKEHPKVKLQRKNRLRALSLGAIAVSGALALTACGSDDTSANGGSSSAPSAKAGSIKCDDAKGQLLANGSSAQANAIQAWVKAYTAECKGVQINYKPEGSGAGVTAFTQGQVAFAGSDSALKPEEVTASKKVCSGGQGIDLPMVGGPIAIGYNVPGVDNLVLDAKTLAQIFDGKISTWDDEAIAKLNPKAKLPKTKIQAFHRSDESGTTDNFTKYLKAASPADWKYSGGKVKQTAGAISYFELSYAKDGIKTVDLDTGASAPVKATTDNATKAISDAKVVGTGKDLALQLNYATKADGAYPITLVTYEIVCDKGNKADTFPATKSFLTYIASQDGQDSLAALGYAPIPSEINTKVRDTIASLS

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
38 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
54 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
55 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
65 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
66 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
67 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
68 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
69 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
70 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
71 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
181 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
182 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
183 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
184 2643221647 Streptomyces sp. Root369 Isolate Unclassified
185 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
186 2643221714 Streptomyces sp. Root264 Isolate Unclassified
187 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
188 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
189 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
190 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
191 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
192 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
193 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
194 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
195 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
196 2808606448 Streptomyces sp. 193411 Isolate Unclassified
197 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
198 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
199 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
200 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
201 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
202 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
203 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
204 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
205 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
206 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
207 2862574272 Streptomyces sp. AcE210 Isolate Nodule
208 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
209 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
210 2867428634 Streptomyces sp. RP5T Isolate Unclassified
211 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
212 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
213 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
214 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
215 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
216 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
217 2891562705 Microbispora tritici MT50 Isolate Unclassified
218 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
219 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
220 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
221 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
222 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
223 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
224 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
225 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
226 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
227 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
228 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
229 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
230 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
