F420825

General Info

Members Datasets Scaffolds Average Seq Length
357 213 714 329

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10111280|Ga0105238_101112801
Length 385
Sequence MFPGSDADGDGCALILVKPAGAALHPCAAGAAAAIIGSTKPACHRGMPPEGTAMELRVFGRTGMQLSVLGFGCGAVGGLMVRGDPADQERTVARGLAAGVNYFDTAVQYGDGESEKNLGRILQKLKPANAAVGTKVRVPPADYGRIGDAITASLEASLKRLQRDHVDIFHLHNPITTKEGGTALSVRQVLGDVVPAFERLRRQGKTRFLGITAVGDTTALREAVNSGAFDSAQIVYNMLNPSAGEPLPRNYPAQDYERLFDATKAAGVGVVGIRVLAGGALSGSAERHPIASPAPEPIGSALSYDADLERARRLMPLVNEGFAGSLTEAATRFALSHPAMGTILVGMATPQQFEDALAAVEKGPLPQAALDRLGALRRGFSGEAR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
213 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.56
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.32
Nodule 0.28
Rhizoplane 0
Rhizosphere 85.99
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10111280 3300009551 Bacteria 2719
2 JGI25404J52841_10010519 3300003659 Bacteria 1989
3 Ga0070658_10002357 3300005327 Bacteria 15835
4 Ga0068869_100038028 3300005334 Bacteria 3426
5 Ga0070680_100006590 3300005336 Bacteria 8830
6 Ga0070680_100034201 3300005336 Bacteria 4098
7 Ga0070680_100050034 3300005336 Bacteria 3408
8 Ga0070680_100078820 3300005336 Bacteria 2714
9 Ga0070691_10011630 3300005341 Bacteria 4021
10 Ga0070661_100136006 3300005344 Bacteria 1849
11 Ga0070692_10109344 3300005345 Bacteria 1526
12 Ga0070703_10014541 3300005406 Bacteria 2243
13 Ga0070709_10000778 3300005434 Bacteria 17844
14 Ga0070709_10032117 3300005434 Bacteria 3164
15 Ga0070714_100018965 3300005435 Bacteria 5596
16 Ga0070714_100019640 3300005435 Bacteria 5509
17 Ga0070714_100019844 3300005435 Bacteria 5483
18 Ga0070713_100098973 3300005436 Bacteria 2522
19 Ga0070713_100318525 3300005436 Bacteria 1436
20 Ga0070713_100432325 3300005436 Bacteria 1234
21 Ga0070710_10000836 3300005437 Bacteria 14813
22 Ga0070710_10101268 3300005437 Bacteria 1716
23 Ga0070701_10013565 3300005438 Bacteria 3712
24 Ga0070711_100228500 3300005439 Bacteria 1450
25 Ga0070711_100270318 3300005439 Bacteria 1341
26 Ga0070705_100005710 3300005440 Bacteria 6077
27 Ga0070662_100037926 3300005457 Bacteria 3419
28 Ga0070681_10006126 3300005458 Bacteria 11675
29 Ga0070681_10073554 3300005458 Bacteria 3379
30 Ga0070681_10265520 3300005458 Bacteria 1628
31 Ga0068867_100069632 3300005459 Bacteria 2628
32 Ga0070698_100137792 3300005471 Bacteria 2394
33 Ga0070699_100017479 3300005518 Bacteria 6156
34 Ga0070679_100003910 3300005530 Bacteria 13701
35 Ga0070679_100034468 3300005530 Bacteria 5017
36 Ga0070679_100070662 3300005530 Bacteria 3482
37 Ga0070679_100156495 3300005530 Bacteria 2254
38 Ga0070679_100172959 3300005530 Bacteria 2132
39 Ga0068853_100102505 3300005539 Bacteria 2532
40 Ga0070695_100011544 3300005545 Bacteria 5284
41 Ga0070696_100079975 3300005546 Unclassified 2313
42 Ga0070665_100015079 3300005548 Bacteria 7759
43 Ga0070665_100048344 3300005548 Bacteria 4271
44 Ga0070665_100127114 3300005548 Bacteria 2551
45 Ga0070704_100231247 3300005549 Unclassified 1508
46 Ga0070704_100231248 3300005549 Bacteria 1508
47 Ga0068855_100022792 3300005563 Bacteria 7503
48 Ga0068855_100100448 3300005563 Bacteria 3331
49 Ga0068855_100376811 3300005563 Bacteria 1559
50 Ga0068857_100034256 3300005577 Bacteria 4491
51 Ga0068857_100150368 3300005577 Bacteria 2109
52 Ga0068856_100182822 3300005614 Bacteria 2110
53 Ga0068852_100335844 3300005616 Bacteria 1471
54 Ga0068851_10135923 3300005834 Bacteria 1333
