F420810

General Info

Members Datasets Scaffolds Average Seq Length
357 149 357 184

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10477656|Ga0105240_104776562
Length 190
Sequence MADETYPVETYSIEVAGVKRDLRLFAIKPGVRIAILNILGDTELVQAVSKVLGEKLRARNDIDVLVTPEAKSIPLAHGLSVETGLPYVVLRKSYKPYMGDALQSETLSITTGAAQTLFLDEKDRDLIKGKHVVLIDDVISTGSTLQGMRLIMEKAGAQVVAEAAIFTEGDRAAWSNIIALGHLPVFIDKA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_166731 2162886006 Bacteria 1429
2 SwRhRL3b_contig_334061 2162886006 Bacteria 809
3 SwRhRL2b_contig_1049683 2162886007 Bacteria 2915
4 JGI25406J46586_10007763 3300003203 Bacteria 4881
5 JGI25406J46586_10009862 3300003203 Bacteria 4266
6 Ga0065704_10071418 3300005289 Bacteria 11266
7 Ga0065704_10237721 3300005289 Unclassified 1024
8 Ga0065704_10370191 3300005289 Bacteria 786
9 Ga0065712_10449020 3300005290 Bacteria 687
10 Ga0065715_10553261 3300005293 Bacteria 739
11 Ga0065707_10013939 3300005295 Bacteria 1951
12 Ga0065707_10084681 3300005295 Bacteria 6894
13 Ga0065707_10089419 3300005295 Unclassified 4373
14 Ga0065707_10095425 3300005295 Bacteria 3361
15 Ga0065707_10098374 3300005295 Bacteria 3083
16 Ga0065707_10112621 3300005295 Unclassified 2355
17 Ga0065707_10133079 3300005295 Bacteria 1887
18 Ga0065707_10235681 3300005295 Bacteria 1173
19 Ga0070689_100184101 3300005340 Bacteria 1698
20 Ga0070691_10339670 3300005341 Unclassified 831
21 Ga0070669_100390999 3300005353 Bacteria 1136
22 Ga0070688_100579089 3300005365 Bacteria 857
23 Ga0070701_10255363 3300005438 Unclassified 1060
24 Ga0070705_100558186 3300005440 Unclassified 879
25 Ga0070700_100025610 3300005441 Bacteria 3475
26 Ga0070694_100171035 3300005444 Unclassified 1601
27 Ga0070694_100557608 3300005444 Unclassified 918
28 Ga0070662_100017440 3300005457 Bacteria 4842
29 Ga0070706_100079496 3300005467 Bacteria 3035
30 Ga0070706_100163485 3300005467 Bacteria 2078
31 Ga0070706_100342545 3300005467 Bacteria 1394
32 Ga0070706_101268220 3300005467 Unclassified 676
33 Ga0070707_100053726 3300005468 Unclassified 3863
34 Ga0070707_100331309 3300005468 Bacteria 1479
35 Ga0070698_100048709 3300005471 Bacteria 4330
36 Ga0070698_100151953 3300005471 Bacteria 2263
37 Ga0070699_100002030 3300005518 Bacteria 18283
38 Ga0070699_100017430 3300005518 Bacteria 6165
39 Ga0070699_100151723 3300005518 Bacteria 2050
40 Ga0070699_100326996 3300005518 Bacteria 1378
41 Ga0070699_100593376 3300005518 Bacteria 1010
42 Ga0070699_100928503 3300005518 Unclassified 797
43 Ga0070699_101177204 3300005518 Bacteria 703
44 Ga0070697_100738725 3300005536 Unclassified 869
45 Ga0068853_100399630 3300005539 Bacteria 1286
46 Ga0070696_100078040 3300005546 Bacteria 2341
47 Ga0070696_100241486 3300005546 Bacteria 1363
48 Ga0070704_100071564 3300005549 Bacteria 2520
49 Ga0070704_100253400 3300005549 Bacteria 1447
50 Ga0068857_100233436 3300005577 Bacteria 1683
51 Ga0068857_100244895 3300005577 Bacteria 1642
52 Ga0068857_100414008 3300005577 Bacteria 1256
53 Ga0068856_100167748 3300005614 Bacteria 2207
54 Ga0070702_100557168 3300005615 Unclassified 852
55 Ga0068859_100026108 3300005617 Bacteria 5859
56 Ga0068859_100188746 3300005617 Bacteria 2145
57 Ga0068859_100315492 3300005617 Unclassified 1657
58 Ga0068859_100892660 3300005617 Bacteria 974
59 Ga0068864_100274691 3300005618 Unclassified 1571
60 Ga0068861_100354990 3300005719 Bacteria 1287
61 Ga0068861_100359644 3300005719 Unclassified 1280
62 Ga0068870_10636868 3300005840 Bacteria 729
63 Ga0068860_100090408 3300005843 Bacteria 2916
64 Ga0068862_100016489 3300005844 Bacteria 6149
65 Ga0068862_101203678 3300005844 Unclassified 756
66 Ga0081539_10002067 3300005985 Bacteria 30073
67 Ga0070712_100015236 3300006175 Bacteria 4946
68 Ga0075427_10000340 3300006194 Bacteria 5145
69 Ga0075428_100078817 3300006844 Bacteria 3596
70 Ga0075428_100114962 3300006844 Bacteria 2931
71 Ga0075428_100319638 3300006844 Unclassified 1668
72 Ga0075428_100374146 3300006844 Bacteria 1527
73 Ga0075428_100457007 3300006844 Bacteria 1367
74 Ga0075428_100797321 3300006844 Unclassified 1004
75 Ga0075430_100246657 3300006846 Bacteria 1480
76 Ga0075431_100010854 3300006847 Bacteria 9163
77 Ga0075431_100013792 3300006847 Bacteria 8160
78 Ga0075431_100040704 3300006847 Bacteria 4789
79 Ga0075431_100218822 3300006847 Bacteria 1943
80 Ga0075431_101457081 3300006847 Unclassified 643
81 Ga0075433_10080312 3300006852 Bacteria 2875
82 Ga0075433_10849172 3300006852 Unclassified 797
83 Ga0075434_100277384 3300006871 Bacteria 1696
84 Ga0075429_100005674 3300006880 Bacteria 10762
85 Ga0075429_100026448 3300006880 Bacteria 5038
86 Ga0075429_100034714 3300006880 Bacteria 4383
87 Ga0075429_100043720 3300006880 Bacteria 3898
88 Ga0075429_100109891 3300006880 Bacteria 2410
89 Ga0075429_100431180 3300006880 Unclassified 1155
90 Ga0075429_100693360 3300006880 Bacteria 892
91 Ga0075429_100882284 3300006880 Bacteria 783
92 Ga0097620_100026108 3300006931 Bacteria 5859
93 Ga0097620_100188754 3300006931 Bacteria 2145
94 Ga0097620_100315475 3300006931 Unclassified 1657
95 Ga0097620_100892589 3300006931 Bacteria 974
96 Ga0105240_10477656 3300009093 Bacteria 1390
97 Ga0105240_10507566 3300009093 Bacteria 1340
98 Ga0111539_10027299 3300009094 Bacteria 6971