231 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
232 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
233 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
234 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
235 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
236 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
237 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
238 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
239 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
240 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
241 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
242 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
243 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
244 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
245 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
246 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
247 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
248 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
249 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
250 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
251 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
252 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
253 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
254 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
255 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
256 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
257 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
258 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
259 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.75
Metatranscriptomes 0.56
Isolates 22.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 1.12
Rhizoplane 0.28
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0004714 3300046455 Bacteria 8144
2 JGI24735J21928_10029302 3300002067 Bacteria 1639
3 JGI24738J21930_10012777 3300002075 Bacteria 1830
4 JGI25406J46586_10031840 3300003203 Bacteria 1968
5 JGI25406J46586_10036554 3300003203 Bacteria 1780
6 rootL2_10023840 3300003322 Bacteria 4118
7 rootH1_10009718 3300003323 Bacteria 2058
8 rootH1_10021083 3300003323 Bacteria 5531
9 Ga0006562J51391_1109534 3300003578 Bacteria 4160
10 Ga0070668_100026396 3300005347 Bacteria 4407
11 Ga0070668_100030595 3300005347 Bacteria 4093
12 Ga0070667_100058502 3300005367 Bacteria 3259
13 Ga0070665_100147045 3300005548 Bacteria 2359
14 Ga0068856_100069321 3300005614 Bacteria 3487
15 Ga0068861_100096868 3300005719 Bacteria 2339
16 Ga0068862_100115075 3300005844 Bacteria 2365
17 Ga0081539_10003263 3300005985 Bacteria 20364
18 Ga0081539_10004664 3300005985 Bacteria 14898
19 Ga0081539_10005678 3300005985 Bacteria 12519
20 Ga0081539_10050061 3300005985 Bacteria 2366
21 Ga0075368_10010355 3300006042 Bacteria 3370
22 Ga0075363_100024051 3300006048 Bacteria 3094
23 Ga0075367_10001803 3300006178 Bacteria 9425
24 Ga0099826_10066983 3300006948 Bacteria 2301
25 Ga0105245_10223782 3300009098 Bacteria 1817
26 Ga0105246_10002694 3300011119 Bacteria 10754
27 Ga0157378_10228847 3300013297 Bacteria 1771
28 Ga0157372_10052411 3300013307 Bacteria 4543
29 Ga0182008_10004774 3300014497 Bacteria 7843
30 Ga0182007_10001086 3300015262 Bacteria 14774
31 Ga0182005_1016213 3300015265 Bacteria 2074
32 Ga0183367_1005 3300015688 Bacteria 652063
33 Ga0209758_1006360 3300025297 Bacteria 8542
34 Ga0207426_1002394 3300025302 Bacteria 12082
35 Ga0207426_1010575 3300025302 Bacteria 3575
36 Ga0207426_1031619 3300025302 Bacteria 1725
37 Ga0207647_10016199 3300025904 Bacteria 5090
38 Ga0207668_10000458 3300025972 Bacteria 25648
39 Ga0207668_10266159 3300025972 Bacteria 1399
40 Ga0207702_10058602 3300026078 Bacteria 3277
41 Ga0207675_100126514 3300026118 Bacteria 2420
42 Ga0209371_1005533 3300027312 Bacteria 4986
43 Ga0209813_10008869 3300027866 Bacteria 2553