55 Ga0068860_100235196 3300005843 Bacteria 1781
56 Ga0068862_100180484 3300005844 Unclassified 1894
57 Ga0081455_10011490 3300005937 Bacteria 8896
58 Ga0081455_10011615 3300005937 Bacteria 8836
59 Ga0081540_1002758 3300005983 Bacteria 14257
60 Ga0081540_1017330 3300005983 Bacteria 4463
61 Ga0081540_1020826 3300005983 Bacteria 3928
62 Ga0081540_1028410 3300005983 Bacteria 3142
63 Ga0081539_10000157 3300005985 Bacteria 158278
64 Ga0070717_10124014 3300006028 Bacteria 2216
65 Ga0075365_10002463 3300006038 Bacteria 9092
66 Ga0075368_10007303 3300006042 Bacteria 3895
67 Ga0075363_100010054 3300006048 Bacteria 4472
68 Ga0075432_10025032 3300006058 Unclassified 2047
69 Ga0070716_100003895 3300006173 Bacteria 7085
70 Ga0070716_100065346 3300006173 Bacteria 2118
71 Ga0070712_100028138 3300006175 Bacteria 3757
72 Ga0070712_100030858 3300006175 Bacteria 3606
73 Ga0070712_100050912 3300006175 Bacteria 2884
74 Ga0070712_100080802 3300006175 Bacteria 2354
75 Ga0070712_100113862 3300006175 Bacteria 2024
76 Ga0070712_100291756 3300006175 Bacteria 1317
77 Ga0070712_100355805 3300006175 Unclassified 1199
78 Ga0075367_10008217 3300006178 Bacteria 5394
79 Ga0075367_10016067 3300006178 Bacteria 4082
80 Ga0075369_10010234 3300006186 Bacteria 3667
81 Ga0075370_10029752 3300006353 Bacteria 3043
82 Ga0075428_100031712 3300006844 Bacteria 5838
83 Ga0075431_100003721 3300006847 Bacteria 14820
84 Ga0075433_10019360 3300006852 Bacteria 5670
85 Ga0075433_10070603 3300006852 Bacteria 3070
86 Ga0075434_100015025 3300006871 Bacteria 7414
87 Ga0075434_100123361 3300006871 Bacteria 2607
88 Ga0075435_100075725 3300007076 Bacteria 2757
89 Ga0105240_10047526 3300009093 Bacteria 5430
90 Ga0105240_10151595 3300009093 Bacteria 2760
91 Ga0111539_10000353 3300009094 Bacteria 56556
92 Ga0105245_10471763 3300009098 Bacteria 1267
93 Ga0105243_10167409 3300009148 Bacteria 1901
94 Ga0105242_10004217 3300009176 Bacteria 11204
95 Ga0105242_10128506 3300009176 Bacteria 2184
96 Ga0105238_10013556 3300009551 Bacteria 8230
97 Ga0105246_10173600 3300011119 Bacteria 1653
98 Ga0157373_10049039 3300013100 Bacteria 3010
99 Ga0157370_10017239 3300013104 Bacteria 7289
100 Ga0157370_10059892 3300013104 Bacteria 3617
101 Ga0157370_10095644 3300013104 Bacteria 2786
102 Ga0157369_10006011 3300013105 Bacteria 14101
103 Ga0157374_10282481 3300013296 Bacteria 1639
104 Ga0182008_10027537 3300014497 Unclassified 2878
105 Ga0157379_10136574 3300014968 Bacteria 2209
106 Ga0206354_11679758 3300020081 Bacteria 1600
107 Ga0206353_11225047 3300020082 Bacteria 2130
108 Ga0213872_10040603 3300021361 Bacteria 2125
109 Ga0213872_10060705 3300021361 Bacteria 1710
110 Ga0213874_10005331 3300021377 Bacteria 2990
111 Ga0213874_10006680 3300021377 Bacteria 2738
112 Ga0213874_10021920 3300021377 Unclassified 1767
113 Ga0213876_10005878 3300021384 Bacteria 6713
114 Ga0213876_10057883 3300021384 Bacteria 2047
115 Ga0213876_10117259 3300021384 Bacteria 1413
116 Ga0213875_10000755 3300021388 Bacteria 24416
117 Ga0213875_10004743 3300021388 Bacteria 7395
118 Ga0213875_10027388 3300021388 Bacteria 2711
119 Ga0213875_10035568 3300021388 Bacteria 2350
120 Ga0207692_10001600 3300025898 Bacteria 8533
121 Ga0207692_10035031 3300025898 Bacteria 2436
122 Ga0207692_10094824 3300025898 Bacteria 1626
123 Ga0207710_10168417 3300025900 Bacteria 1070
124 Ga0207688_10021607 3300025901 Bacteria 3518
125 Ga0207699_10003914 3300025906 Bacteria 7116
