F420650

General Info

Members Datasets Scaffolds Average Seq Length
356 115 712 179

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0011717|Ga0501079_0011717_5610_6122
Length 170
Sequence VIVFHVAVTPSPDYLSRREPHRRAHIERLQGLRAAGILIGGGPSPDATRVDLFYRLQRPAQLTNAIEEDPYFVSGAWTGYTPRSFAEFVEPWEAVPVVLDGSRVANRDMAQFALIELRGGGRLAFGGFFEDGATLAVVKTPKADEAVDALAASGFWDRPALTARPWLYVL

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
65 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
72 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0011717 3300049741 Bacteria 6697
2 Ga0065707_10093749 3300005295 Bacteria 3584
3 Ga0070690_100029053 3300005330 Bacteria 3427
4 Ga0070670_101025395 3300005331 Unclassified 751
5 Ga0068869_100347750 3300005334 Bacteria 1208
6 Ga0070689_100067955 3300005340 Bacteria 2779
7 Ga0070668_100619824 3300005347 Bacteria 948
8 Ga0070669_100204747 3300005353 Bacteria 1554
9 Ga0070705_100191589 3300005440 Bacteria 1394
10 Ga0070705_100250213 3300005440 Unclassified 1244
11 Ga0070708_100001486 3300005445 Bacteria 17897
12 Ga0070708_100026836 3300005445 Bacteria 4934
13 Ga0070708_100094369 3300005445 Bacteria 2729
14 Ga0070708_100423250 3300005445 Bacteria 1256
15 Ga0070708_100520960 3300005445 Bacteria 1121
16 Ga0070662_101113844 3300005457 Bacteria 677
17 Ga0070681_11192956 3300005458 Unclassified 683
18 Ga0070706_100003492 3300005467 Bacteria 15447
19 Ga0070706_100156152 3300005467 Bacteria 2130
20 Ga0070706_100593438 3300005467 Bacteria 1029
21 Ga0070707_100015436 3300005468 Bacteria 7166
22 Ga0070707_100025522 3300005468 Bacteria 5606
23 Ga0070707_100048983 3300005468 Bacteria 4049
24 Ga0070707_100298732 3300005468 Bacteria 1565
25 Ga0070707_100933440 3300005468 Bacteria 833
26 Ga0070698_100002361 3300005471 Bacteria 20833
27 Ga0070698_100012060 3300005471 Bacteria 9166
28 Ga0070698_100107642 3300005471 Bacteria 2755
29 Ga0070699_100001275 3300005518 Bacteria 23206
30 Ga0070699_100075523 3300005518 Bacteria 2933
31 Ga0070699_100111847 3300005518 Bacteria 2398
32 Ga0070699_100390347 3300005518 Bacteria 1258
33 Ga0070699_100576135 3300005518 Bacteria 1025
34 Ga0070699_100600338 3300005518 Bacteria 1004
35 Ga0070699_100756815 3300005518 Bacteria 889
36 Ga0070699_100859597 3300005518 Unclassified 830
37 Ga0070699_101552592 3300005518 Bacteria 607
38 Ga0070697_100001135 3300005536 Bacteria 20137
39 Ga0070697_100007946 3300005536 Bacteria 8268
40 Ga0070697_100030817 3300005536 Bacteria 4310
41 Ga0070697_100167289 3300005536 Bacteria 1860
42 Ga0070697_100706164 3300005536 Bacteria 890
43 Ga0070697_100734729 3300005536 Bacteria 872
44 Ga0070697_100950767 3300005536 Bacteria 763
45 Ga0070696_100265269 3300005546 Bacteria 1304
46 Ga0070696_100268042 3300005546 Unclassified 1297
47 Ga0070704_100243467 3300005549 Bacteria 1473
48 Ga0068857_100191693 3300005577 Bacteria 1862
49 Ga0068859_100081405 3300005617 Bacteria 3280
50 Ga0068859_100180224 3300005617 Unclassified 2195
51 Ga0068861_100732256 3300005719 Bacteria 922
52 Ga0068863_100433168 3300005841 Bacteria 1289
53 Ga0068860_100031116 3300005843 Bacteria 5131
54 Ga0068860_100139356 3300005843 Bacteria 2330
55 Ga0068862_100024796 3300005844 Bacteria 5032
56 Ga0068862_100299525 3300005844 Bacteria 1479
57 Ga0068862_100558326 3300005844 Bacteria 1094
58 Ga0081455_10201969 3300005937 Unclassified 1488
59 Ga0081455_10252907 3300005937 Bacteria 1288
60 Ga0075428_100010899 3300006844 Bacteria 10111