44 Ga0268266_10065746 3300028379 Bacteria 3135
45 Ga0307515_10001120 3300028794 Bacteria 61255
46 Ga0268256_1005766 3300030500 Bacteria 4769
47 Ga0307511_10008569 3300030521 Bacteria 10229
48 Ga0307511_10049038 3300030521 Bacteria 3425
49 Ga0307512_10051702 3300030522 Bacteria 3284
50 Ga0307513_10181060 3300031456 Bacteria 1970
51 Ga0307508_10000820 3300031616 Bacteria 36285
52 Ga0307508_10002228 3300031616 Bacteria 20649
53 Ga0307508_10029195 3300031616 Bacteria 4986
54 Ga0307508_10053793 3300031616 Bacteria 3571
55 Ga0307514_10005625 3300031649 Bacteria 11105
56 Ga0316576_10013614 3300031727 Bacteria 5412
57 Ga0316578_10009459 3300031728 Bacteria 5016
58 Ga0307516_10014301 3300031730 Bacteria 8404
59 Ga0307516_10035129 3300031730 Bacteria 5031
60 Ga0307516_10078520 3300031730 Bacteria 3147
61 Ga0307405_10083887 3300031731 Bacteria 2090
62 Ga0307518_10071184 3300031838 Bacteria 2518
63 Ga0307410_10107961 3300031852 Bacteria 2009
64 Ga0307409_100114491 3300031995 Bacteria 2269
65 Ga0307415_100093237 3300032126 Bacteria 2186
66 Ga0316593_10033174 3300032168 Bacteria 1689
67 Ga0307510_10042609 3300033180 Bacteria 4945
68 Ga0373948_0011821 3300034817 Bacteria 1551
69 Ga0373951_0000208 3300035091 Bacteria 20961
70 Ga0373942_0000020 3300035207 Bacteria 30859
71 Ga0395900_0075072 3300037418 Bacteria 3475
72 Ga0395898_0010868 3300037466 Bacteria 9504
73 Ga0395901_0089531 3300038443 Bacteria 3221
74 Ga0395901_0459503 3300038443 Bacteria 1301
75 Ga0439436_0000169 3300041404 Bacteria 15343
76 Ga0451853_1880415 3300041512 Bacteria 5410
77 Ga0451853_2096403 3300041512 Bacteria 2113
78 Ga0439433_0002349 3300041999 Bacteria 4007
79 Ga0439448_0000636 3300042005 Bacteria 8285
80 Ga0439449_0000534 3300042007 Bacteria 14173
81 Ga0439449_0001711 3300042007 Bacteria 8616
82 Ga0439449_0013072 3300042007 Bacteria 3122
83 Ga0439455_0001086 3300042012 Bacteria 4340
84 Ga0439457_000115 3300042014 Bacteria 19277
85 Ga0439457_000694 3300042014 Bacteria 9946
86 Ga0439457_019269 3300042014 Bacteria 1515
87 Ga0439462_0013385 3300042015 Bacteria 2101
88 Ga0450894_000926 3300042131 Bacteria 4638
89 Ga0450896_005098 3300042133 Bacteria 1789
90 Ga0450899_000454 3300042135 Bacteria 4592
91 Ga0450903_000181 3300042138 Bacteria 13881
92 Ga0450903_010868 3300042138 Bacteria 1470
93 Ga0450906_002128 3300042145 Bacteria 4330
94 Ga0439458_0003024 3300042157 Bacteria 4008
95 Ga0466969_0012454 3300044656 Bacteria 4484
96 Ga0466969_0020535 3300044656 Bacteria 3420
97 Ga0466972_0001763 3300044658 Bacteria 10607
98 Ga0466972_0008601 3300044658 Bacteria 5121
99 Ga0466972_0026106 3300044658 Bacteria 2893
100 Ga0466965_0000210 3300044683 Bacteria 18354
101 Ga0466966_0009850 3300044684 Bacteria 6334
102 Ga0466966_0018418 3300044684 Bacteria 4606
103 Ga0466966_0033219 3300044684 Bacteria 3340
104 Ga0466966_0211132 3300044684 Bacteria 1173
105 Ga0466961_0047312 3300044693 Bacteria 2750
106 Ga0466963_0000721 3300044694 Bacteria 16182
107 Ga0466963_0077634 3300044694 Bacteria 2244
108 Ga0466964_0004318 3300044706 Bacteria 5238
109 Ga0466971_0000749 3300044719 Bacteria 13021
110 Ga0466968_0073429 3300044735 Bacteria 1493
111 Ga0466970_0001935 3300044765 Bacteria 10014
112 Ga0466970_0014169 3300044765 Bacteria 4089
113 Ga0466970_0215215 3300044765 Bacteria 1071
114 Ga0466957_0000446 3300044842 Bacteria 20383
115 Ga0466959_0001307 3300045049 Bacteria 15104
116 Ga0466958_0000691 3300045836 Bacteria 14682
117 Ga0466958_0135836 3300045836 Bacteria 1546
118 Ga0466967_0011466 3300045976 Bacteria 6716
119 Ga0466967_0329863 3300045976 Bacteria 1473
120 Ga0495627_005776 3300046453 Bacteria 4928
121 Ga0495592_0101205 3300046454 Bacteria 2053
122 Ga0495592_0158336 3300046454 Bacteria 1560
123 Ga0495603_0018752 3300046455 Bacteria 4187
124 Ga0495603_0042692 3300046455 Bacteria 2710
125 Ga0495629_0027170 3300046459 Bacteria 4065
126 Ga0495629_0057637 3300046459 Bacteria 2715