126 Ga0207699_10035840 3300025906 Bacteria 2825
127 Ga0207707_10076600 3300025912 Bacteria 2919
128 Ga0207707_10094046 3300025912 Bacteria 2619
129 Ga0207707_10206002 3300025912 Bacteria 1714
130 Ga0207695_10110483 3300025913 Bacteria 2729
131 Ga0207671_10034883 3300025914 Bacteria 3737
132 Ga0207671_10355433 3300025914 Bacteria 1162
133 Ga0207693_10047382 3300025915 Bacteria 3378
134 Ga0207693_10129948 3300025915 Bacteria 1980
135 Ga0207693_10131612 3300025915 Bacteria 1966
136 Ga0207660_10012700 3300025917 Bacteria 5515
137 Ga0207660_10022887 3300025917 Bacteria 4213
138 Ga0207660_10034878 3300025917 Bacteria 3490
139 Ga0207660_10079846 3300025917 Bacteria 2400
140 Ga0207660_10160467 3300025917 Bacteria 1734
141 Ga0207657_10015659 3300025919 Bacteria 7335
142 Ga0207649_10183777 3300025920 Bacteria 1465
143 Ga0207652_10489759 3300025921 Bacteria 1107
144 Ga0207646_10160606 3300025922 Bacteria 2028
145 Ga0207681_10060611 3300025923 Unclassified 2598
146 Ga0207694_10192733 3300025924 Bacteria 1656
147 Ga0207659_10342943 3300025926 Bacteria 1238
148 Ga0207687_10188223 3300025927 Bacteria 1604
149 Ga0207700_10019245 3300025928 Bacteria 4608
150 Ga0207700_10223105 3300025928 Unclassified 1599
151 Ga0207664_10011720 3300025929 Bacteria 6247
152 Ga0207664_10021368 3300025929 Bacteria 4811
153 Ga0207664_10072784 3300025929 Bacteria 2772
154 Ga0207664_10132409 3300025929 Bacteria 2100
155 Ga0207644_10253450 3300025931 Bacteria 1405
156 Ga0207706_10110174 3300025933 Bacteria 2422
157 Ga0207709_10116245 3300025935 Bacteria 1798
158 Ga0207665_10003985 3300025939 Bacteria 9869
159 Ga0207665_10193606 3300025939 Bacteria 1478
160 Ga0207665_10372974 3300025939 Bacteria 1081
161 Ga0207689_10010612 3300025942 Bacteria 7932
162 Ga0207667_10458139 3300025949 Bacteria 1295
163 Ga0207708_10091508 3300026075 Bacteria 2346
164 Ga0207702_10180826 3300026078 Bacteria 1942
165 Ga0207702_10548553 3300026078 Bacteria 1130
166 Ga0207641_10489340 3300026088 Bacteria 1193
167 Ga0207674_10041896 3300026116 Bacteria 4733
168 Ga0207674_10090216 3300026116 Bacteria 3056
169 Ga0207698_10030367 3300026142 Bacteria 3885
170 Ga0209813_10026035 3300027866 Bacteria 1688
171 Ga0207428_10001110 3300027907 Bacteria 29297
172 Ga0268266_10011541 3300028379 Bacteria 7672
173 Ga0268266_10026987 3300028379 Bacteria 4886
174 Ga0268266_10039446 3300028379 Bacteria 4023
175 Ga0268265_10095970 3300028380 Unclassified 2382
176 Ga0268264_10183812 3300028381 Bacteria 1901
177 Ga0268264_10248328 3300028381 Bacteria 1652
178 Ga0307517_10000744 3300028786 Bacteria 56253
179 Ga0307515_10058169 3300028794 Bacteria 5574
180 Ga0265332_10065303 3300031238 Bacteria 1554
181 Ga0265328_10031674 3300031239 Bacteria 1965
182 Ga0265339_10000052 3300031249 Bacteria 101603
183 Ga0265313_10000318 3300031595 Bacteria 52390
184 Ga0265313_10009400 3300031595 Bacteria 6350
185 Ga0307508_10054839 3300031616 Bacteria 3532
186 Ga0307508_10062660 3300031616 Bacteria 3282
187 Ga0265314_10077111 3300031711 Bacteria 2212
188 Ga0265342_10000518 3300031712 Bacteria 41040
189 Ga0307412_10334000 3300031911 Bacteria 1211
190 Ga0373934_0020009 3300035086 Unclassified 2573
191 Ga0373934_0032461 3300035086 Bacteria 2048
192 Ga0373934_0064247 3300035086 Bacteria 1465
193 Ga0373923_0037093 3300035111 Bacteria 1993
194 Ga0373923_0059587 3300035111 Bacteria 1619
195 Ga0373936_0006648 3300035113 Bacteria 4353
196 Ga0373953_0049283 3300035117 Bacteria 1699