99 Ga0105245_10022625 3300009098 Bacteria 5518
100 Ga0114129_10004481 3300009147 Bacteria 19691
101 Ga0114129_10008275 3300009147 Bacteria 14835
102 Ga0114129_10011707 3300009147 Bacteria 12482
103 Ga0114129_10024970 3300009147 Bacteria 8473
104 Ga0114129_10073225 3300009147 Bacteria 4772
105 Ga0114129_10082785 3300009147 Bacteria 4458
106 Ga0114129_10139297 3300009147 Bacteria 3327
107 Ga0114129_10485020 3300009147 Bacteria 1617
108 Ga0114129_10954611 3300009147 Bacteria 1083
109 Ga0114129_11003865 3300009147 Bacteria 1051
110 Ga0105243_10029149 3300009148 Bacteria 4243
111 Ga0105243_10049187 3300009148 Unclassified 3325
112 Ga0105243_10068356 3300009148 Bacteria 2863
113 Ga0105241_10101504 3300009174 Unclassified 2287
114 Ga0105241_10826560 3300009174 Unclassified 855
115 Ga0105242_10335653 3300009176 Bacteria 1391
116 Ga0105248_11326536 3300009177 Unclassified 814
117 Ga0105249_10030652 3300009553 Bacteria 4863
118 Ga0105249_10058320 3300009553 Bacteria 3539
119 Ga0105249_10162183 3300009553 Bacteria 2161
120 Ga0105249_10176908 3300009553 Bacteria 2073
121 Ga0105249_10498287 3300009553 Bacteria 1263
122 Ga0105239_10138261 3300010375 Bacteria 2713
123 Ga0105246_10015971 3300011119 Bacteria 4749
124 Ga0157372_10423912 3300013307 Unclassified 1551
125 Ga0157375_10858398 3300013308 Bacteria 1054
126 Ga0163163_10403123 3300014325 Unclassified 1426
127 Ga0157380_10169974 3300014326 Bacteria 1904
128 Ga0207684_10059169 3300025910 Unclassified 3252
129 Ga0207684_10137392 3300025910 Bacteria 2100
130 Ga0207654_10189435 3300025911 Bacteria 1347
131 Ga0207695_10505255 3300025913 Bacteria 1091
132 Ga0207671_10548421 3300025914 Bacteria 922
133 Ga0207693_10009522 3300025915 Bacteria 7913
134 Ga0207662_10128338 3300025918 Bacteria 1596
135 Ga0207646_10507087 3300025922 Bacteria 1087
136 Ga0207646_10989548 3300025922 Unclassified 743
137 Ga0207706_10080270 3300025933 Bacteria 2868
138 Ga0207686_10200762 3300025934 Bacteria 1428
139 Ga0207709_10027129 3300025935 Unclassified 3296
140 Ga0207709_10330106 3300025935 Bacteria 1145
141 Ga0207670_10609967 3300025936 Bacteria 897
142 Ga0207670_11157034 3300025936 Unclassified 654
143 Ga0207712_10138311 3300025961 Bacteria 1865
144 Ga0207677_10134405 3300026023 Bacteria 1883
145 Ga0207702_10200963 3300026078 Bacteria 1847
146 Ga0207702_10330760 3300026078 Bacteria 1453
147 Ga0207648_10433708 3300026089 Bacteria 1195
148 Ga0207674_10197964 3300026116 Bacteria 1959
149 Ga0207674_10285138 3300026116 Bacteria 1600
150 Ga0207674_10299155 3300026116 Bacteria 1558
151 Ga0207674_10982448 3300026116 Unclassified 813
152 Ga0207675_100154558 3300026118 Bacteria 2186
153 Ga0207675_100222119 3300026118 Bacteria 1820
154 Ga0268265_10035211 3300028380 Bacteria 3656
155 Ga0268265_11030575 3300028380 Bacteria 814
156 Ga0268264_10071718 3300028381 Bacteria 2936
157 Ga0265334_10027517 3300028573 Unclassified 2290
158 Ga0265318_10001482 3300028577 Bacteria 13732
159 Ga0265323_10097909 3300028653 Bacteria 974
160 Ga0265338_10033454 3300028800 Unclassified 4988
161 Ga0265328_10051646 3300031239 Unclassified 1509
162 Ga0265320_10007860 3300031240 Bacteria 6582
163 Ga0265320_10084220 3300031240 Unclassified 1481
164 Ga0265325_10043391 3300031241 Bacteria 2347
165 Ga0265329_10070652 3300031242 Unclassified 1104
166 Ga0265340_10048010 3300031247 Bacteria 2076
167 Ga0265331_10046653 3300031250 Bacteria 2087
168 Ga0265327_10013937 3300031251 Bacteria 5299
169 Ga0265316_10060032 3300031344 Bacteria 2956
170 Ga0307408_100093231 3300031548 Unclassified 2278
171 Ga0265313_10282141 3300031595 Unclassified 671
172 Ga0316575_10002885 3300031665 Bacteria 5844
173 Ga0316575_10072436 3300031665 Unclassified 1385
174 Ga0316579_10000728 3300031691 Bacteria 11282
175 Ga0316579_10015007 3300031691 Unclassified 3358
176 Ga0316579_10180331 3300031691 Bacteria 1021
177 Ga0265342_10309204 3300031712 Unclassified 831
178 Ga0316576_10037702 3300031727 Bacteria 3462
179 Ga0316576_10045570 3300031727 Bacteria 3172
180 Ga0316576_10142790 3300031727 Bacteria 1803
181 Ga0316576_10553222 3300031727 Unclassified 843
182 Ga0316576_10800817 3300031727 Unclassified 678
183 Ga0316576_10802423 3300031727 Unclassified 677
184 Ga0316578_10002176 3300031728 Bacteria 8464
185 Ga0316578_10013109 3300031728 Bacteria 4385
186 Ga0316578_10032545 3300031728 Bacteria 2980
187 Ga0307405_10139703 3300031731 Bacteria 1687
188 Ga0307405_10343482 3300031731 Bacteria 1149
189 Ga0316577_10012909 3300031733 Bacteria 4559
190 Ga0316577_10136388 3300031733 Bacteria 1381
191 Ga0316577_10204734 3300031733 Bacteria 1115
192 Ga0316577_10236376 3300031733 Bacteria 1033
193 Ga0307413_10089623 3300031824 Bacteria 1999
194 Ga0307406_10480071 3300031901 Unclassified 1004
195 Ga0307407_10831453 3300031903 Unclassified 704
196 Ga0307412_10090745 3300031911 Bacteria 2137
197 Ga0307412_10403722 3300031911 Unclassified 1113
198 Ga0307416_100167150 3300032002 Unclassified 2042
199 Ga0307416_100179223 3300032002 Bacteria 1984
200 Ga0307416_101589568 3300032002 Bacteria 759
201 Ga0307411_10690957 3300032005 Unclassified 888
202 Ga0307415_100048163 3300032126 Unclassified 2874
203 Ga0307415_100241996 3300032126 Unclassified 1460