127 Ga0495629_0140860 3300046459 Bacteria 1678
128 Ga0495651_0002617 3300046462 Bacteria 13930
129 Ga0495605_0031631 3300046474 Bacteria 2701
130 Ga0495664_0000916 3300046477 Bacteria 15174
131 Ga0495585_0040169 3300046492 Bacteria 2628
132 Ga0495594_0013982 3300046499 Bacteria 4202
133 Ga0495607_0052197 3300046501 Bacteria 2369
134 Ga0495583_0022067 3300046506 Bacteria 3258
135 Ga0495606_0018406 3300046507 Bacteria 5237
136 Ga0495610_0038406 3300046512 Bacteria 2430
137 Ga0495616_0036627 3300046513 Bacteria 2530
138 Ga0495628_0094045 3300046516 Bacteria 2317
139 Ga0495643_0012776 3300046522 Bacteria 5052
140 Ga0495648_0035765 3300046524 Bacteria 3215
141 Ga0495648_0123742 3300046524 Bacteria 1385
142 Ga0495642_0035655 3300046528 Bacteria 2008
143 Ga0495652_0027350 3300046529 Bacteria 5025
144 Ga0495654_0017823 3300046530 Bacteria 3727
145 Ga0495640_0043346 3300046533 Bacteria 3134
146 Ga0495587_0003379 3300046536 Bacteria 10642
147 Ga0495609_0011306 3300046538 Bacteria 4254
148 Ga0495645_0189343 3300046543 Bacteria 1403
149 Ga0495622_0067110 3300046557 Bacteria 1657
150 Ga0495633_0016152 3300046558 Bacteria 3857
151 Ga0495667_0158471 3300046559 Bacteria 1456
152 Ga0495668_0007625 3300046616 Bacteria 6891
153 Ga0495634_0002500 3300046642 Bacteria 15238
154 Ga0495634_0070025 3300046642 Bacteria 2312
155 Ga0495611_0101025 3300046648 Bacteria 1339
156 Ga0495625_0096561 3300046660 Bacteria 2035
157 Ga0495625_0122444 3300046660 Bacteria 1768
158 Ga0495635_0000703 3300046663 Bacteria 21566
159 Ga0495588_0012332 3300046674 Bacteria 4036
160 Ga0495657_0006533 3300046675 Bacteria 9118
161 Ga0495657_0152758 3300046675 Bacteria 1432
162 Ga0495646_0001264 3300046680 Bacteria 14863
163 Ga0495658_0068620 3300046683 Bacteria 2053
164 Ga0495613_0046461 3300046689 Bacteria 3210
165 Ga0495624_0082923 3300046690 Bacteria 1983
166 Ga0495670_0018243 3300046691 Bacteria 3455
167 Ga0495671_0017489 3300046692 Bacteria 3816
168 Ga0495649_0014461 3300046694 Bacteria 4521
169 Ga0495649_0056500 3300046694 Bacteria 2119
170 Ga0495589_0013912 3300046794 Bacteria 4149
171 Ga0495589_0088522 3300046794 Bacteria 1504
172 Ga0495600_0012692 3300046809 Bacteria 5274
173 Ga0495600_0134466 3300046809 Bacteria 1606
174 Ga0495660_0025993 3300046810 Bacteria 3321
175 Ga0495581_0020714 3300047315 Bacteria 3813
176 Ga0495604_0000555 3300047317 Bacteria 32869
177 Ga0495604_0063543 3300047317 Bacteria 2815
178 Ga0495636_0019589 3300047318 Bacteria 2721
179 Ga0495636_0023276 3300047318 Bacteria 2507
180 Ga0495676_0018127 3300047321 Bacteria 6210
181 Ga0495676_0147098 3300047321 Bacteria 1681
182 Ga0495680_0099916 3300047322 Bacteria 2162
183 Ga0495679_053463 3300047446 Bacteria 1206
184 Ga0495685_004425 3300047447 Bacteria 4540
185 Ga0495681_0000290 3300047470 Bacteria 40038
186 Ga0495593_0005210 3300047673 Bacteria 7684
187 Ga0495593_0015709 3300047673 Bacteria 4282
188 Ga0495602_0033242 3300048088 Bacteria 4841
189 Ga0495614_0011209 3300048089 Bacteria 3944
190 Ga0495614_0055230 3300048089 Bacteria 1704
191 Ga0495626_0012351 3300048091 Bacteria 4480
192 Ga0495678_009728 3300049459 Bacteria 4724
193 Ga0501031_0003210 3300049568 Bacteria 10490
194 Ga0501031_0018892 3300049568 Bacteria 4487
195 Ga0501031_0171074 3300049568 Bacteria 1419
196 Ga0501032_0002876 3300049569 Bacteria 13392
197 Ga0501032_0027108 3300049569 Bacteria 3939
198 Ga0501033_0008312 3300049570 Bacteria 8039
199 Ga0501033_0017165 3300049570 Bacteria 5470
200 Ga0501033_0023061 3300049570 Bacteria 4692
201 Ga0501033_0061521 3300049570 Bacteria 2766
202 Ga0501033_0101894 3300049570 Bacteria 2094
203 Ga0501034_0002624 3300049571 Bacteria 21326
204 Ga0501034_0003791 3300049571 Bacteria 17060
205 Ga0501034_0052447 3300049571 Bacteria 4108
206 Ga0501034_0206693 3300049571 Bacteria 1919
207 Ga0501036_0001551 3300049572 Bacteria 17764
208 Ga0501036_0008297 3300049572 Bacteria 8512
209 Ga0501036_0008787 3300049572 Bacteria 8294