61 Ga0075428_100036221 3300006844 Bacteria 5436
62 Ga0075428_100046444 3300006844 Bacteria 4771
63 Ga0075428_100092041 3300006844 Bacteria 3306
64 Ga0075428_100171850 3300006844 Bacteria 2349
65 Ga0075428_100244863 3300006844 Bacteria 1934
66 Ga0075430_100000519 3300006846 Bacteria 28960
67 Ga0075430_100001479 3300006846 Bacteria 19145
68 Ga0075430_100007976 3300006846 Bacteria 8948
69 Ga0075430_100027455 3300006846 Bacteria 4836
70 Ga0075430_100152503 3300006846 Bacteria 1924
71 Ga0075430_100240576 3300006846 Bacteria 1500
72 Ga0075431_100000709 3300006847 Bacteria 28714
73 Ga0075431_100002926 3300006847 Bacteria 16536
74 Ga0075431_100003064 3300006847 Bacteria 16181
75 Ga0075431_100004214 3300006847 Bacteria 14081
76 Ga0075431_100017399 3300006847 Bacteria 7304
77 Ga0075431_100154592 3300006847 Bacteria 2360
78 Ga0075431_100495251 3300006847 Bacteria 1214
79 Ga0075433_10005050 3300006852 Bacteria 10341
80 Ga0075433_10009870 3300006852 Bacteria 7653
81 Ga0075433_10049104 3300006852 Bacteria 3671
82 Ga0075433_10054136 3300006852 Bacteria 3500
83 Ga0075433_10119461 3300006852 Bacteria 2340
84 Ga0075434_100004407 3300006871 Bacteria 12680
85 Ga0075434_100020048 3300006871 Bacteria 6478
86 Ga0075434_100311846 3300006871 Bacteria 1593
87 Ga0075434_101522607 3300006871 Unclassified 678
88 Ga0075434_101738929 3300006871 Bacteria 631
89 Ga0075429_100000884 3300006880 Bacteria 23661
90 Ga0075429_100001356 3300006880 Bacteria 20008
91 Ga0075429_100004180 3300006880 Bacteria 12360
92 Ga0075429_100006482 3300006880 Bacteria 10138
93 Ga0075429_100015905 3300006880 Bacteria 6515
94 Ga0075429_100046800 3300006880 Bacteria 3763
95 Ga0075429_100382187 3300006880 Bacteria 1233
96 Ga0075429_100483521 3300006880 Bacteria 1085
97 Ga0075436_100161276 3300006914 Bacteria 1581
98 Ga0075436_100162232 3300006914 Bacteria 1576
99 Ga0075436_100434787 3300006914 Bacteria 954
100 Ga0097620_100081414 3300006931 Bacteria 3280
101 Ga0097620_100180223 3300006931 Unclassified 2195
102 Ga0075435_100035902 3300007076 Bacteria 3936
103 Ga0075435_100096143 3300007076 Bacteria 2450
104 Ga0099794_10003565 3300007265 Bacteria 5961
105 Ga0099794_10066184 3300007265 Bacteria 1763
106 Ga0099794_10104593 3300007265 Bacteria 1415
107 Ga0099794_10156417 3300007265 Bacteria 1158
108 Ga0111539_10004456 3300009094 Bacteria 18307
109 Ga0111539_10031554 3300009094 Bacteria 6435
110 Ga0111539_10415305 3300009094 Bacteria 1567
111 Ga0111539_11258317 3300009094 Bacteria 859
112 Ga0114129_10009826 3300009147 Bacteria 13645
113 Ga0114129_10017536 3300009147 Bacteria 10193
114 Ga0114129_10029796 3300009147 Bacteria 7728
115 Ga0114129_10045318 3300009147 Bacteria 6183
116 Ga0114129_10067201 3300009147 Bacteria 5000
117 Ga0114129_10073836 3300009147 Bacteria 4752
118 Ga0114129_10090119 3300009147 Bacteria 4252
119 Ga0114129_10182872 3300009147 Bacteria 2851
120 Ga0114129_10220181 3300009147 Bacteria 2561
121 Ga0114129_10541281 3300009147 Bacteria 1515
122 Ga0114129_10616625 3300009147 Bacteria 1404
123 Ga0114129_11122574 3300009147 Unclassified 983
124 Ga0114129_11288377 3300009147 Unclassified 906
125 Ga0105248_11000232 3300009177 Unclassified 945
126 Ga0105249_10236504 3300009553 Bacteria 1804
127 Ga0105249_10457600 3300009553 Bacteria 1316
128 Ga0105249_10869130 3300009553 Unclassified 968
129 Ga0163162_10532977 3300013306 Bacteria 1303
130 Ga0157375_10424784 3300013308 Bacteria 1495