204 Ga0316580_10099466 3300032139 Bacteria 890
205 Ga0316574_0005562 3300035398 Bacteria 6730
206 Ga0316574_0043698 3300035398 Bacteria 2769
207 Ga0316582_0032130 3300036647 Bacteria 3213
208 Ga0316582_0083827 3300036647 Bacteria 2086
209 Ga0316582_0124564 3300036647 Bacteria 1727
210 Ga0316582_0188047 3300036647 Bacteria 1406
211 Ga0316584_0002272 3300036712 Bacteria 12090
212 Ga0316584_0008321 3300036712 Bacteria 7142
213 Ga0316584_0098598 3300036712 Bacteria 2188
214 Ga0316584_0124369 3300036712 Unclassified 1927
215 Ga0316584_0229441 3300036712 Unclassified 1362
216 Ga0316584_0396763 3300036712 Bacteria 983
217 Ga0395899_0266086 3300037312 Bacteria 1171
218 Ga0395900_0167590 3300037418 Bacteria 2238
219 Ga0395905_0106122 3300037471 Bacteria 2638
220 Ga0395905_0457043 3300037471 Bacteria 1175
221 Ga0316581_0012704 3300037588 Bacteria 2375
222 Ga0395901_0023082 3300038443 Bacteria 6376
223 Ga0395901_0073705 3300038443 Bacteria 3561
224 Ga0451802_0594564 3300041460 Bacteria 928
225 Ga0451577_0000735 3300042876 Bacteria 50706
226 Ga0451577_0010175 3300042876 Bacteria 9011
227 Ga0451577_0062886 3300042876 Bacteria 3309
228 Ga0451577_0090658 3300042876 Bacteria 2729
229 Ga0451577_0142060 3300042876 Bacteria 2158
230 Ga0451577_0179670 3300042876 Unclassified 1907
231 Ga0451577_0189265 3300042876 Bacteria 1856
232 Ga0451577_0500610 3300042876 Unclassified 1103
233 Ga0451577_0577101 3300042876 Bacteria 1021
234 Ga0453683_0002120 3300044673 Bacteria 15803
235 Ga0453683_0006767 3300044673 Bacteria 7832
236 Ga0453683_0007934 3300044673 Bacteria 7155
237 Ga0453683_0019909 3300044673 Unclassified 4293
238 Ga0453683_0022279 3300044673 Unclassified 4042
239 Ga0453683_0036098 3300044673 Bacteria 3112
240 Ga0453683_0117561 3300044673 Unclassified 1673
241 Ga0453683_0401533 3300044673 Unclassified 883
242 Ga0453683_0470220 3300044673 Bacteria 814
243 Ga0453683_0603409 3300044673 Bacteria 716
244 Ga0466964_0066977 3300044706 Bacteria 1508
245 Ga0453684_0000053 3300044712 Bacteria 545350
246 Ga0453684_0000269 3300044712 Bacteria 223826
247 Ga0453684_0000944 3300044712 Bacteria 95859
248 Ga0453684_0000962 3300044712 Bacteria 94884
249 Ga0453684_0001179 3300044712 Bacteria 81099
250 Ga0453684_0004660 3300044712 Bacteria 28481
251 Ga0453684_0005815 3300044712 Bacteria 24027
252 Ga0453684_0006031 3300044712 Bacteria 23448
253 Ga0453684_0008263 3300044712 Bacteria 18761
254 Ga0453684_0023405 3300044712 Bacteria 9103
255 Ga0453684_0037036 3300044712 Bacteria 6704
256 Ga0453684_0049979 3300044712 Bacteria 5505
257 Ga0453684_0052847 3300044712 Bacteria 5308
258 Ga0453684_0057644 3300044712 Bacteria 5025
259 Ga0453684_0069203 3300044712 Unclassified 4478
260 Ga0453684_0070973 3300044712 Bacteria 4407
261 Ga0453684_0116704 3300044712 Bacteria 3231
262 Ga0453684_0126467 3300044712 Bacteria 3075
263 Ga0453684_0145984 3300044712 Bacteria 2818
264 Ga0453684_0158140 3300044712 Bacteria 2683
265 Ga0453684_0162042 3300044712 Bacteria 2644
266 Ga0453684_0193162 3300044712 Bacteria 2380
267 Ga0453684_0222789 3300044712 Bacteria 2184
268 Ga0453684_0224133 3300044712 Unclassified 2175
269 Ga0453684_0262238 3300044712 Unclassified 1978
270 Ga0453684_0334967 3300044712 Bacteria 1710
271 Ga0453684_0339617 3300044712 Bacteria 1696
272 Ga0453684_0350196 3300044712 Unclassified 1666
273 Ga0453684_0414495 3300044712 Unclassified 1506
274 Ga0453684_0451934 3300044712 Bacteria 1430
275 Ga0453684_0485910 3300044712 Unclassified 1369
276 Ga0453684_0509855 3300044712 Unclassified 1330
277 Ga0453684_0521895 3300044712 Bacteria 1312
278 Ga0453684_0557380 3300044712 Unclassified 1261
279 Ga0453684_0629965 3300044712 Unclassified 1172
280 Ga0453684_0714407 3300044712 Unclassified 1088
281 Ga0453684_0798858 3300044712 Unclassified 1018
282 Ga0453684_0846703 3300044712 Bacteria 983
283 Ga0453684_0932618 3300044712 Bacteria 928
284 Ga0453684_1225889 3300044712 Bacteria 786
285 Ga0453684_1399300 3300044712 Bacteria 725
286 Ga0453684_1611620 3300044712 Unclassified 666
287 Ga0453684_1642277 3300044712 Bacteria 658
288 Ga0466960_0083838 3300044901 Bacteria 1612
289 Ga0451576_0003664 3300045051 Bacteria 20849
290 Ga0451576_0016790 3300045051 Bacteria 8069
291 Ga0451576_0026586 3300045051 Bacteria 6223
292 Ga0451576_0037107 3300045051 Bacteria 5163
293 Ga0451576_0073283 3300045051 Bacteria 3563
294 Ga0451576_0127398 3300045051 Unclassified 2653
295 Ga0451576_0140511 3300045051 Bacteria 2518
296 Ga0451576_0206203 3300045051 Bacteria 2053
297 Ga0451576_0249622 3300045051 Unclassified 1854
298 Ga0451576_0279816 3300045051 Bacteria 1744
299 Ga0451576_0361279 3300045051 Bacteria 1521
300 Ga0451576_0388098 3300045051 Bacteria 1464
301 Ga0451576_0598637 3300045051 Bacteria 1159
302 Ga0451576_0656541 3300045051 Unclassified 1102
303 Ga0496101_0142838 3300048904 Bacteria 1826
304 Ga0496108_1124226 3300048911 Unclassified 667
305 Ga0496110_0930188 3300048913 Bacteria 776
306 Ga0501299_073387 3300049522 Bacteria 747
307 Ga0501039_0260369 3300049575 Unclassified 1363
308 Ga0501040_0053145 3300049576 Unclassified 2774
309 Ga0501042_0391723 3300049578 Bacteria 1006
310 Ga0501046_0305964 3300049580 Bacteria 1160
311 Ga0501071_0144635 3300049587 Unclassified 1772