197 Ga0373954_0021487 3300035118 Bacteria 2923
198 Ga0373954_0027442 3300035118 Bacteria 2614
199 Ga0373954_0049937 3300035118 Bacteria 1962
200 Ga0373956_0066151 3300035119 Bacteria 1643
201 Ga0373943_0011439 3300035170 Bacteria 3993
202 Ga0373943_0091873 3300035170 Unclassified 1573
203 Ga0373943_0113352 3300035170 Bacteria 1433
204 Ga0373946_0016423 3300035171 Bacteria 2820
205 Ga0373946_0031206 3300035171 Bacteria 2132
206 Ga0373955_0009615 3300035172 Bacteria 4538
207 Ga0373955_0015891 3300035172 Bacteria 3694
208 Ga0373955_0073042 3300035172 Bacteria 1922
209 Ga0373942_0033692 3300035207 Bacteria 1367
210 Ga0373924_0051194 3300035410 Unclassified 1712
211 Ga0373935_0028815 3300035692 Bacteria 3432
212 Ga0373927_0001997 3300035695 Bacteria 15042
213 Ga0373927_0054450 3300035695 Unclassified 2588
214 Ga0373927_0091593 3300035695 Bacteria 1974
215 Ga0373933_0000788 3300035724 Bacteria 19348
216 Ga0373933_0006287 3300035724 Bacteria 6464
217 Ga0373933_0032176 3300035724 Bacteria 3047
218 Ga0373933_0037931 3300035724 Bacteria 2829
219 Ga0373933_0077610 3300035724 Bacteria 2030
220 Ga0373933_0253571 3300035724 Bacteria 1133
221 Ga0373947_0005895 3300035725 Bacteria 7142
222 Ga0373947_0051464 3300035725 Bacteria 2478
223 Ga0373937_0003010 3300036401 Bacteria 14133
224 Ga0373937_0005826 3300036401 Bacteria 10594
225 Ga0373937_0044935 3300036401 Unclassified 4035
226 Ga0373937_0046093 3300036401 Bacteria 3985
227 Ga0373937_0303427 3300036401 Bacteria 1509
228 Ga0373925_0027806 3300037068 Bacteria 4140
229 Ga0373925_0036568 3300037068 Bacteria 3623
230 Ga0395899_0014212 3300037312 Bacteria 6075
231 Ga0395900_0010027 3300037418 Bacteria 9694
232 Ga0395898_0032056 3300037466 Bacteria 5245
233 Ga0395898_0526273 3300037466 Bacteria 1124
234 Ga0436364_0200832 3300037853 Bacteria 50854
235 Ga0436364_0713683 3300037853 Bacteria 5153
236 Ga0436364_0717187 3300037853 Bacteria 10318
237 Ga0436364_1081865 3300037853 Bacteria 1423
238 Ga0436364_1119186 3300037853 Bacteria 34885
239 Ga0395901_0000475 3300038443 Bacteria 46590
240 Ga0395901_0040850 3300038443 Bacteria 4805
241 Ga0395901_0135205 3300038443 Bacteria 2591
242 Ga0436365_0493796 3300039437 Bacteria 2130
243 Ga0436365_0605653 3300039437 Bacteria 55706
244 Ga0436365_1890581 3300039437 Bacteria 4898
245 Ga0436365_1921439 3300039437 Bacteria 2024
246 Ga0436360_0922659 3300039438 Bacteria 3973
247 Ga0436361_0178763 3300039447 Bacteria 1894
248 Ga0436361_0199909 3300039447 Bacteria 2197
249 Ga0436361_0954415 3300039447 Bacteria 2333
250 Ga0436363_0580065 3300039450 Bacteria 40060
251 Ga0436363_1133281 3300039450 Bacteria 4983
252 Ga0436363_1256843 3300039450 Bacteria 2611
253 Ga0439441_003693 3300042001 Bacteria 2276
254 Ga0451577_0004021 3300042876 Bacteria 15813
255 Ga0466966_0075618 3300044684 Bacteria 2104
256 Ga0453684_0065856 3300044712 Bacteria 4617
257 Ga0451576_0028034 3300045051 Bacteria 6037
258 Ga0495592_0043833 3300046454 Bacteria 3345
259 Ga0495603_0001070 3300046455 Bacteria 15886
260 Ga0495629_0000333 3300046459 Bacteria 40364
261 Ga0495641_0013583 3300046461 Bacteria 4461
262 Ga0495651_0007058 3300046462 Bacteria 8588
263 Ga0495651_0012668 3300046462 Bacteria 6509
264 Ga0495651_0055368 3300046462 Bacteria 3048
265 Ga0495653_0025609 3300046463 Bacteria 4737
266 Ga0495653_0080304 3300046463 Bacteria 2413
267 Ga0495653_0126663 3300046463 Bacteria 1813
268 Ga0495580_0003347 3300046472 Bacteria 13709