131 Ga0207688_10618379 3300025901 Bacteria 683
132 Ga0207684_10000645 3300025910 Bacteria 41289
133 Ga0207684_10000910 3300025910 Bacteria 33686
134 Ga0207684_10026031 3300025910 Bacteria 4985
135 Ga0207684_10128639 3300025910 Bacteria 2174
136 Ga0207684_10808304 3300025910 Bacteria 792
137 Ga0207646_10000537 3300025922 Bacteria 50487
138 Ga0207646_10002242 3300025922 Bacteria 23032
139 Ga0207646_10025918 3300025922 Bacteria 5360
140 Ga0207646_10557310 3300025922 Bacteria 1030
141 Ga0207646_10927770 3300025922 Bacteria 771
142 Ga0207706_10355410 3300025933 Bacteria 1273
143 Ga0207689_10023956 3300025942 Bacteria 5120
144 Ga0207712_10046688 3300025961 Bacteria 3004
145 Ga0207712_10088775 3300025961 Bacteria 2271
146 Ga0207712_10844461 3300025961 Unclassified 807
147 Ga0207668_10812894 3300025972 Bacteria 828
148 Ga0207708_11348915 3300026075 Bacteria 625
149 Ga0207641_10354542 3300026088 Bacteria 1399
150 Ga0207648_10025333 3300026089 Bacteria 5286
151 Ga0207674_10023208 3300026116 Bacteria 6648
152 Ga0207675_100065969 3300026118 Bacteria 3383
153 Ga0209588_1006176 3300027671 Bacteria 3468
154 Ga0209998_10007698 3300027717 Unclassified 2235
155 Ga0209974_10064547 3300027876 Bacteria 1243
156 Ga0207428_10000049 3300027907 Bacteria 179267
157 Ga0207428_10028270 3300027907 Bacteria 4660
158 Ga0268265_10005994 3300028380 Bacteria 8273
159 Ga0268265_10050195 3300028380 Bacteria 3142
160 Ga0268264_10085325 3300028381 Bacteria 2710
161 Ga0307408_100209757 3300031548 Bacteria 1582
162 Ga0307408_100379140 3300031548 Bacteria 1208
163 Ga0307413_10172698 3300031824 Bacteria 1532
164 Ga0307409_100319877 3300031995 Bacteria 1452
165 Ga0373940_0029213 3300035088 Bacteria 1459
166 Ga0373940_0108454 3300035088 Bacteria 850
167 Ga0373952_0046521 3300035092 Bacteria 1020
168 Ga0373939_0021055 3300035114 Bacteria 1780
169 Ga0373962_0056349 3300035242 Bacteria 1144
170 Ga0373931_0101564 3300035691 Bacteria 1618
171 Ga0395900_0024371 3300037418 Bacteria 6197
172 Ga0395901_0000999 3300038443 Bacteria 30559
173 Ga0242420_032482 3300038996 Bacteria 973
174 Ga0242420_068825 3300038996 Bacteria 717
175 Ga0439435_0128125 3300042436 Bacteria 800
176 Ga0451577_0028739 3300042876 Bacteria 5027
177 Ga0453683_0012822 3300044673 Bacteria 5485
178 Ga0453683_0021524 3300044673 Bacteria 4116
179 Ga0451576_0055522 3300045051 Bacteria 4143
180 Ga0451576_0300683 3300045051 Bacteria 1678
181 Ga0495584_0212219 3300046491 Bacteria 984
182 Ga0495642_0103396 3300046528 Bacteria 1214
183 Ga0495636_0479371 3300047318 Unclassified 600
184 Ga0501033_0113955 3300049570 Bacteria 1966
185 Ga0501033_0145847 3300049570 Bacteria 1709
186 Ga0501036_0213739 3300049572 Unclassified 1620
187 Ga0501036_0354823 3300049572 Bacteria 1224
188 Ga0501036_0628112 3300049572 Bacteria 890
189 Ga0501037_0064441 3300049573 Bacteria 2671
190 Ga0501037_0546300 3300049573 Bacteria 782
191 Ga0501038_0152247 3300049574 Bacteria 1885
192 Ga0501038_0217390 3300049574 Bacteria 1526
193 Ga0501039_0055235 3300049575 Bacteria 3075
194 Ga0501039_0087645 3300049575 Bacteria 2425
195 Ga0501039_0112972 3300049575 Bacteria 2124
196 Ga0501039_0136224 3300049575 Bacteria 1928
197 Ga0501040_0009082 3300049576 Bacteria 6468
198 Ga0501040_0052705 3300049576 Bacteria 2786
199 Ga0501040_0054356 3300049576 Bacteria 2745
200 Ga0501040_0091216 3300049576 Bacteria 2118
201 Ga0501040_0252547 3300049576 Bacteria 1258
202 Ga0501040_0581007 3300049576 Bacteria 809