312 Ga0501072_0049164 3300049588 Bacteria 3320
313 Ga0501072_0449914 3300049588 Bacteria 1020
314 Ga0501073_0301572 3300049589 Bacteria 1105
315 Ga0501075_0038725 3300049591 Unclassified 3565
316 Ga0501076_0202499 3300049592 Bacteria 1621
317 Ga0501076_0565035 3300049592 Unclassified 938
318 Ga0501076_1286242 3300049592 Unclassified 601
319 Ga0501225_0155420 3300049705 Unclassified 700
320 Ga0501079_0203371 3300049741 Unclassified 1547
321 Ga0501079_0224988 3300049741 Bacteria 1466
322 Ga0501080_0092234 3300049742 Bacteria 2813
323 Ga0501080_0124504 3300049742 Bacteria 2388
324 Ga0501080_1421545 3300049742 Bacteria 591
325 Ga0501081_0033188 3300049743 Unclassified 3506
326 Ga0501081_0399865 3300049743 Unclassified 1017
327 Ga0501283_077188 3300049779 Bacteria 622
328 Ga0501045_0347318 3300049824 Bacteria 1104
329 Ga0501045_0435789 3300049824 Bacteria 975
330 Ga0501045_0544598 3300049824 Unclassified 861
331 nmdc:mga05p37_22747_c1 3300050507 Bacteria 7604
332 nmdc:mga05p37_39845_c1 3300050507 Bacteria 5769
333 nmdc:mga05p37_46295_c1 3300050507 Bacteria 5349
334 nmdc:mga05p37_50460_c1 3300050507 Bacteria 5117
335 nmdc:mga05p37_5098_c1 3300050507 Bacteria 15409
336 nmdc:mga05p37_65077_c1 3300050507 Bacteria 4486
337 nmdc:mga09592_101940_c1 3300050508 Bacteria 2459
338 nmdc:mga09592_12895_c1 3300050508 Bacteria 6816
339 nmdc:mga09592_17134_c1 3300050508 Bacteria 5932
340 nmdc:mga09592_17338_c1 3300050508 Bacteria 5899
341 nmdc:mga09592_5968_c1 3300050508 Bacteria 9929
342 nmdc:mga09592_618655_c1 3300050508 Bacteria 927
343 nmdc:mga09592_74280_c1 3300050508 Bacteria 2889
344 nmdc:mga0qj67_114817_c1 3300050509 Bacteria 2175
345 nmdc:mga0qj67_439262_c1 3300050509 Bacteria 1051
346 nmdc:mga0qj67_598228_c1 3300050509 Unclassified 882
347 nmdc:mga06r32_112800_c1 3300050510 Bacteria 2675
348 nmdc:mga06r32_1300701_c1 3300050510 Unclassified 671
349 nmdc:mga06r32_154386_c1 3300050510 Bacteria 2276
350 nmdc:mga06r32_26405_c1 3300050510 Bacteria 5414
351 nmdc:mga06r32_33921_c1 3300050510 Bacteria 4810
352 nmdc:mga08y16_106784_c1 3300050511 Bacteria 2914
353 nmdc:mga0a205_801745_c1 3300050515 Unclassified 789
354 Ga0501084_0212975 3300054114 Unclassified 1630
355 Ga0501082_0050672 3300060353 Unclassified 3580
356 Ga0501082_0412733 3300060353 Unclassified 1179
357 Ga0530510_0068391 3300061734 Bacteria 2577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041460 Ga0451802_0594564 Ga0451802_0594564_334_885 174
2 3300049824 Ga0501045_0347318 Ga0501045_0347318_107_631 174
3 3300044673 Ga0453683_0603409 Ga0453683_0603409_10_537 175
4 3300050509 nmdc:mga0qj67_439262_c1 nmdc:mga0qj67_439262_c1_501_1028 175
5 2162886006 SwRhRL3b_contig_334061 SwRhRL3b_0848.00001560 180
6 3300005289 Ga0065704_10370191 Ga0065704_103701911 180
7 3300005295 Ga0065707_10112621 Ga0065707_101126213 180
8 3300042876 Ga0451577_0142060 Ga0451577_0142060_685_1233 180
9 3300045051 Ga0451576_0026586 Ga0451576_0026586_3656_4204 180
10 3300045051 Ga0451576_0656541 Ga0451576_0656541_67_615 180
11 3300042876 Ga0451577_0090658 Ga0451577_0090658_92_640 182
12 3300044712 Ga0453684_0000944 Ga0453684_0000944_50716_51264 182
13 3300044712 Ga0453684_0001179 Ga0453684_0001179_19502_20050 182
14 3300044712 Ga0453684_0070973 Ga0453684_0070973_1798_2346 182
15 3300044712 Ga0453684_0145984 Ga0453684_0145984_330_878 182
16 3300044712 Ga0453684_0414495 Ga0453684_0414495_461_1009 182
17 3300044712 Ga0453684_0846703 Ga0453684_0846703_221_769 182
18 3300003203 JGI25406J46586_10007763 JGI25406J46586_100077636 183
19 3300003203 JGI25406J46586_10009862 JGI25406J46586_100098622 183
20 3300005289 Ga0065704_10071418 Ga0065704_1007141811 183
21 3300005289 Ga0065704_10237721 Ga0065704_102377212 183
22 3300005290 Ga0065712_10449020 Ga0065712_104490201 183
23 3300005293 Ga0065715_10553261 Ga0065715_105532611 183
24 3300005295 Ga0065707_10013939 Ga0065707_100139393 183
25 3300005295 Ga0065707_10084681 Ga0065707_100846813 183
26 3300005295 Ga0065707_10089419 Ga0065707_100894193 183
27 3300005295 Ga0065707_10095425 Ga0065707_100954253 183
28 3300005295 Ga0065707_10098374 Ga0065707_100983741 183
29 3300005295 Ga0065707_10133079 Ga0065707_101330791 183
30 3300005295 Ga0065707_10235681 Ga0065707_102356812 183
31 3300005340 Ga0070689_100184101 Ga0070689_1001841013 183
32 3300005341 Ga0070691_10339670 Ga0070691_103396702 183
33 3300005353 Ga0070669_100390999 Ga0070669_1003909991 183
34 3300005365 Ga0070688_100579089 Ga0070688_1005790891 183
35 3300005438 Ga0070701_10255363 Ga0070701_102553633 183
36 3300005440 Ga0070705_100558186 Ga0070705_1005581861 183
37 3300005441 Ga0070700_100025610 Ga0070700_1000256103 183
38 3300005444 Ga0070694_100171035 Ga0070694_1001710353 183
39 3300005444 Ga0070694_100557608 Ga0070694_1005576082 183
40 3300005457 Ga0070662_100017440 Ga0070662_1000174405 183
41 3300005467 Ga0070706_100079496 Ga0070706_1000794963 183
42 3300005467 Ga0070706_100163485 Ga0070706_1001634853 183
43 3300005467 Ga0070706_100342545 Ga0070706_1003425452 183
44 3300005467 Ga0070706_101268220 Ga0070706_1012682201 183
45 3300005468 Ga0070707_100053726 Ga0070707_1000537264 183
46 3300005468 Ga0070707_100331309 Ga0070707_1003313093 183