269 Ga0495582_0000581 3300046473 Bacteria 20224
270 Ga0495639_0000231 3300046475 Bacteria 27804
271 Ga0495662_0001332 3300046476 Bacteria 12221
272 Ga0495664_0002812 3300046477 Bacteria 9350
273 Ga0495664_0033825 3300046477 Bacteria 3005
274 Ga0495594_0016843 3300046499 Bacteria 3855
275 Ga0495608_0013641 3300046511 Bacteria 5637
276 Ga0495608_0017386 3300046511 Bacteria 4975
277 Ga0495618_0085437 3300046514 Bacteria 2017
278 Ga0495630_0006442 3300046517 Bacteria 8350
279 Ga0495630_0259308 3300046517 Unclassified 1328
280 Ga0495652_0033515 3300046529 Bacteria 4484
281 Ga0495640_0025843 3300046533 Bacteria 4252
282 Ga0495640_0147696 3300046533 Bacteria 1512
283 Ga0495640_0190484 3300046533 Bacteria 1304
284 Ga0495587_0012520 3300046536 Bacteria 5335
285 Ga0495645_0003602 3300046543 Bacteria 10505
286 Ga0495645_0005401 3300046543 Bacteria 8764
287 Ga0495667_0004316 3300046559 Bacteria 9590
288 Ga0495667_0017550 3300046559 Bacteria 4834
289 Ga0495667_0036439 3300046559 Bacteria 3284
290 Ga0495667_0071891 3300046559 Bacteria 2256
291 Ga0495634_0000633 3300046642 Bacteria 34239
292 Ga0495635_0007725 3300046663 Bacteria 7503
293 Ga0495635_0136857 3300046663 Bacteria 1669
294 Ga0495588_0072138 3300046674 Bacteria 1796
295 Ga0495657_0158684 3300046675 Bacteria 1400
296 Ga0495599_0027433 3300046678 Bacteria 3570
297 Ga0495623_0012077 3300046679 Bacteria 5594
298 Ga0495658_0000725 3300046683 Bacteria 17802
299 Ga0495613_0031766 3300046689 Bacteria 3922
300 Ga0495624_0005763 3300046690 Bacteria 8879
301 Ga0495600_0135526 3300046809 Bacteria 1600
302 Ga0495581_0007641 3300047315 Bacteria 6255
303 Ga0495604_0076249 3300047317 Bacteria 2522
304 Ga0495674_0005532 3300047319 Bacteria 12120
305 Ga0495674_0038781 3300047319 Bacteria 4274
306 Ga0495672_0008157 3300047320 Bacteria 7771
307 Ga0495676_0035402 3300047321 Bacteria 4176
308 Ga0495680_0186697 3300047322 Bacteria 1493
309 Ga0495680_0202713 3300047322 Bacteria 1423
310 Ga0495675_0000686 3300047444 Bacteria 21269
311 Ga0495684_0029873 3300047471 Bacteria 4184
312 Ga0495684_0107183 3300047471 Bacteria 2111
313 Ga0495686_0054919 3300047472 Bacteria 2493
314 Ga0495593_0000679 3300047673 Bacteria 19632
315 Ga0495602_0004262 3300048088 Bacteria 14882
316 Ga0495602_0141230 3300048088 Bacteria 1906
317 Ga0495602_0227678 3300048088 Bacteria 1403
318 Ga0495614_0021301 3300048089 Bacteria 2799
319 Ga0496121_0023953 3300048924 Bacteria 5854
320 Ga0496121_0076703 3300048924 Bacteria 2664
321 Ga0496126_0019049 3300048929 Bacteria 6773
322 Ga0496126_0068652 3300048929 Bacteria 3164
323 Ga0501047_0283997 3300049581 Bacteria 1499
324 Ga0501035_0011737 3300049822 Bacteria 8114
325 Ga0501035_0263931 3300049822 Bacteria 1459
326 Ga0501044_0138987 3300049823 Bacteria 2418
327 nmdc:mga03683_86562_c1 3300050489 Bacteria 1361
328 nmdc:mga03n38_40697_c1 3300050490 Bacteria 2021
329 nmdc:mga03n38_62928_c1 3300050490 Bacteria 1694
330 nmdc:mga00v17_28630_c1 3300050491 Bacteria 3264
331 nmdc:mga0k408_16101_c1 3300050493 Bacteria 4142
332 nmdc:mga0k408_53058_c1 3300050493 Bacteria 2349
333 nmdc:mga06z11_4017_c1 3300050494 Bacteria 5745
334 nmdc:mga04h51_30493_c1 3300050495 Bacteria 1697
335 nmdc:mga09592_381814_c1 3300050508 Unclassified 1218
336 nmdc:mga06r32_368_c1 3300050510 Bacteria 37943
337 nmdc:mga08y16_3859_c1 3300050511 Bacteria 15586
338 nmdc:mga0n895_18258_c1 3300050512 Bacteria 6486