210 Ga0501036_0011523 3300049572 Bacteria 7325
211 Ga0501037_0002131 3300049573 Bacteria 14329
212 Ga0501037_0010296 3300049573 Bacteria 6862
213 Ga0501037_0037296 3300049573 Bacteria 3583
214 Ga0501038_0001356 3300049574 Bacteria 22325
215 Ga0501038_0009133 3300049574 Bacteria 9094
216 Ga0501038_0013001 3300049574 Bacteria 7593
217 Ga0501038_0031417 3300049574 Bacteria 4693
218 Ga0501038_0115270 3300049574 Bacteria 2221
219 Ga0501039_0007375 3300049575 Bacteria 8387
220 Ga0501039_0049141 3300049575 Bacteria 3260
221 Ga0501039_0218224 3300049575 Bacteria 1499
222 Ga0501040_0043258 3300049576 Bacteria 3069
223 Ga0501041_0005055 3300049577 Bacteria 7681
224 Ga0501042_0007470 3300049578 Bacteria 7162
225 Ga0501043_0004037 3300049579 Bacteria 12004
226 Ga0501043_0005808 3300049579 Bacteria 9925
227 Ga0501043_0008901 3300049579 Bacteria 7899
228 Ga0501046_0002540 3300049580 Bacteria 17060
229 Ga0501046_0008988 3300049580 Bacteria 8672
230 Ga0501046_0085508 3300049580 Bacteria 2432
231 Ga0501046_0133885 3300049580 Bacteria 1878
232 Ga0501047_0002730 3300049581 Bacteria 16812
233 Ga0501047_0020036 3300049581 Bacteria 6422
234 Ga0501047_0194709 3300049581 Bacteria 1889
235 Ga0501048_0013355 3300049582 Bacteria 6095
236 Ga0501048_0050632 3300049582 Bacteria 2957
237 Ga0501067_0003597 3300049583 Bacteria 8535
238 Ga0501068_0002237 3300049584 Bacteria 10299
239 Ga0501069_0006721 3300049585 Bacteria 6021
240 Ga0501069_0144588 3300049585 Bacteria 1365
241 Ga0501070_0002721 3300049586 Bacteria 15423
242 Ga0501070_0087440 3300049586 Bacteria 2579
243 Ga0501070_0096441 3300049586 Bacteria 2446
244 Ga0501071_0033931 3300049587 Bacteria 3628
245 Ga0501072_0008118 3300049588 Bacteria 7966
246 Ga0501074_0004852 3300049590 Bacteria 9644
247 Ga0501074_0013312 3300049590 Bacteria 5981
248 Ga0501074_0185526 3300049590 Bacteria 1483
249 Ga0501076_0007683 3300049592 Bacteria 7853
250 Ga0501077_0008391 3300049593 Bacteria 6396
251 Ga0501079_0007363 3300049741 Bacteria 8322
252 Ga0501080_0259094 3300049742 Bacteria 1585
253 Ga0501083_0012688 3300049744 Bacteria 5895
254 Ga0501035_0000268 3300049822 Bacteria 61655
255 Ga0501035_0002947 3300049822 Bacteria 16374
256 Ga0501035_0011529 3300049822 Bacteria 8189
257 Ga0501035_0041865 3300049822 Bacteria 4134
258 Ga0501035_0052267 3300049822 Bacteria 3656
259 Ga0501035_0189782 3300049822 Bacteria 1767
260 Ga0501044_0003962 3300049823 Bacteria 16582
261 Ga0501044_0010106 3300049823 Bacteria 10254
262 Ga0501044_0010519 3300049823 Bacteria 10039
263 Ga0501044_0028205 3300049823 Bacteria 5926
264 Ga0501044_0069681 3300049823 Bacteria 3579
265 Ga0501044_0225333 3300049823 Bacteria 1824
266 Ga0501045_0182333 3300049824 Bacteria 1564
267 nmdc:mga03n38_38908_c1 3300050490 Bacteria 2060
268 nmdc:mga06z11_1352_c1 3300050494 Bacteria 9078
269 nmdc:mga04h51_10620_c1 3300050495 Bacteria 2534
270 Ga0500600_0061934 3300053149 Bacteria 2082
271 Ga0501084_0014613 3300054114 Bacteria 6507
272 Ga0501084_0271025 3300054114 Bacteria 1433
273 Ga0501084_0333400 3300054114 Bacteria 1281
274 Ga0501082_0003993 3300060353 Bacteria 12877
275 Ga0466962_0005178 3300061719 Bacteria 6278
276 Ga0466962_0016395 3300061719 Bacteria 3573
277 2547408322 2547132111 Bacteria 8013147
278 2585310147 2582581313 Bacteria 10042643
279 2585313702 2582581314 Bacteria 11452267
280 2616694852 2616644814 Bacteria 11555299
281 2644262564 2643221647 Bacteria 10741251
282 2644437340 2643221678 Bacteria 9540101
283 2644629076 2643221714 Bacteria 9015452
284 2676489141 2675903060 Bacteria 10051191
285 2784588801 2784132148 Bacteria 8627943
286 2785343079 2784746763 Bacteria 9783172
287 2785369751 2784746768 Bacteria 10036182
288 2786670828 2786546132 Bacteria 10419719
289 2793983642 2791355406 Bacteria 11364898
290 2804846071 2802429296 Bacteria 7227771
291 2808842244 2808606359 Bacteria 9866990
292 2808920784 2808606375 Bacteria 9466072