47 3300005471 Ga0070698_100048709 Ga0070698_1000487095 183
48 3300005471 Ga0070698_100151953 Ga0070698_1001519533 183
49 3300005518 Ga0070699_100002030 Ga0070699_10000203016 183
50 3300005518 Ga0070699_100017430 Ga0070699_1000174305 183
51 3300005518 Ga0070699_100151723 Ga0070699_1001517233 183
52 3300005518 Ga0070699_100326996 Ga0070699_1003269962 183
53 3300005518 Ga0070699_100593376 Ga0070699_1005933761 183
54 3300005518 Ga0070699_100928503 Ga0070699_1009285032 183
55 3300005518 Ga0070699_101177204 Ga0070699_1011772041 183
56 3300005536 Ga0070697_100738725 Ga0070697_1007387251 183
57 3300005539 Ga0068853_100399630 Ga0068853_1003996302 183
58 3300005546 Ga0070696_100078040 Ga0070696_1000780402 183
59 3300005546 Ga0070696_100241486 Ga0070696_1002414863 183
60 3300005549 Ga0070704_100071564 Ga0070704_1000715643 183
61 3300005549 Ga0070704_100253400 Ga0070704_1002534001 183
62 3300005577 Ga0068857_100233436 Ga0068857_1002334363 183
63 3300005577 Ga0068857_100244895 Ga0068857_1002448953 183
64 3300005577 Ga0068857_100414008 Ga0068857_1004140082 183
65 3300005614 Ga0068856_100167748 Ga0068856_1001677482 183
66 3300005615 Ga0070702_100557168 Ga0070702_1005571682 183
67 3300005617 Ga0068859_100026108 Ga0068859_1000261083 183
68 3300005617 Ga0068859_100188746 Ga0068859_1001887462 183
69 3300005617 Ga0068859_100315492 Ga0068859_1003154923 183
70 3300005617 Ga0068859_100892660 Ga0068859_1008926602 183
71 3300005618 Ga0068864_100274691 Ga0068864_1002746911 183
72 3300005719 Ga0068861_100354990 Ga0068861_1003549901 183
73 3300005719 Ga0068861_100359644 Ga0068861_1003596441 183
74 3300005840 Ga0068870_10636868 Ga0068870_106368681 183
75 3300005843 Ga0068860_100090408 Ga0068860_1000904082 183
76 3300005844 Ga0068862_100016489 Ga0068862_1000164896 183
77 3300005844 Ga0068862_101203678 Ga0068862_1012036781 183
78 3300005985 Ga0081539_10002067 Ga0081539_100020673 183
79 3300006175 Ga0070712_100015236 Ga0070712_1000152363 183
80 3300006194 Ga0075427_10000340 Ga0075427_100003404 183
81 3300006844 Ga0075428_100078817 Ga0075428_1000788173 183
82 3300006844 Ga0075428_100114962 Ga0075428_1001149622 183
83 3300006844 Ga0075428_100319638 Ga0075428_1003196383 183
84 3300006844 Ga0075428_100374146 Ga0075428_1003741462 183
85 3300006844 Ga0075428_100457007 Ga0075428_1004570072 183
86 3300006844 Ga0075428_100797321 Ga0075428_1007973213 183
87 3300006846 Ga0075430_100246657 Ga0075430_1002466571 183
88 3300006847 Ga0075431_100010854 Ga0075431_1000108542 183
89 3300006847 Ga0075431_100013792 Ga0075431_1000137928 183
90 3300006847 Ga0075431_100040704 Ga0075431_1000407044 183
91 3300006847 Ga0075431_100218822 Ga0075431_1002188223 183
92 3300006847 Ga0075431_101457081 Ga0075431_1014570811 183
93 3300006852 Ga0075433_10080312 Ga0075433_100803122 183
94 3300006852 Ga0075433_10849172 Ga0075433_108491721 183
95 3300006871 Ga0075434_100277384 Ga0075434_1002773842 183
96 3300006880 Ga0075429_100005674 Ga0075429_1000056745 183
97 3300006880 Ga0075429_100026448 Ga0075429_1000264485 183
98 3300006880 Ga0075429_100034714 Ga0075429_1000347143 183
99 3300006880 Ga0075429_100043720 Ga0075429_1000437201 183
100 3300006880 Ga0075429_100109891 Ga0075429_1001098912 183
101 3300006880 Ga0075429_100431180 Ga0075429_1004311801 183
102 3300006880 Ga0075429_100693360 Ga0075429_1006933601 183
103 3300006880 Ga0075429_100882284 Ga0075429_1008822842 183
104 3300006931 Ga0097620_100026108 Ga0097620_1000261083 183
105 3300006931 Ga0097620_100188754 Ga0097620_1001887542 183
106 3300006931 Ga0097620_100315475 Ga0097620_1003154753 183
107 3300006931 Ga0097620_100892589 Ga0097620_1008925892 183
108 3300009093 Ga0105240_10477656 Ga0105240_104776562 183
109 3300009093 Ga0105240_10507566 Ga0105240_105075662 183
110 3300009094 Ga0111539_10027299 Ga0111539_100272995 183
111 3300009098 Ga0105245_10022625 Ga0105245_100226256 183
112 3300009147 Ga0114129_10004481 Ga0114129_100044818 183
113 3300009147 Ga0114129_10008275 Ga0114129_100082753 183
114 3300009147 Ga0114129_10011707 Ga0114129_100117077 183
115 3300009147 Ga0114129_10024970 Ga0114129_1002497011 183
116 3300009147 Ga0114129_10073225 Ga0114129_100732252 183
117 3300009147 Ga0114129_10082785 Ga0114129_100827852 183
118 3300009147 Ga0114129_10139297 Ga0114129_101392973 183
119 3300009147 Ga0114129_10485020 Ga0114129_104850201 183
120 3300009147 Ga0114129_10954611 Ga0114129_109546112 183
121 3300009147 Ga0114129_11003865 Ga0114129_110038652 183
122 3300009148 Ga0105243_10029149 Ga0105243_100291492 183
123 3300009174 Ga0105241_10826560 Ga0105241_108265601 183
124 3300009176 Ga0105242_10335653 Ga0105242_103356532 183
125 3300009553 Ga0105249_10030652 Ga0105249_100306522 183
126 3300009553 Ga0105249_10058320 Ga0105249_100583203 183
127 3300009553 Ga0105249_10162183 Ga0105249_101621833 183
128 3300009553 Ga0105249_10176908 Ga0105249_101769083 183
129 3300009553 Ga0105249_10498287 Ga0105249_104982871 183
130 3300010375 Ga0105239_10138261 Ga0105239_101382614 183
131 3300011119 Ga0105246_10015971 Ga0105246_100159715 183
132 3300013307 Ga0157372_10423912 Ga0157372_104239122 183
133 3300013308 Ga0157375_10858398 Ga0157375_108583982 183
134 3300014325 Ga0163163_10403123 Ga0163163_104031233 183
135 3300014326 Ga0157380_10169974 Ga0157380_101699743 183