203 Ga0501040_0871268 3300049576 Bacteria 652
204 Ga0501041_0007185 3300049577 Bacteria 6534
205 Ga0501041_0017526 3300049577 Bacteria 4261
206 Ga0501041_0032353 3300049577 Bacteria 3161
207 Ga0501041_0079615 3300049577 Bacteria 2017
208 Ga0501041_0295663 3300049577 Unclassified 1020
209 Ga0501042_0031188 3300049578 Bacteria 3771
210 Ga0501042_0054979 3300049578 Bacteria 2840
211 Ga0501042_0063869 3300049578 Bacteria 2631
212 Ga0501042_0215129 3300049578 Bacteria 1386
213 Ga0501043_0276563 3300049579 Bacteria 1288
214 Ga0501043_0503984 3300049579 Bacteria 904
215 Ga0501046_0010129 3300049580 Bacteria 8113
216 Ga0501046_0173035 3300049580 Bacteria 1619
217 Ga0501046_0255195 3300049580 Bacteria 1290
218 Ga0501046_0267192 3300049580 Bacteria 1255
219 Ga0501046_0318299 3300049580 Bacteria 1134
220 Ga0501046_1007245 3300049580 Unclassified 578
221 Ga0501048_0070536 3300049582 Bacteria 2468
222 Ga0501048_0075783 3300049582 Bacteria 2374
223 Ga0501048_0251262 3300049582 Bacteria 1255
224 Ga0501067_0033958 3300049583 Bacteria 2831
225 Ga0501068_0016488 3300049584 Bacteria 4259
226 Ga0501068_0062814 3300049584 Bacteria 2259
227 Ga0501068_0661284 3300049584 Bacteria 682
228 Ga0501071_0181295 3300049587 Bacteria 1578
229 Ga0501071_0779438 3300049587 Unclassified 737
230 Ga0501071_0917991 3300049587 Bacteria 676
231 Ga0501072_0004377 3300049588 Bacteria 10724
232 Ga0501074_0120793 3300049590 Bacteria 1874
233 Ga0501074_0139347 3300049590 Bacteria 1735
234 Ga0501074_0260052 3300049590 Bacteria 1234
235 Ga0501074_0323849 3300049590 Bacteria 1094
236 Ga0501074_1007731 3300049590 Bacteria 585
237 Ga0501075_0006033 3300049591 Bacteria 8307
238 Ga0501075_0006944 3300049591 Bacteria 7822
239 Ga0501075_0021649 3300049591 Bacteria 4689
240 Ga0501075_0110876 3300049591 Bacteria 2086
241 Ga0501075_0156366 3300049591 Bacteria 1738
242 Ga0501075_0193553 3300049591 Bacteria 1551
243 Ga0501075_0196446 3300049591 Bacteria 1539
244 Ga0501075_0442398 3300049591 Bacteria 991
245 Ga0501075_0746363 3300049591 Unclassified 745
246 Ga0501076_0013647 3300049592 Bacteria 6095
247 Ga0501076_0037310 3300049592 Bacteria 3810
248 Ga0501076_0043358 3300049592 Bacteria 3544
249 Ga0501076_0044594 3300049592 Bacteria 3497
250 Ga0501076_0128116 3300049592 Bacteria 2058
251 Ga0501076_0150285 3300049592 Bacteria 1895
252 Ga0501077_0005121 3300049593 Bacteria 7959
253 Ga0501077_0014650 3300049593 Bacteria 4928
254 Ga0501077_0031281 3300049593 Bacteria 3386
255 Ga0501077_0077369 3300049593 Bacteria 2107
256 Ga0501077_0096286 3300049593 Bacteria 1876
257 Ga0501077_0419832 3300049593 Bacteria 856
258 Ga0501079_0013115 3300049741 Bacteria 6319
259 Ga0501079_0028210 3300049741 Bacteria 4306
260 Ga0501079_0093643 3300049741 Bacteria 2328
261 Ga0501079_0118853 3300049741 Bacteria 2055
262 Ga0501079_0526765 3300049741 Bacteria 929
263 Ga0501080_0031564 3300049742 Bacteria 4936
264 Ga0501080_0132873 3300049742 Bacteria 2304
265 Ga0501080_0317521 3300049742 Bacteria 1411
266 Ga0501080_0446952 3300049742 Bacteria 1159
267 Ga0501081_0001017 3300049743 Bacteria 16736
268 Ga0501081_0002907 3300049743 Bacteria 10869
269 Ga0501081_0005867 3300049743 Bacteria 7949
270 Ga0501081_0035132 3300049743 Bacteria 3412
271 Ga0501081_0038463 3300049743 Bacteria 3268
272 Ga0501081_0115704 3300049743 Bacteria 1906
273 Ga0501081_0160327 3300049743 Unclassified 1621
274 Ga0501081_0275834 3300049743 Bacteria 1230