339 nmdc:mga0n895_197274_c1 3300050512 Bacteria 2044
340 nmdc:mga0n895_308204_c1 3300050512 Bacteria 1605
341 nmdc:mga0rr50_282692_c1 3300050513 Bacteria 1385
342 nmdc:mga0rr50_355304_c1 3300050513 Unclassified 1233
343 nmdc:mga0a205_2148_c1 3300050515 Bacteria 17315
344 nmdc:mga0a205_28352_c1 3300050515 Bacteria 5354
345 nmdc:mga0a205_5574_c2 3300050515 Bacteria 9003
346 Ga0495601_0008957 3300053077 Bacteria 5907
347 Ga0495601_0009601 3300053077 Bacteria 5727
348 Ga0495601_0027181 3300053077 Bacteria 3537
349 Ga0495601_0039638 3300053077 Bacteria 2951
350 Ga0495612_0000629 3300053078 Bacteria 14161
351 Ga0495595_0014098 3300053084 Bacteria 3386
352 Ga0495595_0025924 3300053084 Bacteria 2600
353 Ga0495619_0188489 3300053085 Bacteria 1427
354 Ga0500616_0003831 3300053153 Bacteria 11126
355 Ga0500636_0058728 3300053177 Bacteria 2248
356 Ga0500552_001160 3300053733 Bacteria 2492
357 2904694430 2904690495 Bacteria 9412302
358 Ga0105238_10111280
359 JGI25404J52841_10010519
360 Ga0070658_10002357
361 Ga0068869_100038028
362 Ga0070680_100006590
363 Ga0070680_100034201
364 Ga0070680_100050034
365 Ga0070680_100078820
366 Ga0070691_10011630
367 Ga0070661_100136006
368 Ga0070692_10109344
369 Ga0070703_10014541
370 Ga0070709_10000778
371 Ga0070709_10032117
372 Ga0070714_100018965
373 Ga0070714_100019640
374 Ga0070714_100019844
375 Ga0070713_100098973
376 Ga0070713_100318525
377 Ga0070713_100432325
378 Ga0070710_10000836
379 Ga0070710_10101268
380 Ga0070701_10013565
381 Ga0070711_100228500
382 Ga0070711_100270318
383 Ga0070705_100005710
384 Ga0070662_100037926
385 Ga0070681_10006126
386 Ga0070681_10073554
387 Ga0070681_10265520
388 Ga0068867_100069632
389 Ga0070698_100137792
390 Ga0070699_100017479
391 Ga0070679_100003910
392 Ga0070679_100034468
393 Ga0070679_100070662
394 Ga0070679_100156495
395 Ga0070679_100172959
396 Ga0068853_100102505
397 Ga0070695_100011544
398 Ga0070696_100079975
399 Ga0070665_100015079
400 Ga0070665_100048344
401 Ga0070665_100127114
402 Ga0070704_100231247
403 Ga0070704_100231248
404 Ga0068855_100022792
405 Ga0068855_100100448
406 Ga0068855_100376811
407 Ga0068857_100034256
408 Ga0068857_100150368
409 Ga0068856_100182822
410 Ga0068852_100335844
411 Ga0068851_10135923
412 Ga0068860_100235196
413 Ga0068862_100180484
414 Ga0081455_10011490
415 Ga0081455_10011615
416 Ga0081540_1002758
417 Ga0081540_1017330
418 Ga0081540_1020826
419 Ga0081540_1028410
420 Ga0081539_10000157
421 Ga0070717_10124014
422 Ga0075365_10002463
423 Ga0075368_10007303
424 Ga0075363_100010054
425 Ga0075432_10025032
426 Ga0070716_100003895
427 Ga0070716_100065346
428 Ga0070712_100028138
429 Ga0070712_100030858
430 Ga0070712_100050912
431 Ga0070712_100080802
432 Ga0070712_100113862
433 Ga0070712_100291756
434 Ga0070712_100355805
435 Ga0075367_10008217
436 Ga0075367_10016067
437 Ga0075369_10010234
438 Ga0075370_10029752
439 Ga0075428_100031712
440 Ga0075431_100003721
441 Ga0075433_10019360
442 Ga0075433_10070603
443 Ga0075434_100015025
444 Ga0075434_100123361
445 Ga0075435_100075725
446 Ga0105240_10047526
447 Ga0105240_10151595
448 Ga0111539_10000353
449 Ga0105245_10471763
450 Ga0105243_10167409
451 Ga0105242_10004217
452 Ga0105242_10128506
453 Ga0105238_10013556
454 Ga0105246_10173600
455 Ga0157373_10049039
456 Ga0157370_10017239
457 Ga0157370_10059892
458 Ga0157370_10095644
459 Ga0157369_10006011
460 Ga0157374_10282481
461 Ga0182008_10027537
462 Ga0157379_10136574
463 Ga0206354_11679758