136 3300025910 Ga0207684_10059169 Ga0207684_100591694 183
137 3300025910 Ga0207684_10137392 Ga0207684_101373922 183
138 3300025911 Ga0207654_10189435 Ga0207654_101894353 183
139 3300025913 Ga0207695_10505255 Ga0207695_105052552 183
140 3300025914 Ga0207671_10548421 Ga0207671_105484211 183
141 3300025915 Ga0207693_10009522 Ga0207693_100095227 183
142 3300025918 Ga0207662_10128338 Ga0207662_101283382 183
143 3300025922 Ga0207646_10507087 Ga0207646_105070872 183
144 3300025922 Ga0207646_10989548 Ga0207646_109895482 183
145 3300025933 Ga0207706_10080270 Ga0207706_100802703 183
146 3300025934 Ga0207686_10200762 Ga0207686_102007622 183
147 3300025935 Ga0207709_10027129 Ga0207709_100271293 183
148 3300025935 Ga0207709_10330106 Ga0207709_103301061 183
149 3300025936 Ga0207670_10609967 Ga0207670_106099671 183
150 3300025936 Ga0207670_11157034 Ga0207670_111570341 183
151 3300025961 Ga0207712_10138311 Ga0207712_101383111 183
152 3300026023 Ga0207677_10134405 Ga0207677_101344052 183
153 3300026078 Ga0207702_10200963 Ga0207702_102009632 183
154 3300026078 Ga0207702_10330760 Ga0207702_103307602 183
155 3300026089 Ga0207648_10433708 Ga0207648_104337082 183
156 3300026116 Ga0207674_10197964 Ga0207674_101979643 183
157 3300026116 Ga0207674_10285138 Ga0207674_102851382 183
158 3300026116 Ga0207674_10299155 Ga0207674_102991553 183
159 3300026116 Ga0207674_10982448 Ga0207674_109824481 183
160 3300026118 Ga0207675_100154558 Ga0207675_1001545583 183
161 3300026118 Ga0207675_100222119 Ga0207675_1002221193 183
162 3300028380 Ga0268265_10035211 Ga0268265_100352113 183
163 3300028380 Ga0268265_11030575 Ga0268265_110305751 183
164 3300028381 Ga0268264_10071718 Ga0268264_100717183 183
165 3300028573 Ga0265334_10027517 Ga0265334_100275173 183
166 3300028577 Ga0265318_10001482 Ga0265318_100014826 183
167 3300028653 Ga0265323_10097909 Ga0265323_100979092 183
168 3300028800 Ga0265338_10033454 Ga0265338_100334546 183
169 3300031239 Ga0265328_10051646 Ga0265328_100516463 183
170 3300031240 Ga0265320_10007860 Ga0265320_100078604 183
171 3300031240 Ga0265320_10084220 Ga0265320_100842201 183
172 3300031241 Ga0265325_10043391 Ga0265325_100433913 183
173 3300031242 Ga0265329_10070652 Ga0265329_100706523 183
174 3300031247 Ga0265340_10048010 Ga0265340_100480104 183
175 3300031250 Ga0265331_10046653 Ga0265331_100466532 183
176 3300031251 Ga0265327_10013937 Ga0265327_100139375 183
177 3300031344 Ga0265316_10060032 Ga0265316_100600324 183
178 3300031548 Ga0307408_100093231 Ga0307408_1000932311 183
179 3300031595 Ga0265313_10282141 Ga0265313_102821411 183
180 3300031665 Ga0316575_10002885 Ga0316575_100028851 183
181 3300031665 Ga0316575_10072436 Ga0316575_100724362 183
182 3300031691 Ga0316579_10000728 Ga0316579_100007283 183
183 3300031691 Ga0316579_10015007 Ga0316579_100150074 183
184 3300031691 Ga0316579_10180331 Ga0316579_101803312 183
185 3300031712 Ga0265342_10309204 Ga0265342_103092042 183
186 3300031727 Ga0316576_10037702 Ga0316576_100377023 183
187 3300031727 Ga0316576_10045570 Ga0316576_100455702 183
188 3300031727 Ga0316576_10142790 Ga0316576_101427902 183
189 3300031727 Ga0316576_10553222 Ga0316576_105532222 183
190 3300031727 Ga0316576_10800817 Ga0316576_108008171 183
191 3300031727 Ga0316576_10802423 Ga0316576_108024231 183
192 3300031728 Ga0316578_10002176 Ga0316578_100021762 183
193 3300031728 Ga0316578_10013109 Ga0316578_100131093 183
194 3300031728 Ga0316578_10032545 Ga0316578_100325452 183
195 3300031731 Ga0307405_10139703 Ga0307405_101397033 183
196 3300031731 Ga0307405_10343482 Ga0307405_103434822 183
197 3300031733 Ga0316577_10012909 Ga0316577_100129091 183
198 3300031733 Ga0316577_10136388 Ga0316577_101363881 183
199 3300031733 Ga0316577_10204734 Ga0316577_102047341 183
200 3300031733 Ga0316577_10236376 Ga0316577_102363762 183
201 3300031824 Ga0307413_10089623 Ga0307413_100896232 183
202 3300031901 Ga0307406_10480071 Ga0307406_104800712 183
203 3300031903 Ga0307407_10831453 Ga0307407_108314531 183
204 3300031911 Ga0307412_10090745 Ga0307412_100907453 183
205 3300031911 Ga0307412_10403722 Ga0307412_104037222 183
206 3300032002 Ga0307416_100167150 Ga0307416_1001671501 183
207 3300032002 Ga0307416_100179223 Ga0307416_1001792233 183
208 3300032002 Ga0307416_101589568 Ga0307416_1015895681 183
209 3300032005 Ga0307411_10690957 Ga0307411_106909572 183
210 3300032126 Ga0307415_100048163 Ga0307415_1000481633 183
211 3300032126 Ga0307415_100241996 Ga0307415_1002419963 183
212 3300032139 Ga0316580_10099466 Ga0316580_100994662 183
213 3300035398 Ga0316574_0005562 Ga0316574_0005562_3060_3623 183
214 3300035398 Ga0316574_0043698 Ga0316574_0043698_132_686 183
215 3300036647 Ga0316582_0032130 Ga0316582_0032130_179_742 183
216 3300036647 Ga0316582_0083827 Ga0316582_0083827_1480_2034 183
217 3300036647 Ga0316582_0124564 Ga0316582_0124564_117_686 183
218 3300036647 Ga0316582_0188047 Ga0316582_0188047_104_667 183
219 3300036712 Ga0316584_0008321 Ga0316584_0008321_1573_2136 183
220 3300036712 Ga0316584_0098598 Ga0316584_0098598_1401_1955 183
221 3300036712 Ga0316584_0124369 Ga0316584_0124369_330_884 183
222 3300037312 Ga0395899_0266086 Ga0395899_0266086_298_855 183