275 Ga0501081_0302736 3300049743 Bacteria 1173
276 Ga0501083_0158563 3300049744 Bacteria 1481
277 Ga0501083_0263151 3300049744 Bacteria 1122
278 Ga0501035_0045006 3300049822 Bacteria 3972
279 Ga0501044_0558015 3300049823 Bacteria 1042
280 Ga0501045_0015540 3300049824 Bacteria 5400
281 Ga0501045_0043474 3300049824 Bacteria 3271
282 Ga0501045_0059536 3300049824 Bacteria 2798
283 Ga0501045_0191722 3300049824 Bacteria 1523
284 Ga0501045_0261839 3300049824 Bacteria 1287
285 Ga0501045_0424590 3300049824 Bacteria 989
286 nmdc:mga05p37_121630_c1 3300050507 Bacteria 3206
287 nmdc:mga05p37_12432_c1 3300050507 Bacteria 10168
288 nmdc:mga05p37_144235_c1 3300050507 Bacteria 2916
289 nmdc:mga05p37_169196_c1 3300050507 Bacteria 2666
290 nmdc:mga05p37_19753_c1 3300050507 Bacteria 8151
291 nmdc:mga05p37_376153_c1 3300050507 Bacteria 1666
292 nmdc:mga05p37_4598_c1 3300050507 Bacteria 16129
293 nmdc:mga05p37_803156_c1 3300050507 Bacteria 1029
294 nmdc:mga05p37_828495_c1 3300050507 Bacteria 1008
295 nmdc:mga05p37_8301_c1 3300050507 Bacteria 12279
296 nmdc:mga05p37_93420_c1 3300050507 Bacteria 3707
297 nmdc:mga09592_1355_c1 3300050508 Bacteria 19575
298 nmdc:mga09592_13662_c1 3300050508 Bacteria 6635
299 nmdc:mga09592_15935_c1 3300050508 Bacteria 6141
300 nmdc:mga09592_233880_c1 3300050508 Bacteria 1592
301 nmdc:mga09592_24455_c1 3300050508 Bacteria 4996
302 nmdc:mga09592_26679_c1 3300050508 Bacteria 4787
303 nmdc:mga09592_5393_c1 3300050508 Bacteria 4306
304 nmdc:mga09592_559254_c1 3300050508 Bacteria 982
305 nmdc:mga09592_90540_c1 3300050508 Bacteria 2614
306 nmdc:mga0qj67_118832_c1 3300050509 Bacteria 2137
307 nmdc:mga0qj67_21859_c1 3300050509 Bacteria 4908
308 nmdc:mga0qj67_4040_c1 3300050509 Bacteria 10628
309 nmdc:mga0qj67_62737_c1 3300050509 Bacteria 2954
310 nmdc:mga06r32_132274_c1 3300050510 Bacteria 2468
311 nmdc:mga06r32_222_c1 3300050510 Bacteria 46046
312 nmdc:mga06r32_350070_c1 3300050510 Bacteria 1462
313 nmdc:mga06r32_384006_c1 3300050510 Bacteria 1387
314 nmdc:mga06r32_43803_c1 3300050510 Bacteria 4259
315 nmdc:mga06r32_507443_c1 3300050510 Bacteria 1183
316 nmdc:mga06r32_6180_c1 3300050510 Bacteria 10750
317 nmdc:mga08y16_33899_c1 3300050511 Bacteria 5364
318 nmdc:mga08y16_518953_c1 3300050511 Bacteria 1208
319 nmdc:mga08y16_9569_c1 3300050511 Bacteria 10172
320 nmdc:mga0n895_1338704_c1 3300050512 Bacteria 686
321 nmdc:mga0n895_23183_c1 3300050512 Bacteria 5831
322 nmdc:mga0n895_334292_c1 3300050512 Bacteria 1535
323 nmdc:mga0n895_471137_c1 3300050512 Unclassified 1267
324 nmdc:mga0n895_483853_c1 3300050512 Bacteria 1248
325 nmdc:mga0n895_607286_c1 3300050512 Bacteria 1096
326 nmdc:mga0n895_711992_c1 3300050512 Bacteria 999
327 nmdc:mga0n895_841931_c1 3300050512 Bacteria 906
328 nmdc:mga0rr50_19901_c1 3300050513 Bacteria 4543
329 nmdc:mga0rr50_377657_c1 3300050513 Bacteria 1195
330 nmdc:mga0rr50_983510_c1 3300050513 Bacteria 719
331 nmdc:mga08x19_181230_c1 3300050514 Bacteria 1438
332 nmdc:mga08x19_329771_c1 3300050514 Bacteria 1063
333 nmdc:mga0a205_123111_c1 3300050515 Bacteria 2493
334 nmdc:mga0a205_2288_c1 3300050515 Bacteria 16894
335 nmdc:mga0a205_236431_c1 3300050515 Unclassified 1709
336 nmdc:mga0a205_25002_c1 3300050515 Bacteria 5686
337 nmdc:mga0a205_50831_c1 3300050515 Bacteria 4002
338 nmdc:mga0a205_663534_c1 3300050515 Bacteria 894
339 nmdc:mga0a205_90205_c1 3300050515 Bacteria 2962
340 Ga0501084_0002131 3300054114 Bacteria 15819