464 Ga0206353_11225047
465 Ga0213872_10040603
466 Ga0213872_10060705
467 Ga0213874_10005331
468 Ga0213874_10006680
469 Ga0213874_10021920
470 Ga0213876_10005878
471 Ga0213876_10057883
472 Ga0213876_10117259
473 Ga0213875_10000755
474 Ga0213875_10004743
475 Ga0213875_10027388
476 Ga0213875_10035568
477 Ga0207692_10001600
478 Ga0207692_10035031
479 Ga0207692_10094824
480 Ga0207710_10168417
481 Ga0207688_10021607
482 Ga0207699_10003914
483 Ga0207699_10035840
484 Ga0207707_10076600
485 Ga0207707_10094046
486 Ga0207707_10206002
487 Ga0207695_10110483
488 Ga0207671_10034883
489 Ga0207671_10355433
490 Ga0207693_10047382
491 Ga0207693_10129948
492 Ga0207693_10131612
493 Ga0207660_10012700
494 Ga0207660_10022887
495 Ga0207660_10034878
496 Ga0207660_10079846
497 Ga0207660_10160467
498 Ga0207657_10015659
499 Ga0207649_10183777
500 Ga0207652_10489759
501 Ga0207646_10160606
502 Ga0207681_10060611
503 Ga0207694_10192733
504 Ga0207659_10342943
505 Ga0207687_10188223
506 Ga0207700_10019245
507 Ga0207700_10223105
508 Ga0207664_10011720
509 Ga0207664_10021368
510 Ga0207664_10072784
511 Ga0207664_10132409
512 Ga0207644_10253450
513 Ga0207706_10110174
514 Ga0207709_10116245
515 Ga0207665_10003985
516 Ga0207665_10193606
517 Ga0207665_10372974
518 Ga0207689_10010612
519 Ga0207667_10458139
520 Ga0207708_10091508
521 Ga0207702_10180826
522 Ga0207702_10548553
523 Ga0207641_10489340
524 Ga0207674_10041896
525 Ga0207674_10090216
526 Ga0207698_10030367
527 Ga0209813_10026035
528 Ga0207428_10001110
529 Ga0268266_10011541
530 Ga0268266_10026987
531 Ga0268266_10039446
532 Ga0268265_10095970
533 Ga0268264_10183812
534 Ga0268264_10248328
535 Ga0307517_10000744
536 Ga0307515_10058169
537 Ga0265332_10065303
538 Ga0265328_10031674
539 Ga0265339_10000052
540 Ga0265313_10000318
541 Ga0265313_10009400
542 Ga0307508_10054839
543 Ga0307508_10062660
544 Ga0265314_10077111
545 Ga0265342_10000518
546 Ga0307412_10334000
547 Ga0373934_0020009
548 Ga0373934_0032461
549 Ga0373934_0064247
550 Ga0373923_0037093
551 Ga0373923_0059587
552 Ga0373936_0006648
553 Ga0373953_0049283
554 Ga0373954_0021487
555 Ga0373954_0027442
556 Ga0373954_0049937
557 Ga0373956_0066151
558 Ga0373943_0011439
559 Ga0373943_0091873
560 Ga0373943_0113352
561 Ga0373946_0016423
562 Ga0373946_0031206
563 Ga0373955_0009615
564 Ga0373955_0015891
565 Ga0373955_0073042
566 Ga0373942_0033692
567 Ga0373924_0051194
568 Ga0373935_0028815
569 Ga0373927_0001997
570 Ga0373927_0054450
571 Ga0373927_0091593
572 Ga0373933_0000788
573 Ga0373933_0006287
574 Ga0373933_0032176
575 Ga0373933_0037931
576 Ga0373933_0077610
577 Ga0373933_0253571
578 Ga0373947_0005895
579 Ga0373947_0051464
580 Ga0373937_0003010
581 Ga0373937_0005826
582 Ga0373937_0044935
583 Ga0373937_0046093
584 Ga0373937_0303427
585 Ga0373925_0027806
586 Ga0373925_0036568
587 Ga0395899_0014212
588 Ga0395900_0010027
589 Ga0395898_0032056
590 Ga0395898_0526273
591 Ga0436364_0200832
592 Ga0436364_0713683
593 Ga0436364_0717187
594 Ga0436364_1081865
595 Ga0436364_1119186
596 Ga0395901_0000475
597 Ga0395901_0040850
598 Ga0395901_0135205
599 Ga0436365_0493796
600 Ga0436365_0605653
601 Ga0436365_1890581
602 Ga0436365_1921439
603 Ga0436360_0922659
604 Ga0436361_0178763
605 Ga0436361_0199909
606 Ga0436361_0954415
607 Ga0436363_0580065
608 Ga0436363_1133281
609 Ga0436363_1256843
610 Ga0439441_003693
611 Ga0451577_0004021
612 Ga0466966_0075618
613 Ga0453684_0065856
614 Ga0451576_0028034
615 Ga0495592_0043833