223 3300037418 Ga0395900_0167590 Ga0395900_0167590_116_673 183
224 3300037471 Ga0395905_0106122 Ga0395905_0106122_1056_1613 183
225 3300037471 Ga0395905_0457043 Ga0395905_0457043_267_818 183
226 3300037588 Ga0316581_0012704 Ga0316581_0012704_553_1116 183
227 3300038443 Ga0395901_0023082 Ga0395901_0023082_2559_3116 183
228 3300038443 Ga0395901_0073705 Ga0395901_0073705_713_1264 183
229 3300042876 Ga0451577_0000735 Ga0451577_0000735_2619_3170 183
230 3300042876 Ga0451577_0062886 Ga0451577_0062886_1426_1977 183
231 3300042876 Ga0451577_0179670 Ga0451577_0179670_1321_1872 183
232 3300042876 Ga0451577_0189265 Ga0451577_0189265_271_822 183
233 3300042876 Ga0451577_0500610 Ga0451577_0500610_509_1060 183
234 3300042876 Ga0451577_0577101 Ga0451577_0577101_453_1004 183
235 3300044673 Ga0453683_0002120 Ga0453683_0002120_1321_1872 183
236 3300044673 Ga0453683_0006767 Ga0453683_0006767_3925_4476 183
237 3300044673 Ga0453683_0019909 Ga0453683_0019909_1049_1600 183
238 3300044673 Ga0453683_0022279 Ga0453683_0022279_3094_3645 183
239 3300044673 Ga0453683_0036098 Ga0453683_0036098_2136_2687 183
240 3300044673 Ga0453683_0117561 Ga0453683_0117561_376_927 183
241 3300044673 Ga0453683_0401533 Ga0453683_0401533_193_744 183
242 3300044673 Ga0453683_0470220 Ga0453683_0470220_111_662 183
243 3300044706 Ga0466964_0066977 Ga0466964_0066977_636_1187 183
244 3300044712 Ga0453684_0000053 Ga0453684_0000053_257292_257843 183
245 3300044712 Ga0453684_0000269 Ga0453684_0000269_16103_16654 183
246 3300044712 Ga0453684_0000962 Ga0453684_0000962_77611_78162 183
247 3300044712 Ga0453684_0004660 Ga0453684_0004660_7147_7701 183
248 3300044712 Ga0453684_0005815 Ga0453684_0005815_21860_22411 183
249 3300044712 Ga0453684_0006031 Ga0453684_0006031_14057_14608 183
250 3300044712 Ga0453684_0008263 Ga0453684_0008263_11102_11656 183
251 3300044712 Ga0453684_0023405 Ga0453684_0023405_6987_7538 183
252 3300044712 Ga0453684_0037036 Ga0453684_0037036_1634_2185 183
253 3300044712 Ga0453684_0049979 Ga0453684_0049979_771_1322 183
254 3300044712 Ga0453684_0052847 Ga0453684_0052847_3704_4255 183
255 3300044712 Ga0453684_0057644 Ga0453684_0057644_3059_3613 183
256 3300044712 Ga0453684_0069203 Ga0453684_0069203_2230_2781 183
257 3300044712 Ga0453684_0126467 Ga0453684_0126467_889_1440 183
258 3300044712 Ga0453684_0162042 Ga0453684_0162042_1487_2038 183
259 3300044712 Ga0453684_0193162 Ga0453684_0193162_1545_2096 183
260 3300044712 Ga0453684_0222789 Ga0453684_0222789_479_1030 183
261 3300044712 Ga0453684_0224133 Ga0453684_0224133_81_635 183
262 3300044712 Ga0453684_0262238 Ga0453684_0262238_1399_1953 183
263 3300044712 Ga0453684_0334967 Ga0453684_0334967_822_1373 183
264 3300044712 Ga0453684_0339617 Ga0453684_0339617_375_926 183
265 3300044712 Ga0453684_0350196 Ga0453684_0350196_62_613 183
266 3300044712 Ga0453684_0451934 Ga0453684_0451934_373_924 183
267 3300044712 Ga0453684_0485910 Ga0453684_0485910_448_999 183
268 3300044712 Ga0453684_0521895 Ga0453684_0521895_289_840 183
269 3300044712 Ga0453684_0629965 Ga0453684_0629965_154_705 183
270 3300044712 Ga0453684_0714407 Ga0453684_0714407_370_927 183
271 3300044712 Ga0453684_0932618 Ga0453684_0932618_321_872 183
272 3300044712 Ga0453684_1225889 Ga0453684_1225889_68_619 183
273 3300044712 Ga0453684_1399300 Ga0453684_1399300_27_578 183
274 3300044712 Ga0453684_1611620 Ga0453684_1611620_15_569 183
275 3300044712 Ga0453684_1642277 Ga0453684_1642277_22_573 183
276 3300044901 Ga0466960_0083838 Ga0466960_0083838_37_588 183
277 3300045051 Ga0451576_0003664 Ga0451576_0003664_13510_14061 183
278 3300045051 Ga0451576_0016790 Ga0451576_0016790_359_910 183
279 3300045051 Ga0451576_0037107 Ga0451576_0037107_2208_2759 183
280 3300045051 Ga0451576_0073283 Ga0451576_0073283_2700_3254 183
281 3300045051 Ga0451576_0127398 Ga0451576_0127398_771_1322 183
282 3300045051 Ga0451576_0206203 Ga0451576_0206203_275_826 183
283 3300045051 Ga0451576_0249622 Ga0451576_0249622_1046_1597 183
284 3300045051 Ga0451576_0279816 Ga0451576_0279816_545_1096 183
285 3300045051 Ga0451576_0361279 Ga0451576_0361279_952_1503 183
286 3300045051 Ga0451576_0388098 Ga0451576_0388098_453_1004 183
287 3300045051 Ga0451576_0598637 Ga0451576_0598637_100_654 183
288 3300048904 Ga0496101_0142838 Ga0496101_0142838_228_779 183
289 3300048913 Ga0496110_0930188 Ga0496110_0930188_73_624 183
290 3300049522 Ga0501299_073387 Ga0501299_073387_12_587 183
291 3300049588 Ga0501072_0049164 Ga0501072_0049164_855_1418 183
292 3300049589 Ga0501073_0301572 Ga0501073_0301572_141_692 183
293 3300049592 Ga0501076_0202499 Ga0501076_0202499_552_1115 183
294 3300049592 Ga0501076_0565035 Ga0501076_0565035_352_903 183
295 3300049705 Ga0501225_0155420 Ga0501225_0155420_118_681 183
296 3300049741 Ga0501079_0224988 Ga0501079_0224988_611_1174 183
297 3300049742 Ga0501080_0124504 Ga0501080_0124504_1509_2072 183
298 3300049742 Ga0501080_1421545 Ga0501080_1421545_27_581 183
299 3300049743 Ga0501081_0399865 Ga0501081_0399865_48_599 183
300 3300049779 Ga0501283_077188 Ga0501283_077188_57_608 183
301 3300049824 Ga0501045_0435789 Ga0501045_0435789_69_632 183
302 3300049824 Ga0501045_0544598 Ga0501045_0544598_12_563 183
303 3300050507 nmdc:mga05p37_22747_c1 nmdc:mga05p37_22747_c1_2346_2897 183