341 Ga0501084_0002702 3300054114 Bacteria 14286
342 Ga0501084_0009008 3300054114 Bacteria 8256
343 Ga0501084_0019336 3300054114 Bacteria 5675
344 Ga0501084_0059207 3300054114 Unclassified 3206
345 Ga0501082_0000542 3300060353 Bacteria 33593
346 Ga0501082_0044731 3300060353 Bacteria 3819
347 Ga0501082_0068526 3300060353 Bacteria 3054
348 Ga0501082_0136450 3300060353 Bacteria 2129
349 Ga0501082_0237875 3300060353 Bacteria 1585
350 Ga0501082_0403944 3300060353 Bacteria 1192
351 Ga0530510_0000427 3300061734 Bacteria 27197
352 Ga0530510_0009786 3300061734 Bacteria 6728
353 Ga0530510_0041344 3300061734 Bacteria 3328
354 Ga0530510_0043620 3300061734 Bacteria 3240
355 Ga0530510_0503726 3300061734 Bacteria 918
356 Ga0530510_0877136 3300061734 Bacteria 685
357 Ga0501079_0011717
358 Ga0065707_10093749
359 Ga0070690_100029053
360 Ga0070670_101025395
361 Ga0068869_100347750
362 Ga0070689_100067955
363 Ga0070668_100619824
364 Ga0070669_100204747
365 Ga0070705_100191589
366 Ga0070705_100250213
367 Ga0070708_100001486
368 Ga0070708_100026836
369 Ga0070708_100094369
370 Ga0070708_100423250
371 Ga0070708_100520960
372 Ga0070662_101113844
373 Ga0070681_11192956
374 Ga0070706_100003492
375 Ga0070706_100156152
376 Ga0070706_100593438
377 Ga0070707_100015436
378 Ga0070707_100025522
379 Ga0070707_100048983
380 Ga0070707_100298732
381 Ga0070707_100933440
382 Ga0070698_100002361
383 Ga0070698_100012060
384 Ga0070698_100107642
385 Ga0070699_100001275
386 Ga0070699_100075523
387 Ga0070699_100111847
388 Ga0070699_100390347
389 Ga0070699_100576135
390 Ga0070699_100600338
391 Ga0070699_100756815
392 Ga0070699_100859597
393 Ga0070699_101552592
394 Ga0070697_100001135
395 Ga0070697_100007946
396 Ga0070697_100030817
397 Ga0070697_100167289
398 Ga0070697_100706164
399 Ga0070697_100734729
400 Ga0070697_100950767
401 Ga0070696_100265269
402 Ga0070696_100268042
403 Ga0070704_100243467
404 Ga0068857_100191693
405 Ga0068859_100081405
406 Ga0068859_100180224
407 Ga0068861_100732256
408 Ga0068863_100433168
409 Ga0068860_100031116
410 Ga0068860_100139356
411 Ga0068862_100024796
412 Ga0068862_100299525
413 Ga0068862_100558326
414 Ga0081455_10201969
415 Ga0081455_10252907
416 Ga0075428_100010899
417 Ga0075428_100036221
418 Ga0075428_100046444
419 Ga0075428_100092041
420 Ga0075428_100171850
421 Ga0075428_100244863
422 Ga0075430_100000519
423 Ga0075430_100001479
424 Ga0075430_100007976
425 Ga0075430_100027455
426 Ga0075430_100152503
427 Ga0075430_100240576
428 Ga0075431_100000709
429 Ga0075431_100002926
430 Ga0075431_100003064
431 Ga0075431_100004214
432 Ga0075431_100017399
433 Ga0075431_100154592
434 Ga0075431_100495251
435 Ga0075433_10005050
436 Ga0075433_10009870
437 Ga0075433_10049104
438 Ga0075433_10054136
439 Ga0075433_10119461
440 Ga0075434_100004407
441 Ga0075434_100020048
442 Ga0075434_100311846
443 Ga0075434_101522607
444 Ga0075434_101738929
445 Ga0075429_100000884
446 Ga0075429_100001356
447 Ga0075429_100004180
448 Ga0075429_100006482
449 Ga0075429_100015905
450 Ga0075429_100046800
451 Ga0075429_100382187
452 Ga0075429_100483521
453 Ga0075436_100161276
454 Ga0075436_100162232
455 Ga0075436_100434787
456 Ga0097620_100081414
457 Ga0097620_100180223
458 Ga0075435_100035902
459 Ga0075435_100096143
460 Ga0099794_10003565
461 Ga0099794_10066184
462 Ga0099794_10104593
463 Ga0099794_10156417
464 Ga0111539_10004456
465 Ga0111539_10031554
466 Ga0111539_10415305
467 Ga0111539_11258317