293 2809232415 2808606448 Bacteria 8656184
294 2811842778 2808606982 Bacteria 7791042
295 2812357872 2811994879 Bacteria 9313447
296 2812480329 2811994917 Bacteria 7761064
297 2852636451 2852635781 Bacteria 8251373
298 2856743187 2856741275 Bacteria 8096094
299 2858850098 2858848962 Bacteria 6963058
300 2862285863 2862281513 Bacteria 9621493
301 2862296443 2862290372 Bacteria 7471434
302 2862388689 2862382967 Bacteria 10317375
303 2862511611 2862507626 Bacteria 9425308
304 2862579044 2862574272 Bacteria 10567477
305 2863404371 2863404153 Bacteria 9672205
306 2867323087 2867319477 Bacteria 7069771
307 2867432336 2867428634 Bacteria 9590268
308 2873155535 2873151551 Bacteria 8625867
309 2873317072 2873314349 Bacteria 8512634
310 2877680886 2877676314 Bacteria 9512378
311 2884702787 2884693830 Bacteria 11273186
312 2891402664 2891395885 Bacteria 9251614
313 2891559825 2891554331 Bacteria 8812224
314 2891566021 2891562705 Bacteria 8039471
315 2895436481 2895427314 Bacteria 13147766
316 2895449102 2895442618 Bacteria 11027144
317 2912719734 2912715099 Bacteria 9460473
318 2912731238 2912723979 Bacteria 8557534
319 2919469340 2919468124 Bacteria 9133025
320 2946067993 2946064051 Bacteria 8957905
321 2946076097 2946072368 Bacteria 8999607
322 2947228962 2947224130 Bacteria 9938529
323 2954385998 2954380949 Bacteria 10050426
324 2954677154 2954673503 Bacteria 9685905
325 2954687002 2954682443 Bacteria 9862841
326 2954696649 2954691527 Bacteria 10720516
327 2954705513 2954701450 Bacteria 10834262
328 2954715998 2954711539 Bacteria 10867210
329 2954725940 2954721474 Bacteria 10456478
330 2954735858 2954731030 Bacteria 10243860
331 2954744876 2954740390 Bacteria 10229294
332 2954754724 2954749733 Bacteria 10366972
333 2954763866 2954759201 Bacteria 9358192
334 2990060003 2990059506 Bacteria 9321252
335 2990092358 2990088156 Bacteria 6657676
336 2997457662 2997451912 Bacteria 8492419
337 2997604928 2997600082 Bacteria 9896405
338 3006497924 3006493962 Bacteria 8825450
339 8003833283 8003830390 Bacteria 6541657
340 8003876344 8003870546 Bacteria 7396674
341 8008567037 8008558824 Bacteria 10610750
342 8008578699 8008574985 Bacteria 7815457
343 8023624297 8023623736 Bacteria 8593882
344 8025415726 8025413630 Bacteria 7014048
345 8025482271 8025478263 Bacteria 8209203
346 8033689072 8033684223 Bacteria 6906479
347 8033691345 8033684223 Bacteria 6906479
348 8047897226 8047893842 Bacteria 11723082
349 8048133566 8048127548 Bacteria 11053136
350 8048361720 8048356638 Bacteria 11044339
351 8048374209 8048369669 Bacteria 11666822
352 8048384011 8048379754 Bacteria 11877923
353 8048407118 8048406513 Bacteria 8936924
354 8055073378 8055066027 Bacteria 9479577
355 8055180192 8055172936 Bacteria 9305943
356 8056450961 8056447290 Bacteria 7680491
357 8056667376 8056667051 Bacteria 6953971
358 Ga0495603_0004714
359 JGI24735J21928_10029302
360 JGI24738J21930_10012777
361 JGI25406J46586_10031840
362 JGI25406J46586_10036554
363 rootL2_10023840
364 rootH1_10009718
365 rootH1_10021083
366 Ga0006562J51391_1109534
367 Ga0070668_100026396
368 Ga0070668_100030595
369 Ga0070667_100058502
370 Ga0070665_100147045
371 Ga0068856_100069321
372 Ga0068861_100096868
373 Ga0068862_100115075
374 Ga0081539_10003263
375 Ga0081539_10004664
376 Ga0081539_10005678
377 Ga0081539_10050061
378 Ga0075368_10010355
379 Ga0075363_100024051
380 Ga0075367_10001803
381 Ga0099826_10066983
382 Ga0105245_10223782
383 Ga0105246_10002694
384 Ga0157378_10228847
385 Ga0157372_10052411
386 Ga0182008_10004774
387 Ga0182007_10001086
388 Ga0182005_1016213
389 Ga0183367_1005
390 Ga0209758_1006360
391 Ga0207426_1002394
392 Ga0207426_1010575
393 Ga0207426_1031619
394 Ga0207647_10016199
395 Ga0207668_10000458
396 Ga0207668_10266159
397 Ga0207702_10058602
398 Ga0207675_100126514
399 Ga0209371_1005533
400 Ga0209813_10008869
401 Ga0268266_10065746
402 Ga0307515_10001120
403 Ga0268256_1005766
404 Ga0307511_10008569