304 3300050507 nmdc:mga05p37_39845_c1 nmdc:mga05p37_39845_c1_2929_3492 183
305 3300050507 nmdc:mga05p37_50460_c1 nmdc:mga05p37_50460_c1_2594_3154 183
306 3300050507 nmdc:mga05p37_5098_c1 nmdc:mga05p37_5098_c1_11543_12094 183
307 3300050507 nmdc:mga05p37_65077_c1 nmdc:mga05p37_65077_c1_3322_3876 183
308 3300050508 nmdc:mga09592_101940_c1 nmdc:mga09592_101940_c1_1269_1832 183
309 3300050508 nmdc:mga09592_12895_c1 nmdc:mga09592_12895_c1_5806_6369 183
310 3300050508 nmdc:mga09592_17134_c1 nmdc:mga09592_17134_c1_3760_4311 183
311 3300050508 nmdc:mga09592_17338_c1 nmdc:mga09592_17338_c1_86_637 183
312 3300050508 nmdc:mga09592_5968_c1 nmdc:mga09592_5968_c1_4354_4917 183
313 3300050508 nmdc:mga09592_618655_c1 nmdc:mga09592_618655_c1_281_832 183
314 3300050509 nmdc:mga0qj67_114817_c1 nmdc:mga0qj67_114817_c1_1162_1743 183
315 3300050509 nmdc:mga0qj67_598228_c1 nmdc:mga0qj67_598228_c1_81_638 183
316 3300050510 nmdc:mga06r32_1300701_c1 nmdc:mga06r32_1300701_c1_24_575 183
317 3300050510 nmdc:mga06r32_154386_c1 nmdc:mga06r32_154386_c1_1311_1874 183
318 3300050510 nmdc:mga06r32_26405_c1 nmdc:mga06r32_26405_c1_4560_5120 183
319 3300050510 nmdc:mga06r32_33921_c1 nmdc:mga06r32_33921_c1_1946_2500 183
320 3300050511 nmdc:mga08y16_106784_c1 nmdc:mga08y16_106784_c1_1634_2185 183
321 3300060353 Ga0501082_0412733 Ga0501082_0412733_19_570 183
322 3300044712 Ga0453684_0158140 Ga0453684_0158140_674_1228 184
323 3300049575 Ga0501039_0260369 Ga0501039_0260369_22_576 184
324 3300049576 Ga0501040_0053145 Ga0501040_0053145_808_1362 184
325 3300049580 Ga0501046_0305964 Ga0501046_0305964_294_848 184
326 3300049587 Ga0501071_0144635 Ga0501071_0144635_119_673 184
327 3300049741 Ga0501079_0203371 Ga0501079_0203371_398_952 184
328 3300049742 Ga0501080_0092234 Ga0501080_0092234_494_1048 184
329 3300049743 Ga0501081_0033188 Ga0501081_0033188_1395_1949 184
330 3300050510 nmdc:mga06r32_112800_c1 nmdc:mga06r32_112800_c1_21_575 184
331 3300054114 Ga0501084_0212975 Ga0501084_0212975_507_1061 184
332 3300060353 Ga0501082_0050672 Ga0501082_0050672_1041_1595 184
333 3300042876 Ga0451577_0010175 Ga0451577_0010175_1194_1754 185
334 3300044673 Ga0453683_0007934 Ga0453683_0007934_43_603 185
335 3300044712 Ga0453684_0116704 Ga0453684_0116704_2126_2686 185
336 3300044712 Ga0453684_0509855 Ga0453684_0509855_543_1103 185
337 3300044712 Ga0453684_0557380 Ga0453684_0557380_38_598 185
338 3300045051 Ga0451576_0140511 Ga0451576_0140511_1695_2255 185
339 3300050507 nmdc:mga05p37_46295_c1 nmdc:mga05p37_46295_c1_1683_2243 185
340 3300050508 nmdc:mga09592_74280_c1 nmdc:mga09592_74280_c1_2304_2864 185
341 2162886006 SwRhRL3b_contig_166731 SwRhRL3b_0353.00000780 186
342 2162886007 SwRhRL2b_contig_1049683 SwRhRL2b_0965.00007140 186
343 3300009148 Ga0105243_10049187 Ga0105243_100491873 186
344 3300009148 Ga0105243_10068356 Ga0105243_100683564 186
345 3300009174 Ga0105241_10101504 Ga0105241_101015043 186
346 3300009177 Ga0105248_11326536 Ga0105248_113265361 186
347 3300036712 Ga0316584_0002272 Ga0316584_0002272_6118_6708 186
348 3300036712 Ga0316584_0229441 Ga0316584_0229441_165_806 186
349 3300036712 Ga0316584_0396763 Ga0316584_0396763_182_784 186
350 3300044712 Ga0453684_0798858 Ga0453684_0798858_144_704 186
351 3300048911 Ga0496108_1124226 Ga0496108_1124226_67_627 186
352 3300049578 Ga0501042_0391723 Ga0501042_0391723_174_740 186
353 3300049588 Ga0501072_0449914 Ga0501072_0449914_140_706 186
354 3300049591 Ga0501075_0038725 Ga0501075_0038725_2345_2911 186
355 3300049592 Ga0501076_1286242 Ga0501076_1286242_18_584 186
356 3300050515 nmdc:mga0a205_801745_c1 nmdc:mga0a205_801745_c1_112_672 186
357 3300061734 Ga0530510_0068391 Ga0530510_0068391_379_945 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

35

179

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f06-assembly2.cif.gz_B crystal structure of 1144 0.9529 6 186
7f06-assembly1.cif.gz_A crystal structure of 1144 0.9491 9 186
7f06-assembly2.cif.gz_B crystal structure of 1144 0.9371 6 186
1vch-assembly2.cif.gz_C crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus 0.9339 8 183
1vch-assembly2.cif.gz_D crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus 0.9208 8 183
ID Description Score Start End Superfamily
1vchA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9195 8 183 3.40.50.2020
1vchA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9091 8 183 3.40.50.2020
1vchE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8861 8 183 3.40.50.2020
1o57A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8837 37 182 3.40.50.2020
1vchE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8753 8 183 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A533S2H1-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9972 6 186
AF-A0A1F8NHR7-F1-model_v4 Adenine phosphoribosyltransferase 0.9948 17 186 GO:0016757
AF-U2EQY2-F1-model_v4 Adenine phosphoribosyltransferase protein (EC 2.4.2.7) 0.9936 8 186 GO:0003999
AF-A0A1F8U5T7-F1-model_v4 Adenine phosphoribosyltransferase 0.9916 9 186 GO:0016757
AF-A0A3A0A193-F1-model_v4 Adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9894 4 186 GO:0003999

Feature Viewer

pLDDT pTM Quality
93.38 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map