468 Ga0114129_10009826
469 Ga0114129_10017536
470 Ga0114129_10029796
471 Ga0114129_10045318
472 Ga0114129_10067201
473 Ga0114129_10073836
474 Ga0114129_10090119
475 Ga0114129_10182872
476 Ga0114129_10220181
477 Ga0114129_10541281
478 Ga0114129_10616625
479 Ga0114129_11122574
480 Ga0114129_11288377
481 Ga0105248_11000232
482 Ga0105249_10236504
483 Ga0105249_10457600
484 Ga0105249_10869130
485 Ga0163162_10532977
486 Ga0157375_10424784
487 Ga0207688_10618379
488 Ga0207684_10000645
489 Ga0207684_10000910
490 Ga0207684_10026031
491 Ga0207684_10128639
492 Ga0207684_10808304
493 Ga0207646_10000537
494 Ga0207646_10002242
495 Ga0207646_10025918
496 Ga0207646_10557310
497 Ga0207646_10927770
498 Ga0207706_10355410
499 Ga0207689_10023956
500 Ga0207712_10046688
501 Ga0207712_10088775
502 Ga0207712_10844461
503 Ga0207668_10812894
504 Ga0207708_11348915
505 Ga0207641_10354542
506 Ga0207648_10025333
507 Ga0207674_10023208
508 Ga0207675_100065969
509 Ga0209588_1006176
510 Ga0209998_10007698
511 Ga0209974_10064547
512 Ga0207428_10000049
513 Ga0207428_10028270
514 Ga0268265_10005994
515 Ga0268265_10050195
516 Ga0268264_10085325
517 Ga0307408_100209757
518 Ga0307408_100379140
519 Ga0307413_10172698
520 Ga0307409_100319877
521 Ga0373940_0029213
522 Ga0373940_0108454
523 Ga0373952_0046521
524 Ga0373939_0021055
525 Ga0373962_0056349
526 Ga0373931_0101564
527 Ga0395900_0024371
528 Ga0395901_0000999
529 Ga0242420_032482
530 Ga0242420_068825
531 Ga0439435_0128125
532 Ga0451577_0028739
533 Ga0453683_0012822
534 Ga0453683_0021524
535 Ga0451576_0055522
536 Ga0451576_0300683
537 Ga0495584_0212219
538 Ga0495642_0103396
539 Ga0495636_0479371
540 Ga0501033_0113955
541 Ga0501033_0145847
542 Ga0501036_0213739
543 Ga0501036_0354823
544 Ga0501036_0628112
545 Ga0501037_0064441
546 Ga0501037_0546300
547 Ga0501038_0152247
548 Ga0501038_0217390
549 Ga0501039_0055235
550 Ga0501039_0087645
551 Ga0501039_0112972
552 Ga0501039_0136224
553 Ga0501040_0009082
554 Ga0501040_0052705
555 Ga0501040_0054356
556 Ga0501040_0091216
557 Ga0501040_0252547
558 Ga0501040_0581007
559 Ga0501040_0871268
560 Ga0501041_0007185
561 Ga0501041_0017526
562 Ga0501041_0032353
563 Ga0501041_0079615
564 Ga0501041_0295663
565 Ga0501042_0031188
566 Ga0501042_0054979
567 Ga0501042_0063869
568 Ga0501042_0215129
569 Ga0501043_0276563
570 Ga0501043_0503984
571 Ga0501046_0010129
572 Ga0501046_0173035
573 Ga0501046_0255195
574 Ga0501046_0267192
575 Ga0501046_0318299
576 Ga0501046_1007245
577 Ga0501048_0070536
578 Ga0501048_0075783
579 Ga0501048_0251262
580 Ga0501067_0033958
581 Ga0501068_0016488
582 Ga0501068_0062814
583 Ga0501068_0661284
584 Ga0501071_0181295
585 Ga0501071_0779438
586 Ga0501071_0917991
587 Ga0501072_0004377
588 Ga0501074_0120793
589 Ga0501074_0139347
590 Ga0501074_0260052
591 Ga0501074_0323849
592 Ga0501074_1007731
593 Ga0501075_0006033
594 Ga0501075_0006944
595 Ga0501075_0021649
596 Ga0501075_0110876
597 Ga0501075_0156366
598 Ga0501075_0193553
599 Ga0501075_0196446
600 Ga0501075_0442398
601 Ga0501075_0746363
602 Ga0501076_0013647
603 Ga0501076_0037310
604 Ga0501076_0043358
605 Ga0501076_0044594
606 Ga0501076_0128116
607 Ga0501076_0150285
608 Ga0501077_0005121
609 Ga0501077_0014650
610 Ga0501077_0031281
611 Ga0501077_0077369
612 Ga0501077_0096286
613 Ga0501077_0419832
614 Ga0501079_0013115
615 Ga0501079_0028210
616 Ga0501079_0093643
617 Ga0501079_0118853
618 Ga0501079_0526765
619 Ga0501080_0031564
620 Ga0501080_0132873