405 Ga0307511_10049038
406 Ga0307512_10051702
407 Ga0307513_10181060
408 Ga0307508_10000820
409 Ga0307508_10002228
410 Ga0307508_10029195
411 Ga0307508_10053793
412 Ga0307514_10005625
413 Ga0316576_10013614
414 Ga0316578_10009459
415 Ga0307516_10014301
416 Ga0307516_10035129
417 Ga0307516_10078520
418 Ga0307405_10083887
419 Ga0307518_10071184
420 Ga0307410_10107961
421 Ga0307409_100114491
422 Ga0307415_100093237
423 Ga0316593_10033174
424 Ga0307510_10042609
425 Ga0373948_0011821
426 Ga0373951_0000208
427 Ga0373942_0000020
428 Ga0395900_0075072
429 Ga0395898_0010868
430 Ga0395901_0089531
431 Ga0395901_0459503
432 Ga0439436_0000169
433 Ga0451853_1880415
434 Ga0451853_2096403
435 Ga0439433_0002349
436 Ga0439448_0000636
437 Ga0439449_0000534
438 Ga0439449_0001711
439 Ga0439449_0013072
440 Ga0439455_0001086
441 Ga0439457_000115
442 Ga0439457_000694
443 Ga0439457_019269
444 Ga0439462_0013385
445 Ga0450894_000926
446 Ga0450896_005098
447 Ga0450899_000454
448 Ga0450903_000181
449 Ga0450903_010868
450 Ga0450906_002128
451 Ga0439458_0003024
452 Ga0466969_0012454
453 Ga0466969_0020535
454 Ga0466972_0001763
455 Ga0466972_0008601
456 Ga0466972_0026106
457 Ga0466965_0000210
458 Ga0466966_0009850
459 Ga0466966_0018418
460 Ga0466966_0033219
461 Ga0466966_0211132
462 Ga0466961_0047312
463 Ga0466963_0000721
464 Ga0466963_0077634
465 Ga0466964_0004318
466 Ga0466971_0000749
467 Ga0466968_0073429
468 Ga0466970_0001935
469 Ga0466970_0014169
470 Ga0466970_0215215
471 Ga0466957_0000446
472 Ga0466959_0001307
473 Ga0466958_0000691
474 Ga0466958_0135836
475 Ga0466967_0011466
476 Ga0466967_0329863
477 Ga0495627_005776
478 Ga0495592_0101205
479 Ga0495592_0158336
480 Ga0495603_0018752
481 Ga0495603_0042692
482 Ga0495629_0027170
483 Ga0495629_0057637
484 Ga0495629_0140860
485 Ga0495651_0002617
486 Ga0495605_0031631
487 Ga0495664_0000916
488 Ga0495585_0040169
489 Ga0495594_0013982
490 Ga0495607_0052197
491 Ga0495583_0022067
492 Ga0495606_0018406
493 Ga0495610_0038406
494 Ga0495616_0036627
495 Ga0495628_0094045
496 Ga0495643_0012776
497 Ga0495648_0035765
498 Ga0495648_0123742
499 Ga0495642_0035655
500 Ga0495652_0027350
501 Ga0495654_0017823
502 Ga0495640_0043346
503 Ga0495587_0003379
504 Ga0495609_0011306
505 Ga0495645_0189343
506 Ga0495622_0067110
507 Ga0495633_0016152
508 Ga0495667_0158471
509 Ga0495668_0007625
510 Ga0495634_0002500
511 Ga0495634_0070025
512 Ga0495611_0101025
513 Ga0495625_0096561
514 Ga0495625_0122444
515 Ga0495635_0000703
516 Ga0495588_0012332
517 Ga0495657_0006533
518 Ga0495657_0152758
519 Ga0495646_0001264
520 Ga0495658_0068620
521 Ga0495613_0046461
522 Ga0495624_0082923
523 Ga0495670_0018243
524 Ga0495671_0017489
525 Ga0495649_0014461
526 Ga0495649_0056500
527 Ga0495589_0013912
528 Ga0495589_0088522
529 Ga0495600_0012692
530 Ga0495600_0134466
531 Ga0495660_0025993
532 Ga0495581_0020714
533 Ga0495604_0000555
534 Ga0495604_0063543
535 Ga0495636_0019589
536 Ga0495636_0023276
537 Ga0495676_0018127
538 Ga0495676_0147098
539 Ga0495680_0099916
540 Ga0495679_053463
541 Ga0495685_004425
542 Ga0495681_0000290
543 Ga0495593_0005210
544 Ga0495593_0015709
545 Ga0495602_0033242
546 Ga0495614_0011209
547 Ga0495614_0055230
548 Ga0495626_0012351
549 Ga0495678_009728
550 Ga0501031_0003210
551 Ga0501031_0018892
552 Ga0501031_0171074
553 Ga0501032_0002876
554 Ga0501032_0027108
555 Ga0501033_0008312
556 Ga0501033_0017165
557 Ga0501033_0023061
558 Ga0501033_0061521
559 Ga0501033_0101894
560 Ga0501034_0002624
561 Ga0501034_0003791
562 Ga0501034_0052447
563 Ga0501034_0206693
564 Ga0501036_0001551
565 Ga0501036_0008297
566 Ga0501036_0008787
567 Ga0501036_0011523
568 Ga0501037_0002131
569 Ga0501037_0010296
570 Ga0501037_0037296
571 Ga0501038_0001356
572 Ga0501038_0009133
573 Ga0501038_0013001
574 Ga0501038_0031417
575 Ga0501038_0115270
576 Ga0501039_0007375
577 Ga0501039_0049141
578 Ga0501039_0218224
579 Ga0501040_0043258
580 Ga0501041_0005055