616 Ga0495603_0001070
617 Ga0495629_0000333
618 Ga0495641_0013583
619 Ga0495651_0007058
620 Ga0495651_0012668
621 Ga0495651_0055368
622 Ga0495653_0025609
623 Ga0495653_0080304
624 Ga0495653_0126663
625 Ga0495580_0003347
626 Ga0495582_0000581
627 Ga0495639_0000231
628 Ga0495662_0001332
629 Ga0495664_0002812
630 Ga0495664_0033825
631 Ga0495594_0016843
632 Ga0495608_0013641
633 Ga0495608_0017386
634 Ga0495618_0085437
635 Ga0495630_0006442
636 Ga0495630_0259308
637 Ga0495652_0033515
638 Ga0495640_0025843
639 Ga0495640_0147696
640 Ga0495640_0190484
641 Ga0495587_0012520
642 Ga0495645_0003602
643 Ga0495645_0005401
644 Ga0495667_0004316
645 Ga0495667_0017550
646 Ga0495667_0036439
647 Ga0495667_0071891
648 Ga0495634_0000633
649 Ga0495635_0007725
650 Ga0495635_0136857
651 Ga0495588_0072138
652 Ga0495657_0158684
653 Ga0495599_0027433
654 Ga0495623_0012077
655 Ga0495658_0000725
656 Ga0495613_0031766
657 Ga0495624_0005763
658 Ga0495600_0135526
659 Ga0495581_0007641
660 Ga0495604_0076249
661 Ga0495674_0005532
662 Ga0495674_0038781
663 Ga0495672_0008157
664 Ga0495676_0035402
665 Ga0495680_0186697
666 Ga0495680_0202713
667 Ga0495675_0000686
668 Ga0495684_0029873
669 Ga0495684_0107183
670 Ga0495686_0054919
671 Ga0495593_0000679
672 Ga0495602_0004262
673 Ga0495602_0141230
674 Ga0495602_0227678
675 Ga0495614_0021301
676 Ga0496121_0023953
677 Ga0496121_0076703
678 Ga0496126_0019049
679 Ga0496126_0068652
680 Ga0501047_0283997
681 Ga0501035_0011737
682 Ga0501035_0263931
683 Ga0501044_0138987
684 nmdc:mga03683_86562_c1
685 nmdc:mga03n38_40697_c1
686 nmdc:mga03n38_62928_c1
687 nmdc:mga00v17_28630_c1
688 nmdc:mga0k408_16101_c1
689 nmdc:mga0k408_53058_c1
690 nmdc:mga06z11_4017_c1
691 nmdc:mga04h51_30493_c1
692 nmdc:mga09592_381814_c1
693 nmdc:mga06r32_368_c1
694 nmdc:mga08y16_3859_c1
695 nmdc:mga0n895_18258_c1
696 nmdc:mga0n895_197274_c1
697 nmdc:mga0n895_308204_c1
698 nmdc:mga0rr50_282692_c1
699 nmdc:mga0rr50_355304_c1
700 nmdc:mga0a205_2148_c1
701 nmdc:mga0a205_28352_c1
702 nmdc:mga0a205_5574_c2
703 Ga0495601_0008957
704 Ga0495601_0009601
705 Ga0495601_0027181
706 Ga0495601_0039638
707 Ga0495612_0000629
708 Ga0495595_0014098
709 Ga0495595_0025924
710 Ga0495619_0188489
711 Ga0500616_0003831
712 Ga0500636_0058728
713 Ga0500552_001160
714 2904694430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

68

378

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8649 3 308
4ast-assembly1.cif.gz_H the apo structure of a bacterial aldo-keto reductase akr14a1 0.8486 1 324
4ast-assembly1.cif.gz_F the apo structure of a bacterial aldo-keto reductase akr14a1 0.8443 1 322
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.844 3 308
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.8428 1 325
ID Description Score Start End Superfamily
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8475 1 118 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8327 1 331 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8297 1 327 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.823 4 322 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8205 1 323 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2H9V6T5-F1-model_v4 deleted 0.984 1 331
AF-A0A2H9V6T5-F1-model_v4 deleted 0.9811 1 331
AF-A0A4Q5QJ70-F1-model_v4 Aldo/keto reductase 0.9779 2 184
AF-A0A2V6U9B1-F1-model_v4 Aldo/keto reductase 0.9757 41 203
AF-A0A3A9JQ81-F1-model_v4 Aldo/keto reductase 0.975 1 331

Map