621 Ga0501080_0317521
622 Ga0501080_0446952
623 Ga0501081_0001017
624 Ga0501081_0002907
625 Ga0501081_0005867
626 Ga0501081_0035132
627 Ga0501081_0038463
628 Ga0501081_0115704
629 Ga0501081_0160327
630 Ga0501081_0275834
631 Ga0501081_0302736
632 Ga0501083_0158563
633 Ga0501083_0263151
634 Ga0501035_0045006
635 Ga0501044_0558015
636 Ga0501045_0015540
637 Ga0501045_0043474
638 Ga0501045_0059536
639 Ga0501045_0191722
640 Ga0501045_0261839
641 Ga0501045_0424590
642 nmdc:mga05p37_121630_c1
643 nmdc:mga05p37_12432_c1
644 nmdc:mga05p37_144235_c1
645 nmdc:mga05p37_169196_c1
646 nmdc:mga05p37_19753_c1
647 nmdc:mga05p37_376153_c1
648 nmdc:mga05p37_4598_c1
649 nmdc:mga05p37_803156_c1
650 nmdc:mga05p37_828495_c1
651 nmdc:mga05p37_8301_c1
652 nmdc:mga05p37_93420_c1
653 nmdc:mga09592_1355_c1
654 nmdc:mga09592_13662_c1
655 nmdc:mga09592_15935_c1
656 nmdc:mga09592_233880_c1
657 nmdc:mga09592_24455_c1
658 nmdc:mga09592_26679_c1
659 nmdc:mga09592_5393_c1
660 nmdc:mga09592_559254_c1
661 nmdc:mga09592_90540_c1
662 nmdc:mga0qj67_118832_c1
663 nmdc:mga0qj67_21859_c1
664 nmdc:mga0qj67_4040_c1
665 nmdc:mga0qj67_62737_c1
666 nmdc:mga06r32_132274_c1
667 nmdc:mga06r32_222_c1
668 nmdc:mga06r32_350070_c1
669 nmdc:mga06r32_384006_c1
670 nmdc:mga06r32_43803_c1
671 nmdc:mga06r32_507443_c1
672 nmdc:mga06r32_6180_c1
673 nmdc:mga08y16_33899_c1
674 nmdc:mga08y16_518953_c1
675 nmdc:mga08y16_9569_c1
676 nmdc:mga0n895_1338704_c1
677 nmdc:mga0n895_23183_c1
678 nmdc:mga0n895_334292_c1
679 nmdc:mga0n895_471137_c1
680 nmdc:mga0n895_483853_c1
681 nmdc:mga0n895_607286_c1
682 nmdc:mga0n895_711992_c1
683 nmdc:mga0n895_841931_c1
684 nmdc:mga0rr50_19901_c1
685 nmdc:mga0rr50_377657_c1
686 nmdc:mga0rr50_983510_c1
687 nmdc:mga08x19_181230_c1
688 nmdc:mga08x19_329771_c1
689 nmdc:mga0a205_123111_c1
690 nmdc:mga0a205_2288_c1
691 nmdc:mga0a205_236431_c1
692 nmdc:mga0a205_25002_c1
693 nmdc:mga0a205_50831_c1
694 nmdc:mga0a205_663534_c1
695 nmdc:mga0a205_90205_c1
696 Ga0501084_0002131
697 Ga0501084_0002702
698 Ga0501084_0009008
699 Ga0501084_0019336
700 Ga0501084_0059207
701 Ga0501082_0000542
702 Ga0501082_0044731
703 Ga0501082_0068526
704 Ga0501082_0136450
705 Ga0501082_0237875
706 Ga0501082_0403944
707 Ga0530510_0000427
708 Ga0530510_0009786
709 Ga0530510_0041344
710 Ga0530510_0043620
711 Ga0530510_0503726
712 Ga0530510_0877136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8906 1 87
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.8496 3 82
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.7761 1 87
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7568 3 82
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7405 3 82
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8564 3 87 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8134 4 87 3.30.70.1060
af_Q5A784_25_117_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7533 2 87 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7502 4 87 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7463 3 87 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2V6ZH01-F1-model_v4 YCII-related domain-containing protein 0.9767 1 178
AF-A0A2V7HQT2-F1-model_v4 Uncharacterized protein 0.9705 39 178
AF-A0A2V7FJW8-F1-model_v4 YCII-related domain-containing protein 0.9674 1 178
AF-A0A1Q7GB76-F1-model_v4 YCII-related domain-containing protein 0.9647 1 135
AF-A0A538R467-F1-model_v4 YCII-related domain-containing protein 0.9643 2 178

Map