581 Ga0501042_0007470
582 Ga0501043_0004037
583 Ga0501043_0005808
584 Ga0501043_0008901
585 Ga0501046_0002540
586 Ga0501046_0008988
587 Ga0501046_0085508
588 Ga0501046_0133885
589 Ga0501047_0002730
590 Ga0501047_0020036
591 Ga0501047_0194709
592 Ga0501048_0013355
593 Ga0501048_0050632
594 Ga0501067_0003597
595 Ga0501068_0002237
596 Ga0501069_0006721
597 Ga0501069_0144588
598 Ga0501070_0002721
599 Ga0501070_0087440
600 Ga0501070_0096441
601 Ga0501071_0033931
602 Ga0501072_0008118
603 Ga0501074_0004852
604 Ga0501074_0013312
605 Ga0501074_0185526
606 Ga0501076_0007683
607 Ga0501077_0008391
608 Ga0501079_0007363
609 Ga0501080_0259094
610 Ga0501083_0012688
611 Ga0501035_0000268
612 Ga0501035_0002947
613 Ga0501035_0011529
614 Ga0501035_0041865
615 Ga0501035_0052267
616 Ga0501035_0189782
617 Ga0501044_0003962
618 Ga0501044_0010106
619 Ga0501044_0010519
620 Ga0501044_0028205
621 Ga0501044_0069681
622 Ga0501044_0225333
623 Ga0501045_0182333
624 nmdc:mga03n38_38908_c1
625 nmdc:mga06z11_1352_c1
626 nmdc:mga04h51_10620_c1
627 Ga0500600_0061934
628 Ga0501084_0014613
629 Ga0501084_0271025
630 Ga0501084_0333400
631 Ga0501082_0003993
632 Ga0466962_0005178
633 Ga0466962_0016395
634 2547408322
635 2585310147
636 2585313702
637 2616694852
638 2644262564
639 2644437340
640 2644629076
641 2676489141
642 2784588801
643 2785343079
644 2785369751
645 2786670828
646 2793983642
647 2804846071
648 2808842244
649 2808920784
650 2809232415
651 2811842778
652 2812357872
653 2812480329
654 2852636451
655 2856743187
656 2858850098
657 2862285863
658 2862296443
659 2862388689
660 2862511611
661 2862579044
662 2863404371
663 2867323087
664 2867432336
665 2873155535
666 2873317072
667 2877680886
668 2884702787
669 2891402664
670 2891559825
671 2891566021
672 2895436481
673 2895449102
674 2912719734
675 2912731238
676 2919469340
677 2946067993
678 2946076097
679 2947228962
680 2954385998
681 2954677154
682 2954687002
683 2954696649
684 2954705513
685 2954715998
686 2954725940
687 2954735858
688 2954744876
689 2954754724
690 2954763866
691 2990060003
692 2990092358
693 2997457662
694 2997604928
695 3006497924
696 8003833283
697 8003876344
698 8008567037
699 8008578699
700 8023624297
701 8025415726
702 8025482271
703 8033689072
704 8033691345
705 8047897226
706 8048133566
707 8048361720
708 8048374209
709 8048384011
710 8048407118
711 8055073378
712 8055180192
713 8056450961
714 8056667376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

86

364

0.88

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

98

367

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h1x-assembly1.cif.gz_A crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution 0.8971 29 95
4lvq-assembly2.cif.gz_B crystal structure of the m. tuberculosis phosphate binding protein psts3 0.8886 33 347
4lvq-assembly2.cif.gz_B crystal structure of the m. tuberculosis phosphate binding protein psts3 0.8757 33 347
7xg8-assembly1.cif.gz_A crystal structure of psts protein from cyanophage p-ssm2 0.8658 33 347
7xg8-assembly1.cif.gz_A crystal structure of psts protein from cyanophage p-ssm2 0.8605 33 347
ID Description Score Start End Superfamily
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9341 29 98 3.40.190.10
4n13A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.903 30 111 3.40.190.10
4lvqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9022 33 347 3.40.190.10
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8989 30 108 3.40.190.10
4pqjC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8938 30 111 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6B3EJM6-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9822 121 347
AF-A0A1D2IHR0-F1-model_v4 Phosphate-binding protein PstS 3 0.9755 145 347
AF-A0A6B3EJM6-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9695 121 347
AF-X8C7D0-F1-model_v4 deleted 0.9672 113 239
AF-A0A069JEX9-F1-model_v4 deleted 0.9655 114 219

Map